3MJ9H

Crystal structure of jaml in complex with the stimulatory antibody hl4e10
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
218
structure length
210
Chain Sequence
b'QVQLKESGPGLLQPSQTLSLTCTVSGISLSDYGVHWVRQAPGKGLEWMGIIGHAGGTDYNSNLKSRVSISRDTSKSQVFLKLNSLQQEDTAMYFCARHFYTYFDVWGQGIQVTVSSATTTAPSVYPLAPANTVTLGCLVKGYFPEPVTVSWNSGALTSGVHTFPSVLHSGLYSLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Junctional adhesion molecule-like
molecule tags Immune system
source organism Mus musculus
publication title Molecular insights into gamma delta T cell costimulation by an anti-JAML antibody.
pubmed doi rcsb
total genus 37
structure length 210
sequence length 218
ec nomenclature
pdb deposition date 2010-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj9H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj9H01
4DN3H 4RAVA 4GH7B 3VFMA 1I7UA 1P7QB 4PJGE 3V4PL 4HUKB 1UXSA 3K8MA 4I9WE 5L2KA 1K5NA 3MBEA 2EYTB 3SDYH 1MEXH 1A7QH 1YEIH 4APQC 3NPSB 4MAUL 3HA0A 2MQ3A 3DURA 4FFVC 5KVGL 3FQUA 3GJFB 1B4JL 1FVDA 5D7LD 3BZDA 1HSAA 4JKLA 4OSUH 5MERB 3W39A 4HWEH 5IHZA 1ORSB 4ONGL 4X83A 3EO0B 2B2XL 1CBVL 4NNYA 1GC1L 3EHBC 1T04A 1P7KA 1S3KL 1CVRA 1NLDL 3KXFB 4NIKB 2RHEA 4Q9QH 5L8LB 1JZ2A 3JWOC 5IFAH 2XZQH 2PUQT 1QRNB 1S7UB 1QLFA 3N1MC 3FT3A 1JPSL 2RBLA 1A9BB 1ORQB 2EIEA 3K1DA 3ZE2F 2AJ3A 4NFCA 3QFJA 3HS0B 4YDJA 5ADPL 1CLYH 2CLVA 3P77A 3GSUA 5F1NB 4PRDA 2NMSA 4MLIA 1CFTB 4ORZC 3S96A 1XGUA 2NY0D 4QYOA 2DQGL 5BZDB 3QZWB 4TRPH 2XT1B 3A6CL 3UYRL 1HOCB 4Z7NF 4MJIE 4NNPL 1I4FB 43C9B 5KOMC 4UQ2B 3ZE0E 3BWUC 4MQSB 3AY4A 2DWEB 5TH2B 1X5JA 5IJVB 3GMMB 1MFEL 1J5OL 4GRLC 3LH2L 3MR9A 4YBQC 5D7LB 3P0YH 1A7RL 4M8QB 2A6JB 3E8UL 3RNKA 3C09C 4PJBB 1N4XH 1TJGH 1BIIA 4UOW0 5EU4B 4ZDHB 3U6RA 3ECBB 3FT2A 3VXRA 1DBBL 4G6KL 5AEAA 2I60L 4ZAKD 1Y18A 3NFPB 5EZIH 3BP5A 4O4YH 2YPLE 1IGJB 1JJUA 5L8KB 5FUOH 3P2TA 2DM2A 4XCEA 4JRYB 4V1DE 5J9PA 1N7ML 2GKIA 3E2HB 1N6QH 3OB0H 1W0VB 4UB0H 5IVZA 3P4LA 5EBMB 4X7CC 2F8XC 4APQB 1FFRA 5CIPA 5GZOD 1S7TB 4KTEL 4M6ML 4F7EA 1L7TH 2R1WB 3X11B 4ODUA 3DTXB 2W60B 3RWHB 1W72A 3I50L 1IGIL 4KRMB 4NJ9H 1FN4A 4GAGH 4PJAE 1URLA 3HMWL 1MQ8A 2AEQL 4HBCH 4JFEA 3NIGE 5JHDD 2EYRB 4Y4KB 3W0WA 1UKQA 4FFYL 3HMXA 3T08A 4DOHE 4JDTL 3ZL4L 3SQOL 3TT3H 4Y8AA 3DGCR 2AJVL 1RMFH 3WE6B 2H1PL 3EDKA 4WFHD 4LU5H 4D9LL 4OQTL 2VABA 3V6OE 5IT2L 3BKYH 2WMPA 5DVLA 3CFBA 3WNPA 1Q1JL 2ILLA 5F7KC 1KACB 4WHYH 3S3PA 4BK4A 4OJFL 4J8RA 3RVTD 3KYMA 3D25B 2D7TL 4L4JA 1J1XH 4XB8A 4Z7UF 4UAOC 1CD1A 4BZ2H 5F1KC 3OPZH 4ZNEA 5B8CA 1OGAA 4M93B 1L6ZA 5SWSE 2R2BA 5JOPE 4JPVL 3L1OH 1HWGB 3U36A 3C9NA 5F89A 3QEUA 4N0YH 1VADB 4XMLL 4OUUA 3HZYA 4OCSL 2AGJH 1K2DA 1N8ZB 3QIBB 2CKBB 3VWJC 1PG7W 3MXWH 3QO1A 1SEBA 4JRXD 1RU9H 3AS1A 4OZ4B 3DX9A 2DQFB 3KLHC 3ARDC 1JHKL 4QHMA 4XRCB 4MHHG 3TCLA 1IC5L 2DS4A 3MJ6A 2VDPH 5IVXE 1OAYH 3TZVC 4UTBL 3S7GA 4U6YB 5I1HH 4PLKC 5B3NA 3FHQA 1JF1B 3DYPA 4FQ1L 4MA8H 3RWJB 3QDMA 4X7TA 5D1ZB 1NMBH 1W2KT 5MEQB 3PHQA 1OHQA 1F2QA 3VCLA 1QA9B 1UM5H 2FEEI 4TVPH 5CSZA 1U93A 3IS1X 2YZ8A 3MRRB 5CP3H 4FTVD 4XVUD 4WW1B 2ESVE 2HKHL 3KPRB 3RA7H 4PY8I 3FO1B 3IGAB 4WV1C 4H0IA 3V6ZA 3SDDB 3CD4A 4G80B 4Z7UA 2MCG1 2BERA 4I4WA 1DQML 3HG1D 4YWGL 1UACL 1MCSA 1S5HB 3VRJB 1KT2A 4PGCA 1YA5A 1A1MB 3QI9A 3SKJH 3QDJD 2EXWC 2R2EA 4IOIB 1LILA 5FYJL 4YFLF 5EA0H 1A6VH 1Z3GH 4KKAC 1M7XA 1RK1A 3PHOB 2NTFB 3PQYE 1TQBC 5KSVB 1YN6B 2NY3D 1P4BL 1NLDH 3WLBA 3E1F1 4QRRA 1CTOA 2QSCL 4XVSH 4ZOCA 5DURB 3AREA 4URTB 4EOWL 3TYGH 1QBMH 2JJTC 3VH8B 5D72L 4ZD3L 4OCRH 4KWUA 1EA9C 4G6KH 4ISVB 4W4NA 3ZT6A 1KG0B 4GKSB 2ARJQ 3EGSB 3FO2A 4PRAA 3QEQD 1H15B 1R5VA 4M61B 3VXQA 5F1IB 4C83B 3MRCB 4ETQB 4OZIE 1UADC 4GAYB 5HHPB 3ARXA 4JHAH 3WEXB 5C0AD 5H35A 1C5BL 1KJMB 4UILL 3VWJD 4G8IB 4C55A 4MJ5A 1D6VH 3C08L 4BH8B 2LAGB 2X4NA 4M6OL 3VRIB 1TZHA 2YBRB 2VITA 3UC0H 4HWBA 4QOKD 1I8LC 2X4RA 3E3QE 4R96B 4XCFL 3KYOA 2HRPH 4O2CB 1T0PB 5SV3A 1YZZA 2LU7A 1BX2B 1JWUA 4QO1A 4CVXA 2KZ1B 5FK9A 3MUJA 3MJ9A 1MF2L 1M05A 3WCYA 4M5ZL 4EUPG 3I6GA 2NY3B 4LU5L 4D9LH 1WFUA 3SKMA 1U3ZA 3NCCB 4ONGH 1OTUC 5GS2D 1OAXH 4GRWB 2VLJE 5CP7A 3BPLC 5IB2A 3LB6C 3ETBF 3MLSH 2BNRE 1T22A 1LVEA 1VCAA 4HV8A 5BMFL 2Z8WC 1UWEL 5DHYB 1A6PA 4FG6D 4HBQA 4X5LA 3UJJL 2ADFH 1CFBA 3JWOL 4FFWC 1X5FA 4JPVH 1WCBA 5I8OH 2BVEA 3GRWL 4KK5C 3HC0A 5IGXL 4NO2A 4FOMA 3O6ML 1HINL 2VB5A 4HF5L 2F58H 3MLVH 3C5ZD 1PAMA 5AZEH 1GPOL 2HFGL 1U41A 2JCCB 3N1GC 2YPLA 4WFFE 1HKFA 1I7RA 5I73C 1YEGL 1J9CT 1I85A 4IS6B 1MWAL 2BNUB 2EIDA 3TBVA 4JQIL 4HUWB 3CMGA 4P2RA 5H2BB 3STLB 5HPMA 3KYKL 3V6BR 2OXGA 3C6LA 1X5YA 1OARL 3HR5B 4G9FA 1NDGA 1QFWH 4WI6A 3KVQA 2Q6WB 4UDUA 4Y4FA 1UM5L 4E0RB 3IAGC 1LD9A 3ULUH 1I1RA 3EDJA 5BO1H 5K9KB 4Y2OA 3U0PA 5BVPH 2FH8A 3VG0H 2IALB 1AXIB 5I76B 3ULVD 1ZLWK 3PL6C 4Y7MA 4P59L 4BQ9A 4P46D 1RJCA 2PO6C 5SX5K 4U0QB 2VDPL 3IAPA 4PGEB 1CD8A 3BSZL 4LCCB 3U9PH 3DI2B 3UBXG 2VLLA 1T6WA 1ROWA 3GSVB 5IEHB 5EZIL 4UQ3A 3WHE1 5FA3B 3HKFA 2ZG3A 9CGTA 3H9YA 3OKYA 2W0PA 4KY1H 5CMAB 5DJ8A 1PKQB 4I3SL 4PJ7F 5DFWH 5C0BA 4KVCH 4PJ5A 5BOPA 4XCNB 4HIXL 3U0WL 1B2WL 2XWBA 4MDIB 4X7DC 3ZKXB 4BSVA 4M5YL 1NEZB 2DM7A 2NY0B 2WLZA 1TQCC 1G0XA 3ARUA 1FV1A 3MV7A 1IKNA 5T33H 5F44A 2QJDA 4FQQB 3VG9C 2F19H 4FZ8L 4JPWL 2ENYA 4K3HA 1TTFA 4NQSA 5AUMA 3U4AA 3VXTB 4FFWD 3ZE0F 3S5LB 1NGYB 5LGJB 2DQTH 4ZO6A 4HKBA 5JW4Q 3RGVA 2FB4L 4K9EC 2F54B 5GGTA 3OKLB 1JZ7A 3C5JB 1A6WH 3EUUA 4ZTOH 1SYVA 2R0ZH 1QHOA 3CLFH 4WW2A 4GO6B 1Z0MA 2G75B 4IMKC 4KQ4L 1KLGA 4PBVC 2AXGB 4XI5C 5E2JA 3SGKC 3TIDA 1ZSDA 5IW1B 3PNWA 4JO4L 3UTSD 4X0KB 4E41E 3U79A 2C9AA 2R1YB 4WUKL 4NT6B 1CGSH 3IB4A 1RZIB 2DMBA 3BKMH 3Q48A 4WHTA 4BKLB 3ILQD 3T3PF 2EC9U 4Z7OE 3G5ZB 1J0JA 3G08B 4KK9C 4RGNE 1A2YB 5JHDE 4XXCC 4JQXC 2YD3A 3ARGC 3KPRE 4UBDD 1N64L 4HWUA 1G7HB 1WAAE 4G7YH 4R97C 5JLZB 2GAZB 1LEKB 1RHHA 4N0UA 3NFSH 1YYLH 3TYFB 4EN3C 5EG6C 3GK8L 2EECA 3O8XA 4OQTA 4JRXA 4R4ND 5I1LA 4B0MM 4PRNB 2FWOA 2HKHH 3O3EB 1UM4L 2M2DA 4NKMA 4K94C 1HDMB 1UWXH 2J8UF 2BC4B 3QG6B 2CMRH 4LPCA 1H5BA 4P49A 5KOVC 1NFIB 1T0NB 1ZLUK 4J3VA 4UZGA 3W9DA 4AYFA 2BXYA 2XNAB 1DDHA 4KJYA 1F4XL 3KDMB 1DBMH 3WN5A 5GS0L 1IM3A 2P44B 4ZSOA 1MJ7H 2WINA 4Z8FH 2A6IB 3CIQA 1R3KA 4NPYB 1CGWA 1YJDC 3SOBH 5J6GB 3A6BL 4P9HH 5JZ7D 4PJDE 3WXWL 5EOTB 4K7FA 4Y4HC 4ZUTA 1CICC 1JGVH 4YBLC 4KFZC 3V5DB 2HH0L 1YNTB 3EOTH 5DEGB 1QFOA 1FLRL 2IAND 5FHAH 3ZKXC 5IEKA 5IIEB 2NY4D 3EOAB 2D03L 3CDGA 4JY5H 4AY0A 3SDXB 5D1XD 4JQVA 2XXMB 2F58L 4ZD3H 2GK0B 4W6YB 3NIDE 4EXPX 1LDSA 5HGAB 2DTML 1MHPL 4DKFH 4YGAB 2XZZA 5DUPL 4U1SB 3SCMD 1QQDA 3JV5A 4GRMB 4XPGL 3GJEB 4DEPB 4OKVB 4GG6E 3MLWL 1ADQL 3PGDB 3GIVA 3BSZH 1C5BH 1KIQB 3SE4C 2QEJA 5D7KD 2JK5A 4LRNL 4KV5F 4ZPTB 4WWKB 3KYKH 2CGRL 3L3IA 3LKSB 3PUCA 2XIDA 4B41A 3KXFA 3FQTA 4NN7C 4EI5B 1FLTX 2ZOKA 4QRUA 5AG9A 4NC1E 5GRUH 3BUYA 5KSBB 3D9AH 3DUUA 3QFJE 4NRXA 5GS3A 3QQNA 1U8OB 5JOEA 4MD4A 4UT9L 5D70H 3QIUC 5FF6A 1FH5H 4MJIA 4O02L 5E1HB 5C0EA 1XF2B 2VE6A 5IW6A 1ZLSH 3VXOB 1QP1A 5EORL 4R97B 1I1YB 4WTZG 5H37G 1DN0B 1PQZB 2FNBA 4U1JA 3HI1A 2LU3A 2BRRL 3CFKA 1TDQA 2H32H 1TVHA 4KK6D 1XCQA 1BZ7A 4PD4K 3JTTA 1XR9B 1AKJD 3ZYJA 3IDNB 1A3RL 4P2CG 1ACYH 3D0LB 5DMKA 2R0ZL 3BN9C 3CLFL 5EU4A 1H0DB 1J18A 4J3TA 4ODSL 2FGWL 4OFYA 3BX7C 2IF7A 3SGJA 1CE6B 5TFSH 1I8IB 5TE4L 4V1DA 1Y18B 1SMOA 3FRPG 4P3CL 4JRYD 5J1AA 5TQ0H 5DJYB 4C4KO 2GTZA 1AGEB 4NC2B 1HSBB 4JZNA 4KROB 4UUJB 1EXUA 3JWOH 5GIRA 1YEGH 3GHBL 2BVUA 1UZ6F 4GJTB 4NZTH 3SO5A 3JTSA 2XQBL 3GSNA 1GGBH 1JPGB 1WBZA 1S7TA 4R4FL 5C08A 3MA7B 1R3IH 3A67L 2L7JA 1RIVL 3F7VA 3SGJC 4PRHD 3ORJA 1DL7L 5D5MB 4N1HB 3QIWC 3D39D 3BT2L 5I8KL 5FECB 1ZA3A 3T2QA 5J11B 4NN5C 1DVFD 1PKOA 3ULUL 2Z31B 1YNLH 3FO9A 4OT1L 4OD2B 2XA8L 1T1WB 1J87A 1GGIL 3M17A 5T3ZL 4Y5XA 3TV3H 4PP1C 4MAUH 1HHJB 3RRQA 5DD6A 2J4WL 4S2SB 3UAJD 1BQHG 4QNPF 3CLEH 2EKSA 5DMJB 1X5XA 3VG0L 4DAGH 1MQKH 2NXYB 3LEXA 3OAUL 2A83B 4PY7A 3ARFA 3D5OF 4LIQH 1WFNA 3BMVA 4P2QB 1JTOA 5F9OL 3HRZB 5BJTB 2WWKT 4KY1L 5TE6H 2W9LA 2PO6B 4NWTL 2ZKHL 2NXYD 3MRDB 5JORB 1P4LB 5EO9A 3L5HA 2GY5A 2O61A 3WFBH 5D5ME 4MDJA 1CQKA 1JWSB 3QQ4A 1JPSH 5C9JB 1AY1L 5CJ5A 2ZUTA 5E99L 1P2CB 1GJIA 2OTWB 1ZVYA 4Z7VF 3ZHDA 1RULL 1CLYL 3KPOB 1CGXA 4KVCL 2FBJH 1CK0L 1TJHL 3HUJE 4ZO7A 3VXUA 1MY5A 3RDTB 3MV9D 4ZO9A 2F9BT 4XAWL 1FNHA 1MHPH 5TPWH 4DKFL 2D2OA 2JELH 2JJVA 3EDEA 5HHQB 5KJRL 4OB5H 1X5ZA 3W11C 2UY7A 2B1HL 3ARSA 4JO1H 3WUWB 4P2YA 1NANH 1CI5A 5F88A 4FZEH 5DA4A 1RUAL 3NIFE 3RHWK 3MFFA 1YQVL 5FHAL 2X4TA 5B21A 3O2DA 5IESH 1OP9A 3QEHB 1GL4B 4L1HA 4F9PA 4BH7A 4LASH 5HHXH 4XX1E 3TBSA 4Z0BL 3GMQB 5GS1B 3SCMA 1KLUB 2ZOLB 3SDDA 2NY1B 5D70L 4WUUD 5HVWA 2R69L 5ICYB 2HJFB 2PYEE 4G9FD 3V0WH 2GW5A 1MSPA 2O5XL 5KSAB 1DBKL 4U49A 3UTZA 3GKZA 3BO8B 3BPLB 3Q6FA 3SDDD 2NY6D 5D2NC 1AI1L 1H5BC 1INEH 1MAML 5HDOA 1MPAL 4XWGL 5CGMA 3KYNB 2ITCB 4U31A 3MYZA 4YHZL 5C2BL 1WEJH 4JPKH 1QO3B 5J13B 5J1TC 5E5MA 1BD2D 2OR7A 4ZFFB 2GJZA 4LCIH 4GUPB 4Z77B 1OTTC 3FHAA 5F71A 3D39B 3VH8A 2F5BL 1EGJL 4MVBD 4BQBA 4UMGA 4UTAH 1VFBA 4PJ8C 5I19H 2EH7H 4NOFA 2FJHB 1I1AA 4KKBC 3DGGA 3D39E 3ARGA 4RX4A 1QFWM 1U8NA 2R4RH 4JPIB 4PJFB 4LPUA 1OP5K 3IFLL 1QVOB 3MOAH 43CAB 4O02H 1HHIA 3O3BA 4P57B 5IB4A 3V5KA 2EYSA 1CT8A 4NRYA 4PBWD 2P5ED 4F7PB 1WBYB 2AXFA 4XH2B 1ZLSL 5D7SH 4ZFOL 2CKNA 3CPLA 2ATPB 4WI2A 3UEZA 2IH3A 3F7PC 3G5XA 1PLGL 2CLZA 3GNML 5CJQL 3TO4A 5AD0A 2BY3A 2D7TH 1OGAE 3NMEA 4EUPA 4Y16B 3GM8A 3SGKA 2DQGH 3T3PE 3FAXA 1SJHB 1UYWH 5HYJB 3A6CH 3DRQA 4WW2C 4L4VD 1JWUB 5D2LA 4Y2DB 2WIIA 1NSNH 3ZDZF 1IM9A 3NGBC 1RVFH 3U9UB 5L7XL 3QWOA 4IIQA 3HMXH 3RPIB 1GGIH 4MNGB 5E00B 1B6UA 5CJBA 1O0VA 1WBXA 1A7RH 4HUVB 2MHAA 4WTZA 4D9QD 1TJGL 2NW2A 4ZTPL 4PJFE 3C5SB 3PWUB 4YDIL 1D5MA 2VDQL 3T1FB 1AIFA 5IK3B 1JIBA 1JGLH 3SE9L 5CBEA 3A67H 4K3JL 4H26A 3ILPB 4HV8B 2ZCHL 3QFDA 1Q0XL 4UV7L 2YWYA 1TENA 1EV2E 1ZVSB 1GHFL 3BT2H 5EH1A 1FZKB 3T65B 3QUXB 5M95B 4NCC2 3BPOC 5LQBH 3G04A 2HT4D 2D7MA 3BKCH 4P46C 4QY8A 3GUTB 2ICEB 4GRLB 3DROB 4PGBB 4FQXD 2O26U 5D7JB 4ESKA 3NPZB 3QCVH 5KVDL 4P2RE 5EORH 3GGWB 3CDFA 4MNGE 1DBBH 3CH8A 1QBLH 2H6PB 2NX5A 1BMGA 2OQJB 2JJWA 4V1DD 4MA7L 4WI5A 1KJVA 1CYGA 1IC7L 4NHUB 5C0JB 2A6KB 5DJCB 2RQ8A 2HMIC 2YPLD 1IGTB 4TUKH 1YN7B 4XCYB 4DZ8B 4JB9H 2GT9B 5HDQH 4JHBA 1KV3A 2WNGA 3LSOA 1P4BH 1NMCB 1NL0H 1MH5A 2XKSA 3CVHH 1ES0B 5F7NC 1BQHB 4BQ8A 3C6LC 1AO7A 4M7LH 1BM3H 1E28A 2D3VA 2JCCF 1IGIH 3K8KA 4O5LH 5KS9E 4JFOB 5DJ0B 2IEPA 4Z0BH 3RUGB 1I85C 3QPQC 2ED8A 1XAUA 4G6AC 5C6WH 3MJ7A 3KJ4B 2OCFD 2OI9C 1NC4A 3Q5TA 3SQOH 2AQ2A 2HVJA 3ZKSD 1IAII 3P9LB 1CZ8H 4W70A 5E4EC 4XI5D 3MRLB 1MUJB 4Z9KB 3CUPB 3CSYB 4PJ5B 3QDHA 1WEJL 3BZ4A 5EPMB 1XCTB 5A2KH 1NUDA 1YECH 3KNBB 1ZANL 3BW9A 1YEDA 5JO5A 3D2UA 1I9JL 1JRHL 5DJAA 3D0VB 5J06A 1SJVA 1W0WB 2P47B 4LSQH 3CLEL 3BAEL 4ZOAA 5C07D 1QFHA 4NZRL 1FVCA 5F9OH 2DJSA 3PABA 3VGGA 4YHLH 1FHGA 5E94B 5JW4N 3PWPA 4RZCB 1RZKL 1U9KA 2YEZA 4PJXE 2FR4A 1A7PL 2BOCB 2COQA 1NAMB 1ZSDB 2A2QT 4P46A 5ALCH 1W72H 1Q94B 2ZUWA 2ZNXA 2QADC 2WP3O 1D5BB 1D9KA 1RVFL 4G8EA 5JHDA 1RAMA 4P4KC 3LQAH 3U4EB 1PEWA 3HNVL 5B39G 2VC2L 1A2YA 5IOPA 4QF1A 4X6DE 2X2YA 5IHUL 3O11A 5D7SL 3LN5A 8FABB 2X9YA 3QUZD 1DLHB 3REVB 1EZVX 5EBWB 4PJEF 3X12B 3IRZA 3QCTL 4L9LB 5HHMB 1IILE 4U1HA 1BAFH 1RHHB 3U82B 2BDNH 1JI2A 2UWEE 1QFWL 3D3VA 3MJ9H 3ZDYE 3KR3H 2XPGB 4Z7VE 5HHXL 2XG5A 4JG0H 1CQYA 3MRIA 3QUMB 1D9KD 4AIZA 1QSEE 3QEGH 3BKCL 1G6RA 3UPCA 3BP7B 4WHCA 5DQ9A 3B6SB 4FZEL 4GRWE 4HK0B 2V9QA 3RKDC 1F90H 2EH8L 4RNRA 3RL2B 5IESL 1QKZH 1NFDE 5L8JB 2R29H 3G5VA 4IRSB 4XGZB 2HFFA 4KMTL 4TSCH 4Q6IB 2YA1A 5C0ND 3WKNA 2EKJA 5L2JB 1YPZE 4TULH 3RIFK 3GMPB 3S98A 2VN4A 4K7FB 4ZUTB 5CD3A 3C2AH 3TFKD 5IMLA 5ESAA 4R90L 2O93L 2HFTA 4JKPL 5EU7E 1WJ3A 4LF3A 5DJ2A 2D4FA 4DK3A 3V5DA 2DL9A 4LVOB 4MQXD 5DC0A 1KIRB 2OTPA 2I27N 3H9HB 5IV2B 2HKFL 5C9KA 5IIEA 4PJ8A 2VDLL 3I6KB 2F5BH 2W07A 4N8CL 1LP9E 2XTJD 1OAKL 5D2LE 2P8LB 4Z7OF 4Y4HD 2Q1EA 5E8DH 2YUXA 4WHYG 1IL1A 2DIBA 1JPFB 3BVNB 4OGZA 4YIQB 4U1SA 2D0FA 3LN9A 3WMSA 1JZ8A 2BHUA 4AG4H 3ARDA 3OKDA 2ATKB 1R3HB 1WISA 2BNQE 1VERA 3BEVB 2JK5B 1Q9LB 4PB0H 1MI5D 1MRDH 2QADD 4C4KT 3VWJA 1C7SA 5DRZB 4JFQB 3QPXL 1QFWI 5ETUB 3V5HA 4JFHE 4WW2F 5D6DC 5C0AB 3ARWA 1CWVA 4I0PD 4YDLC 2R4SH 1RIHL 3MCLL 3NAAH 3SCMC 2AABH 4JQIH 1A6ZB 1SBBA 1KCRL 1VEPA 3BJLA 4CADA 4EIZC 4MAYB 5TDPB 4JR9H 4L3CB 3MCKA 5B4MD 2IBBA 3RTQB 2J1KA 1NCWL 5CJXC 3OBAA 2V7HA 2X4OB 1A0QH 4XPFL 5JXEA 4H8WC 2VLJD 2DI8A 4GOSA 4OCLC 4FS0A 3FT4A 4I5BB 2BCKA 4OQ1A 1TVHB 3T0EE 2YMXH 3LMJH 4DW2H 1KCUL 3HZMA 4ZOBA 1F2XK 1YMHB 3MOQA 5IMOB 2VIRB 4UNTA 1K8DB 1NGQH 1BLNB 3QDGE 5MEPA 5HJ3B 3GK8H 4YHPA 4HKZB 4R2GD 3OL2A 1Q9OA 3DX7A 3LZFH 4PP1D 2Y6SC 4N8PA 3SDXF 3LKOB 2YWZA 3F65A 2NXZC 1OSZA 3TFKC 1SEQH 5DJYA 5DUBA 4GW1A 2IPTH 4KK6C 5EU3B 3MRNA 3LQAL 5GS1C 2FX9L 1U3HB 3L3HA 4PGDA 2ZZUT 5CZVH 3QEQB 3ARFC 4X6CA 2VC2H 3L3OB 3FZUD 3G6DH 3RIAK 5CSGA 4PV9B 5J3HC 4LMQE 3ULUD 3OGCA 5KS9B 3CAFA 1I3UA 1P6FA 3WO3B 3BMWA 3TJEL 1CTNA 5C08D 1MI5A 4NO5A 3DXAB 5FB8B 4LEOB 3NZ8A 3RDTD 1IFHL 1G1YA 2QBWA 5F3HA 1FBIL 4NSKA 4E5XA 2WUBH 1QSFA 3GMOB 4PIRF 1SYSB 4WUUE 2VAJA 4Y19A 3LKQA 3MBXL 3WSQH 3OTTA 3J8F7 4XVJH 1X5HA 1CU4L 5DTFA 3WD5H 3ULUC 4LSSL 3S36L 5LCVH 5CIPH 3O4OC 3AMLA 1EMTH 2P42B 1U3YA 4M5YH 2FHCA 5CBAB 25C8H 4LLUA 4P2QA 2ZCLL 3WL9A 1MCRA 4WGVB 5CUSL 1GOHA 3KXFE 1N59A 1DUYB 3HLAB 3PWPD 4RWYL 3DO7A 3PP3H 3MZTA 1ND0A 2J8UB 3B3IB 1LDPH 4I77L 1E27A 2FB4H 3HAEB 2HKFH 3WFDL 3HE7D 4J3SA 3LY6A 2F15A 1CZ8L 4YGVA 1TIUA 1FNGA 4JLRB 1MCNA 3HFML 1RJZA 2DAVA 1NJ9A 3KPOA 3CVHB 5CGYD 1IC1A 4LLMB 2RFXA 3OX8A 1KB5B 3KLHD 2EC8A 4U6XB 2VERN 1CLCA 4XZUB 3BESR 1AXSB 3O3UN 4NQEB 3P9WB 3O3AB 3F8UB 4ZUSB 2NW3A 5EO0B 2I24N 5F97E 2Y6SD 3WIHA 5C0FA 1OTSD 2XKNB 4NM4L 2NY2D 5FCUL 1MRDL 3LQZB 1YDPB 1K4CB 4X7EC 1G84A 2A74A 4YPGB 3IAQA 1CF8L 3FFCE 1QSEB 2DN7A 4NKQB 3QIUA 3QEHA 5FOBA 2UWEA 1RZGB 1SVCP 1INQB 1P84J 2FIKB 3RWEB 1JN6A 3KWWB 5GS1A 4XXDB 1JGEB 2H3NB 3QHFH 5ISZD 1S3KH 3CK0L 1T03H 1H9VA 1H8NA 1MJUL 3QXDB 3MLRH 5HHOB 4DVBB 5EZOL 2DKUA 5I8CB 1BEYL 3GB7B 3IFNH 2R23B 1KELL 1MJJA 4PRPE 2HTKC 3QNZA 1JHTA 3N9GH 4N90E 4MXQD 2GJ6B 2XYCA 4XP4L 4AZ8A 2R2HB 4QKXB 4XNXL 4GXVH 5BVJA 2WBJD 4P5MB 4CJ0A 4WFHE 3CFIC 3MROA 2QSQA 3RIAF 5L6YH 1GZQA 1WICA 5CWSA 3U0TB 3D39A 2KBGA 1IZKA 1VFBB 3QDMD 4LIQE 4NKIH 4PJ7A 1LP9A 3GKWH 1U8NB 1CFSA 3B83A 3T4YA 2VDRL 5CEZL 4CN1A 3KR3L 2D31A 2ZSWB 1WC7A 4OGXL 3VXSB 3P73A 4PJ9D 2L0DA 4DUXA 1XF4B 2DQEH 2IG2H 4FQ2H 3EYOB 3UPRA 3RZCB 4DVRH 2PTTA 4IIQC 1BOYA 2HT4C 1I9IL 3F6IA 5D6CB 1N6QL 3TN0B 3MRGB 5F70A 2NY1D 1D7FA 3TZVB 5J0BA 3L3GB 3V8OA 4Y2DA 1YEEL 5FO9B 2Y5TA 3WFBL 4J7RA 4XP9H 5IFHH 1FBIH 5DF0A 3TT1H 5BS0A 4JAMA 3R8QA 2C1PA 3BPNC 3UMTA 5DGQA 3CJJA 1T1XA 3RX7A 1I8MA 4OM0H 4PRHB 4CVZB 4QHUA 5HD8D 2FX9H 4OBSA 5JW4M 1T7VA 3P0GB 1F3RB 4ZS7L 3FOMB 2AV1A 2EXYC 3T1FA 4RMRA 5TE4H 2X5PA 1FL5B 4D2NA 2MPAL 4JQXA 4YXLL 1I1AC 5FGRA 1K4DB 3BHBB 3MLXL 4S1DD 1G6RL 3SJVA 4LCWB 4Y4HB 2MJWA 3EJZC 4YDLB 5SX4I 4FXKB 2E8ZA 3B9EA 2XOTA 5TE7L 4LASL 1KC5L 2AEWA 4WDIB 5E03A 5HD8C 1C5CH 1QLRB 1UCBL 1VKXB 1KNOA 5JQHC 3GI9L 4HH9A 3GGWA 4IBLT 4U1GB 5KTEH 1SM3H 2CLRB 4NZUL 3SGEI 3V0WL 1KCRH 1FIEA 4Q7DA 3WLWC 1BFOA 3TNNB 3S9DB 5ALBH 2Y1VA 4LSTL 2W9DH 5LBSH 2A6KA 5HYSB 2HVKB 5CCKL 3LSOB 4NO0A 4F7MA 2IANA 1Z0NA 1ZXQA 3LCYA 5D7IB 4DN4L 4LVHB 1ZHNB 2VAAB 1U8JB 4I2XA 1MLCB 4MD0B 4EVNB 2N1KA 3MBEB 1A1OA 4JFOA 5DJ0A 3T0VA 4UIMB 2WANA 5DD3L 1V05A 5GISL 1Y6KR 2X4SA 2WW8A 1DBJH 3VD3A 5DFVD 1RFDH 5EU7C 2Q76A 3ZDZE 4NQDD 3IDXH 5DMYA 1QRNE 4HX1B 3IDJA 1XGQA 5GGRB 4A6YL 5LXGL 3TV3L 4JRWA 3QCUH 1JV5A 3IFOB 1CFVL 3C6LD 3O6FD 3GNMH 5CJQH 1R24B 4WU7A 1BVKA 3S4SG 1RUML 1CL7H 3GMLA 1T04B 1TJHH 1U58A 3INUH 1KPUB 3FOLA 4C59B 3PF2A 4XCCH 4XPHL 5FA4A 2VYRE 3QDAA 3X13B 5ILTL 4XNUH 5E8EA 4EXKA 1TETL 4OFDA 4RGND 3BKJL 3HI5H 3V79C 3IXAA 2Z91A 1FE8H 5KSBE 4XAKE 1I1AD 5CILH 3MV9A 1HHHA 1I7UB 4P5TB 4S1DC 4F2MB 1TQCB 3L9RB 2FX7L 3KPSA 5I15L 4PRDB 1DLFH 1W0WA 1H3PH 5BZDA 5M94B 2ED7A 1MVUB 2F53E 3TYGL 3QXUA 3KPNB 5DLMH 3IFPB 4LDOB 3D85A 4LLDB 2V2WB 2FBJL 4GS7C 4JDZA 3KPLB 1L0YA 2ZUXA 4RA0C 5TQ2L 3V52H 3NZHH 2QR0A 3WJLA 3GMNB 1E4XH 1JNNH 4UV7H 3S36H 1E4WL 2CKBL 2O5XH 4TNVF 4BFEA 4J3XA 3F12B 5EU5B 3VXRE 4KUZH 4KZDL 2B20A 3U6RB 3ULVF 1HHGB 5B39B 4YHYC 2B1HH 5HGDB 1JTTA 4KQ3H 3N85L 4RGOH 3PJSA 2W38A 4XP9L 2NR6C 1U8MA 3BD4A 1JMZA 4OD3L 4K3DL 3V0VB 3VU2A 5FKPB 3T4AA 3FFCD 4XCFH 2B5IC 2MTPA 2HP4A 4NJAL 5J9PB 3RHWF 2DL2A 3GSNL 1U8QB 2EC9T 5CKAA 3SGDH 3ARGD 3MA9L 1BVZA 2BNQB 4PG9A 1EDQA 4XP5H 3BN9D 2GCYA 1M71A 2AJ3B 1VFOA 4HQQH 1LK2A 4D9RE 2QKIB 4P9MH 3UO1H 3MRPB 3FTGA 1NC4D 5CS7A 2FHFA 4M1GL 4P4KD 4KKNA 3BYYA 3VFVB 5C7XL 4L1DA 3C8KB 4Q2ZA 5C0RH 2VDKH 3MREB 3PXJA 5I2IA 5EBGA 4R3SA 3W0WB 1DBAH 4NM4H 5IQ9B 2DLFH 1YEJH 3L3JA 3ZHLA 1FYTD 2PW2A 5BRZD 3BH8B 4HGKC 2OSLA 4HK0A 4OCYL 1S7RA 2X09A 3WE6A 2J8OA 4L3EA 1FO0L 5ESQA 3GO1L 3OZ9H 3M1BB 5KTEL 1WTGT 1YY8B 1RUQL 4NZUH 4OZGB 5GSRB 4PRIA 3SBWC 3HMXL 4WU5B 4Q9RL 3UTPD 2X4PB 3BP5B 4X9BA 1IGFL 5KSAD 1CD1B 1MAJA 1Q0YL 1EFXB 4N0FA 5T1DH 2A1WL 3LHPH 4GRLD 5B4MC 4G8GE 1W0VA 3U36B 3I6KA 2XICA 2VDQH 2NY4C 2GSIB 4HXAH 3B9KC 5C0NC 5E8PA 4J3OC 1IAOB 4LKXA 3GKWL 4LCUA 1ED3B 5I17A 4A6YB 3WIHL 1CG9B 5BS0E 3QWQB 1O7VA 5I1IH 3T8XB 2K7PA 5K9OB 2X1OA 4H88H 4ODTH 4ONHA 4YK4B 3H3PL 3MV11 4FQCL 2UUDH 5GSVB 4CU8A 1KTLA 1UENA 2VQTA 1I9EA 3PDDA 1HYSC 3BQUC 3O2DH 3W2DL 2YPKB 5MEQA 4U05A 2HJLA 5CEZH 5HHMD 4O2EA 5D1QA 3H8NA 1NDMB 4YDIH 3C6SA 5CJXA 1MJ8L 4H25A 5GZNC 2R9HD 1JGLL 3KYMB 1JBJA 5JA8B 4L8SA 4TSBH 3I75A 1RZJL 5B8CB 4ODWB 5T3XH 2R15A 4G80A 1CFQB 4Z7UB 5BV7B 4X6DA 5J3HD 3OR7B 1VGEH 5E8NB 3EDFA 5LGHL 4LSRL 4LVEA 5IFHL 2NCMA 5KANI 4NKDA 4EBQH 1KT2B 4GRWF 2XN9D 3RVUC 1ZHKB 3QDJB 4OLWH 3HZMB 1QRKA 1Z9SA 1RK1B 3PHOA 1MIEH 3CCHA 1G7LB 1K8DA 3RP1A 3TCLB 1HI6B 1MLBA 1QBLL 5D2NA 5INCB 4RFEA 1QEWA 1JNNL 2YRLA 3JV4B 3O8XC 4F80A 1JPTL 2B0SL 2YD6A 1UCTA 4XBPA 3GSRA 2X89A 4EN3A 3WBDA 2UWEF 4F8TA 1NC2A 2XWTB 1SY6L 3U2SB 3QEGL 4RIRA 5F6HJ 4ZMAT 3MOBH 3VGFA 4U6HB 3IJYB 1DE4B 5HDBE 3GBMH 2QHRH 4NUGL 4OZIA 3MRMB 1RZ7L 3QH3A 3L3OA 3CX2A 4L8SC 2VXSL 3ZKND 5BQ7B 5D7IE 3JBG7 2V2XA 3OGCB 3O4LD 4HS6B 3SKNA 4M00A 2ICES 4U7MA 1AQKH 2FBOJ 4LBEB 3GHEH 2H32A 1EO7A 1L7IL 4PUBL 3V52L 2ZUUA 5C0CD 5ICXA 4WTWA 4KXZH 5ITFB 1YEHL 2VITB 1QSFE 4ONOA 1J8KA 5EO1B 4JDVA 4HZLB 4O2CA 1OD7A 1JP5A 1WWWX 2IBZY 4K2UH 1A1MA 1P4IL 2VKWA 2E9WA 2XTJE 4LPYA 3NA9H 3FRUB 2Q86A 2O5YL 5KW9L 2BY1A 1OAKH 2VLKD 2LTQB 2HJKB 3REWB 5FO8B 4GKNB 4PJIF 5DHXB 5KSVA 2FYYB 1YMMD 4NFDA 4Z78A 5KBNC 2CK0L 2YR3A 4YZFE 3DMMB 3VFSA 3AREB 1Q1JH 3SKMB 3QUML 1YECL 1U0QA 4XMPH 4P23C 4TUJB 3RI5K 3L3DA 1EEQA 1IKNC 5I1JH 5E9DB 5T1LB 4OAWA 4FXGB 3UTOA 3ULVH 2AJXH 5TDNB 2PYFA 5MI0B 3OKNB 2VL4A 3LKRB 3F5WB 3DYMA 4OZFG 4Z8FL 1FNSL 1ND0B 2J8UA 3GI8H 5HGHB 2A1WH 3G6AA 4EQ2A 3MYJB 3MRCA 3SBWA 4Z6AT 4OCSH 4L29B 5JHLL 3MCLH 4U0RB 1OSPL 5FKAB 5E4EB 3WHXA 4R8WL 4K8RL 4D3CH 1JGVL 1PX4A 1U8HB 3LN4B 3O9WC 1RZKH 3CVHA 3S37H 3FQXB 4EI5D 3WIHH 4X9GA 2X4RB 1OT2A 4M6AA 4RFOH 2WBJC 1K3IA 4RSVA 1X5KA 1T21B 5GRXG 4NRZB 4RMSA 4FA8A 3FONB 3AY4C 2UZIH 4BSJA 4JKWA 1UWGL 4FQ1H 3SDAA 3ZE1E 2CJUL 2XWJB 1DQLH 4IRJD 2NY6B 4HUWA 1X5LA 5LG1A 4JJ5A 3X3GL 4WO4D 4OIAA 2FX7H 5C0BD 1Q0YH 4TTDC 3C2SA 3SGDI 3UBXB 4G9FB 1JGUL 3MRHB 2R0LL 3I84A 3TGXA 3WS3B 3JWNC 4E42B 4Y4FB 2B7DT 3STZA 1QOKA 2B1AL 4PJAB 4GBXB 1HH6A 4RFNB 3OJ2C 3U83A 2C1OA 1QACA 1UEMA 5I76A 1F4YH 4OGAD 2JCCE 4NCC1 1AR1C 4BSWA 4M1DL 4LOUC 1BBJB 4KPHH 5FUZL 1WCBB 1YQ2A 3FQNB 3WFCL 5IKCB 4MJ6B 2GJ6A 3K46A 4GQ9H 4RQQB 4NQCD 1EEUA 5CINL 1J0KA 4WEMB 3NFNA 5C7XH 2R0KL 1DQQB 5KG9B 1B0GA 4BFIA 3BPOB 5CEZE 4NQXA 2P5WB 5EFIB 4XCNA 1X6LA 3IRPX 2ZSVB 4HQQL 3BH9B 4FFZH 2DKMA 4DUVA 2VLME 1AGCB 1KTDA 2Q3ZA 2EXYD 4OCYH 1CFSB 2UZYB 1KCLA 2NPLX 1NCCH 3DBXA 4UDUB 2P8MB 2IQ9L 2KQMA 3DX8B 2PCPB 3GRWA 4CUCA 2IAMA 3C60B 1CU4H 1AHWB 4N9OB 4ODSH 1JWMB 2DJ4A 5DJDA 5LCVL 1YEJL 1FL3B 4GKZB 1TVBA 2IPKA 4ODVH 3EJZD 3OKOA 4YX2L 4AQOA 4F7CA 1T7YA 2VZTA 5J12C 2A73B 3HE6A 1MWAA 4L8BB 1AXTH 1L7IH 3LDBB 5F96L 2ICWA 4L8CA 1O5DT 1UJTA 1G0YR 3LEYH 4N0CC 4K2UL 1YEFL 3WS6C 5ESVA 2X4UA 1YEKL 4G43B 5I8KH 1ZWIB 3SO3C 5IBTH 3ZDXE 1C08B 3G5ZA 2IQAA 4HGMA 1XF3A 4AT6B 4ZXBB 1MCLA 1S7SA 1T2QL 3LV3A 4FQCH 3PV7A 1OAZH 4QTIH 3U30B 4BSVB 3MV8A 1M7DA 2VL5B 1KJ2B 3BZFA 5F9JA 1QSZA 1RJYA 3I6LD 3JWDH 2V5MA 5DS8B 2CUIA 4DUWA 3FFCA 5E2WH 5I9QC 4KRNA 1A3QA 2E5EA 4KKLD 1CE1L 4N5UA 4PRID 1OPGL 4JRXB 3RNQA 1Y6NR 1FVEA 5D2NE 2OX5A 1P4IH 4X7SL 1JZ6A 1IBGH 3VGHA 4DGYL 5HI5D 3O6KL 1FPTL 1KXQE 3QO0A 4TOYL 3H6JA 3MLRL 3CMOL 1CR9L 3UTSE 1IGCL 4I9WD 5BCAA 3UTTA 2F8VA 1R5WB 3DI3B 1SEQL 1V3MA 3EYQC 2VQUA 4H1LA 4NT6A 4J3WA 1IQDB 4Q58C 5E2UH 4U1MB 5B38G 2RCSL 5L2KB 5FYJE 3X3GH 3PHSA 1AO7D 2BSTB 4JGUA 2QQLH 1A7OH 5GGTH 4CAGA 3IU3B 3ARBB 5HVHB 4KRLB 3M8OH 2VLJB 2YUZA 4LLVA 1G7HA 3R1GL 1CFNB 1A1NA 3EO0A 2P5WD 1XH3A 4D0BB 2YKLL 2VDRH 3VDAA 1KYOK 3QT2A 5IFJA 1UH4A 1L9MA 4Y88A 3KG5A 1G7IA 3VH8G 1DN2A 4LHJB 3O3EA 2DD8H 3LS4H 3AGVA 1DQJB 1OCWL 4PB9H 4IMKA 3GIVB 2VDML 4WU7B 5DZOA 3RIFF 2A9NL 1X4YA 3CVIH 3L6FB 1U58B 1NC2D 4EN3D 1S9KC 1BD2A 2VXSH 3P77B 3QHTC 1GIGH 2Z35A 3HZVA 4WVRA 25C8L 4OLZL 4NRXB 4WI3A 2O5YH 4HFWA 5L9DL 3VFOA 3IS0X 4IM8A 1JF6A 5EUOF 1EX0A 5CFHA 5IMMA 1JK8B 3VGAB 5DEGA 2EE6A 4MJIB 3ZO0A 3GMMA 5F1SA 5IEKB 2VXQH 1FFNB 4PLOB 4ELKB 4JHWH 2X9WA 3MR9B 1G7MA 2BVPA 5FGCE 4PJEA 2GK2A 4GMTH 4U1NB 4QT5B 3LIZL 1C12A 3ECBA 5HI5C 2JB6B 3OJDA 2IAMD 3BJ91 3DUSB 3OKKA 2G9HB 1KELH 1WSST 5C09E 5LJYH 4XVTL 4OKVA 5C70A 1WITA 2XV6B 4MNQD 1VGKB 3ES6A 5IVZB 2BSSA 4G8FB 1AP2B 1E6OH 3HE6C 3MRQA 3LEYL 5JDSA 1T5WA 1A6UH 4F3FB 2AEIT 2IQ9H 5EU6D 1Q8MA 3FCTB 1W72B 2V7NA 3RVVD 1NAMH 3VG9B 1AQDB 3QHFL 5E70A 2IAMC 4JFEB 3ULUE 4ALAH 1MIMH 2CH8A 5FF6B 1XGRB 5DEFB 5I66A 1X7QA 4JFXB 3IFNL 3T77B 1NBQA 2EDQA 2IPUG 1UB6B 2UZIL 2XY2A 2I9LB 4DTGL 2VLKB 2IG2L 4KJQD 2CMRL 4ETYA 2YA0A 5ISZA 3S37X 3KAAA 32C2A 2Q7NA 1DP0A 1X5IA 3FB7A 3QP3A 1HHJA 1MCEA 3WFCH 1YEEH 2AK4A 3SOBL 1PYWB 2UYLB 3IDXL 1IGCH 1HKLH 3AS3A 5IVXB 4XWOC 3UYPA 1NGXB 3O3DB 2FJFA 4WTXA 1U91A 5ENWA 5KVFH 1RUKL 1EFXA 5GGVL 3ZTNH 5GJSH 1MCWW 5E1AB 4HS8L 5GIRB 4KJQC 2R1XA 5DJXB 2AQ3A 3DHMA 3GBLA 1OPGH 4YO0A 1JYWA 1KPVA 4OD1H 4LKXB 5HHNB 1SJEA 1ONQB 1Q9KA 2VKXA 1GXEA 1TTUA 3OR6A 1C16A 3HCVB 4MB3A 3SDAC 3CX5J 2OLDA 2YKLH 5D93C 5I73B 1ADQH 3SPVB 1BM3L 4GS7B 5M7QA 4F8QA 3MJ8B 4ZNEE 5HHQA 1EAJA 3ZYIA 5INDB 3O9WA 2JLLA 2F5AH 1K6QL 3MO1B 5A16B 4PJIA 1DFBH 5KN5B 3K2UL 1JNHB 2P45B 3LVEA 4JG1H 4R4BA 3VWKB 2Y4SA 3WIIL 3KPMB 3LQAC 4KZDH 4X6FB 4I4WB 2XRAL 3OHXA 4PY7B 1J8HE 3ZL4H 1QFUH 3QR2A 1S5HA 4KQ3L 5D9SA 5L9DH 3SCMB 3K1KC 4Z7WF 5FYLL 5B38B 1JNJA 3BQUD 4NKOA 1CFQA 3MACH 5IT2H 1AKJB 5ICYA 1T2QH 5IB3B 4NJAH 2O61B 1IE5A 1F3JB 3GSNH 1Q9WB 2APBA 2D7QA 5L2KD 3ET9F 3DSFH 4BM7A 1P2CA 3MA9H 1VFAA 3BGFB 4OSUL 1IC4L 1WWBX 4QXUL 3LRSA 1GGTA 1I3GH 5E2WL 1CL7I 4IDLA 4HXBH 4NNXB 2QQQA 2HWZL 3M45A 4Q6YA 5SWZA 1GIGL 1GOFA 2YUVA 2ZUQC 4LGPB 2J6EL 3G6JA 1J05A 4P3DB 4JQVC 3U2SA 2XG4A 5F7DB 2D9CA 5JNYB 2N7BA 3QFJD 4U6HA 2BSRB 3ZYZA 3TO4C 2ZWLT 3VI3F 2FJHA 4FQLL 1PSKH 1V3LA 2BVTA 3WFEH 4WV1A 1CDYA 2BX5A 1ZT7A 5ILTH 4OZHB 2YXMA 4BH7B 4CL7A 2PXYB 3QQ9C 4Z0XB 2R0WH 5HHOD 2XQYG 4DGYH 2FX8H 2X05A 1VFUA 3QI9D 1DL7H 5D6DA 3VI3E 5TDOB 1N5AA 4JDVB 3O9WD 2VJXA 3V4UL 2DQDH 4HT1L 1PX3A 1SJHA 4H8WL 3X3FH 1IAKB 2WIIB 5J89A 3JWDC 1NBYB 1XIWA 1TJIH 1BBDH 1RUMH 1PDKA 5EBLB 3KYNA 3FB6A 1E6OL 2NLJB 2X7LB 4HK3N 5TQ2H 4MCZB 1WBXB 3JUZA 2EICA 5K9JH 2MHAB 5J6HB 4AJ0A 2LVCA 1OAUL 4G6JH 1I1FB 1ULVA 4MQ7B 4O2FB 2J5LC 4YR6B 1UXWB 3GBNL 4I3RH 4PS4L 3SKJL 2XFXA 5E9DA 4JHZA 3SDDC 1I1AB 3CFEB 5IK3A 4IRZH 4ZUVB 1DLFL 4XXCA 3VXMA 3KPTA 2VDOH 5DUML 1ZT4B 2X9XA 5IB1A 4NWTH 1CT8B 1VB9A 4NRYB 4F9PC 4Y5YB 2R29L 4KHTH 4MHHI 5C8JB 2H2SD 2BVQB 1EAPB 4R26L 4PB9L 2SEBB 4LOUD 2BOBB 4N1EA 3PDOB 4MZ3A 3DX6A 1JVKA 4OGAC 1SJXA 4XC1L 4ZPVB 4F57H 1MHCB 1U8HA 4KJWC 4OD1L 2W65B 3IJSB 3Q5YA 3FQXA 2ICEA 5GGUB 5I1EL 3VWKD 3VW3H 3STLA 2DYPB 3CFDB 3P30H 4ZAKB 1NPUA 3DRQB 1BFVH 4I48A 4OLZH 4OV5A 3RZWA 1DBAL 1UT9A 3N85H 4RDQF 4HIEA 4LLYA 2BNRA 1KXVC 1T0MB 4HUXB 1T2JA 15C8L 5E00A 3BUTA 5F7EL 4KDVA 5HVGB 2DMCA 3GMRA 4M7KL 4QHNA 5GJSL 4HUVA 4IHOA 1UJ3B 4ZFOA 1LO0L 4JO2H 2VXQL 2IALA 3B9KA 4RAUA 4UV4H 5DFTA 5DSCA 2BVOA 4AENA 4OGYL 5HTSA 5DXWA 4MJID 4PGEA 3JV6A 4AM0B 3LS5L 1FGVL 3H9SE 2CO7B 1MFNA 1KPRA 4UQ3B 1X9QA 2Z93B 4P4KA 3T65A 5CJOL 3B2UD 4YEEA 5DO2D 3GBML 1X44A 1D9KC 1JNLH 2AABL 5IKCA 5MEND 1AGBB 1OB1A 1RZKC 3OXSB 1W8NA 2HG5B 1T1ZA 2H26B 4HPOL 4KKCC 2CPCA 4HJ0C 1VEOA 4HMCA 4Y5XC 1IC5H 3L5WA 5IP4A 3EBAA 1HXYA 2R56L 3NFNB 1OGTA 2PXYD 1FAIH 1P5VA 1UZ8B 4S1SL 1MRFL 4ELMA 4Z5RA 1FC2D 3WIIH 1FCCA 4XBEH 4NQCE 3K74B 4TQEL 4HPYL 3P0VH 2QV2A 1T4KA 3TBTA 1F6FB 3BW9B 2WQRA 3S5LA 3F58H 5DJCA 3MLTB 5IJKC 2C3VA 1EJOL 4M4PA 5E6ZA 4HCRH 4RAVB 3C8DA 3VFMB 4B7IA 5KAQF 1AHWA 2HFEA 5I16B 1F5WA 3RA7L 1ES0A 5FXCH 3U7AA 4U6VH 1D5IL 4WCYL 3T2NH 4TSBL 4H5SB 1K5NB 2YRZA 3HR6A 3Q6GH 4CMMA 3WDIA 4F37K 3ZTNL 1A6TB 4CJ1A 2I5YH 4PJXA 5BRZB 5KSBF 2OL3A 3DURB 3ULVL 1R3LA 4D9QE 3QNYB 4PJ5E 4PJHF 3ROOB 5DI8B 2YEZB 4WHTB 1BP3B 1PY4A 1FO0B 2NY7L 4DGIH 3OAYH 4N1CA 5BVPL 1J0HA 3LRGA 4NQTA 4R8WH 4O51A 4LARH 1J8HD 3QRGH 5JHDB 3WO4B 4KDWA 2ADIA 3FB8B 1ZEAL 3IXTB 3X14A 5DA0B 5IBLD 4GRWH 5F72S 5K9JL 3MV8B 3SJVD 4NM8H 1DSFH 3ZKMD 4GBXC 2Z92B 2WP3T 3K0WA 4MA1C 4XX1G 2VXTH 1Q0XH 5DJAB 1AC0A 4G42A 3H3BC 1FFOA 4NP4L 2OK0H 2X10A 3RNQB 1G9NL 4LNRA 4N8VG 1NGWA 3ZTJG 1UVQB 5CEYA 1CLOL 5KSUA 4E41A 1WT5C 2DBLL 3L7EA 3WUZA 4GMSH 3MRIB 4KMLB 2A6IA 3CH1B 3MBED 3UTSA 2FD6L 5DRWB 1H3VA 2HRPL 3BP7A 3IU4H 4YHKL 3L5JA 1MCIA 5T5NF 5CGTA 3QCVL 2BOCA 5D96C 4IRSD 3OSKA 4M62L 3ARED 1NANI 5F9WC 2E7MA 3UCRA 4G5ZL 1J0IA 5FGCB 3CZFA 4Q6IA 3EYVB 3HFMH 1CD0A 2YPVL 3TPUA 2E7LC 4Z7WA 1T80A 1IC7H 3HPJA 1CGUA 1IGJA 3MJGX 5DUMH 1M7IA 1QSFD 4HJJL 5EC1B 5EUKA 4XP1L 4KHTL 1S7UA 2Z0BA 5GHWH 3RVXC 4EUPH 2VLJA 1A9EB 3U4BH 2X44D 4PP2A 5CIPB 5F7WC 1R5IA 4NQDA 5D5MF 2JJTA 1EHLH 4PUBH 4FFZL 3PGDA 3MRFA 4JFDA 3S96B 3AREC 1KIQA 1FZOB 5E5RB 3QUZB 5J13C 2B4CH 3MZGB 3BVNA 3QZWA 1N0XL 2DDQH 3OG4B 4WFGE 3S34H 5SWQB 4UQ2A 4EDWH 1OSPH 3OJVC 1BREA 2ZOKB 2P7TA 3KS0J 1YJDH 4LLWA 3IDMB 4YX2H 4RNRB 4YFDB 2ADGB 1DCLA 1S9XA 3RVXD 1RHFA 2F74A 4L4TA 4XMPL 2R56H 3IDIA 5IM7B 1XF2A 4OBRA 4XP4H 4KVNH 1OARH 2XN9E 4K94H 1CIDA 2CIKB 4J8RB 3RI5F 4CADB 5DDHA 4UAOB 4MX7A 4LF3B 5DJ2B 5SWSB 1A5FH 3T0EB 1ZGLB 3MCKB 4XCEB 3K7UA 3HC4L 3O2VH 1F4XH 3RKDD 1KSRA 1EHXA 3QDGB 1AGDA 3V4PH 4WJ5B 3H42H 4GG6A 2ARWA 1MCOH 5F89B 3BEWA 1OAUH 4G6JL 1ZHLB 2P48B 5D71L 3HZYB 4U1NA 1RZJC 3FT4B 5JDJA 2J12B 3B5TA 2W60A 4LSVH 1BQSA 3RWHA 5IR1A 1CE6A 4OLYL 1EVUA 3L3KA 3NCJH 4XRCA 5I75C 4Y1AB 1FLRH 2EYRA 5JIPA 3OKDB 1HSBA 4NYLB 4WEBL 4YHPB 5ALCL 1DQLL 1KN2H 4CVUA 2B8OT 1U42A 4PJHA 4G8FA 2IJ0C 4QRPA 3LKOA 5J12B 3VFNA 5JDSB 3RWJA 3JTSB 4X7TB 1AGFA 3MA7A 2EDTA 4X6CE 5KVEH 2HT2D 3RWIA 3UXFA 5IFAL 3P11L 3QEQA 4Q9BA 4HKXB 2CDEB 1TXKA 2NXYC 2X70B 3P4NA 1U95A 1T2XA 1FG2A 4OM1L 4Y4KD 4W4OC 5L0QC 5DEFA 4JPWH 5DZLA 2R2BB 3D87B 4KPHL 5FUZH 1KEML 3U7YH 3FAWA 3MNWA 5I30H 4AEIL 4OUUB 4XNMA 2QL1A 5GGSA 1BGXL 1DEEA 1ZT1A 2B4CC 2VLKA 1A6WL 1PJ9A 4FXLA 1OOAA 1V8HA 4H0GA 4CRPA 4OZ4A 2LE9A 2NQCA 1HNGA 32C2B 3DX9B 5EUOB 3E0GA 1CN4A 5I8EB 1FH5L 4P99A 4WY7L 3BWAA 1OP3K 4L8DB 1AC6A 1Q9OB 1ZKAA 2NNAB 4U6YA 2LVEA 1JF1A 2CXKA 5ANMA 3S4SA 1KCSL 3PL6A 4WI8A 5JORA 4G9DB 2VMFA 1DQDH 5E1AA 3JSSA 5J57B 5HVHC 5IMKA 5CSZB 4HMEA 2NZIA 1ACYL 3W0WD 3SDCD 1N6UA 2OK0L 5IQ7H 4TTGA 1C7TA 1HE7A 4Y4FC 3KPRA 3B3IA 4R2GC 5ALBL 4HC1H 5HHNA 4MNQB 4DFIA 5H35B 3SDCB 4KK8C 2MQCA 2NXZD 5E8DL 1MI5B 2QADB 4NO5B 4YHOL 1KENH 2KL6A 1TZHB 1XF5B 2XZQL 1BQUA 3OX8B 2RFXB 1UM4H 5F7LB 3KYOB 5IG7A 5EUOE 1TPXB 1TLKA 4N8VB 4E5XB 4YDVB 4PJIE 4X9HA 4Z76B 5E6ID 2OL3L 1GGUA 1SYSA 3F58L 3OB8A 2N56A 5E8OB 4BELD 5C0FB 3LKQB 2VOTA 3QIWA 3RWFA 4JM2F 3I6GB 5DMIH 3V4VH 2DJUA 5A2FA 2ZOLA 5I1DB 3H3KA 5JR1H 2C7UB 1G7JA 1U8LA 5LXGH 3EYSL 4PJGB 5EIQA 5I18L 3PWLA 1I3RA 4PJDA 4X98B 3H9SD 1FYTB 5B3JF 5EIVA 2M8XA 3TVMA 1OVZA 3MLUL 3OPZL 2BHZA 2H3NA 3CXDH 2F53D 3Q6FB 3HUJA 3QULA 4MWFA 4UOJA 4BFBD 4I0PB 5T1MB 2X1XR 2FO1A 2ITCA 5GGQH 4F58L 5I8CA 3LKNB 4IEFB 2Q8AL 3ZDXF 1MNUH 3AFLA 2D0GA 4DZBB 4G8IA 5A2IH 1CDHA 3VMNA 3HNSL 1U6AL 5CEXA 3UYRH 4U6XA 5I74B 1A4KA 1MHEB 1UH3A 3HE7B 3SDXE 3DGGB 4ORGB 3QXWA 3L5IA 1I8LA 2RR3A 4AL8L 5E7BA 4KVNL 2CGRH 5DWUL 1RK0B 2BSRA 4TSAH 2VR5A 1T66C 4ZODA 4NC0B 3S36X 3HN3A 2A74B 4YPGA 4NQDE 2PYEA 1RULH 4NOBA 4P2OB 2AK4E 1NH6A 4QWWD 4MA1B 2GSGB 4OZGE 4Z0XA 5TPWL 3RY6A 1LD9B 1F8TL 1UWXK 3SY0B 4NQVB 2EIBA 3EAKA 3B5HA 5GRVK 3QWOB 4HJJH 3LS4L 2HLAB 4KTEH 4M6MH 4QRTA 2E8YA 3RUGE 3QNZB 2FL5B 3UTQA 4AMKL 3QQ9D 1KN2L 1E6JL 1N3NB 2EDJA 4NBYB 4Y5YC 1Z3GL 4F7TA 3QUYB 4MCZA 4JAMB 3QI9C 3DOSA 4NBZB 4LQFL 2K3TA 3LPWA 2ZCKH 4PRHA 4KMQA 4WY7H 5F9DC 5H94A 2W0FA 4PJAF 4O2FA 5JXEC 1DBKH 3W5NA 3HB3C 1J10A 4LGSB 1FZKA 4PJ7B 3SQBA 2AKRB 4WO4B 4ZUVA 3HR5A 1BVLA 3MMEA 4S0SD 3BHBA 1VDGA 5IB1B 3QA3B 1CICA 4K23H 4OF6A 1U8IA 4JFPB 4MCYA 5LKNA 5DGRA 1GGBL 3VXSA 4R4FH 4FQIH 1H3UA 4Y4HA 3FQRB 4HJGA 5IQ7L 4Q9RH 1RZ8B 3ARRA 1NGYA 2FSEA 4UILH 3T0XA 3C8HA 4LNVA 1ZMYA 3B2UC 2F54A 4MQXC 5I19L 2I07A 1XR8A 3NGBB 5J8OA 2I9TB 5CZXD 3CFDA 4JY4A 4Y1AE 1UB5A 4WW2B 4HIIA 1F3DH 4HH9B 2A38A 3IKCA 5JUEL 3FN3A 1KLGB 5GZOC 1N26A 2AXGA 2GY7B 2W59A 2NYYD 3TNNA 1KCSH 4IRJC 5ACZB 1OF2B 1BQHA 4WO4C 3VA6A 1LO4H 1OAYL 1T7WA 4IHOB 1MFDH 1I8MB 2XY1A 2HVKA 1MCOL 4ODTL 2WIMA 5SWZE 5DSCB 1EERB 4KI5E 4P48A 1ZA6B 4I2XE 5AZ2L 1NMBL 4MD5A 3VFWA 1VENA 1A6VL 2BY0A 5T5NG 2VLKE 1QD0A 3MLPA 1U8PA 4HS3B 3TBYB 1KJ2L 1LHZA 3EYQD 2JB5L 5BXFB 2VXVL 3Q1SL 2Y06L 1LMKA 2ADFL 5JW3H 1A14H 2EIZB 1ITBB 1AY1H 4YAQB 3OXSA 4JREC 4ERSH 3GFUA 1TFHA 5JPNA 4OM1H 1OWWA 1MFBH 3C5JA 1R6VA 3QG6A 5K59E 5EPMA 1U92B 4ELME 1DUZA 5IBUG 4KRPB 5ANME 4Z7VB 1KTKE 1WK0A 4KJYB 3VXUE 1ORQA 1A9BA 2JELL 5EZJA 5ICZA 2DQIH 3EOBA 3EHBD 2ENSA 3H0TB 4QXTB 5T3XD 2ZUVA 5DO2C 2DQUH 5EA0L 4WIQA 4RA3A 3EYSH 2HN7B 4JGMA 4X0KA 4G6ML 3BDYH 5DR5H 5KZCB 1B88A 1HOCA 3RU8L 4ELMF 1BGXH 2VWEC 1JPTH 2B0SH 2AJUH 2Y9RT 3GJFA 2JIXD 3PWPB 1N2RB 4UNVA 1MLCA 4ZXBC 1A1OB 1FGNH 3IFPA 4YE4L 2XA3A 4WNQB 3TLRA 1RURH 5IROA 1EHNA 3KPLA 1I9IH 3QNYA 4TUKL 3VXSD 1RZ7H 2Q76B 4ODHH 4X5XB 3ZE2E 4DCQA 4YHMH 5D96B 3VMPA 4QOKA 3MLSL 1KIPA 1QLEL 2PNDA 2DM3A 2Z8SA 1IC4H 4QXUH 4OZIF 4ZPTA 1Z2KA 2VLRB 4X9FA 5DYOB 3WN5B 4DJMA 1J1OH 5I1EH 3VW3L 3STBA 4F7EB 3IXTA 4JM2C 3X14B 1EUTA 1F4HA 4XPBL 4LCWD 1ACZA 2VQ1B 5HHME 2OL3H 5C0AE 3MRKA 2Z92A 4J4PD 5EOQH 3MOAL 2FECI 4MD4B 1LK2B 2DWEA 3KPSB 4RMQA 5F7EH 5JXAH 1BFSA 2D4DA 2DKSA 1WAAF 3ARTA 1YMMB 2FZ3A 1LO0H 4NWUL 3C8KA 2A6JA 3BGMB 3DVFA 1I1YA 1UWEH 1DN0A 1PQZA 4U1JB 4LLDA 4RBPK 1J11A 2A9ML 1NGZB 4DGVL 3FT2B 1C5CL 5CKGA 1AD0B 3WJJC 2QR0B 1OD9A 2PYED 1S7RB 5JIHA 1PGRB 1F6AB 3N50A 3PWVA 4X6BA 4M9PA 5BO1L 2VWEE 4L4VA 2P8PA 3PQYD 1OGAB 1HILA 4GXUN 4UU9A 1BBDL 4PRBB 1ZHBB 5ERWB 3CXDL 4OZGA 3K4DA 3DECA 4TYUA 4P2OD 1WFTA 3THML 1AD9B 4G8GA 4JO3H 3MBEC 1MWAH 4EI5A 4U3XA 4M7JL 2R1WA 4KDTA 3X11A 4JFFB 3BUYB 3U9PL 1U8QA 4CW1A 5JOFA 1HYRC 3VXMD 1IL1B 3ME0A 3RFZC 2FX8L 3QAZC 1A9EA 2H45A 3OF6A 4M4RA 2ZCHH 1RIUH 3VI4E 4LPWA 2B2XH 4ZXBD 1IAMA 1WIUA 5HSFA 3CDCA 3BEVA 2P24B 3FO0H 3KPSD 4XWOD 1DBJL 3HNVH 4LCWE 2NY6C 3S5LG 7CGTA 1FSKB 1YPZA 4HKJA 1G6VK 5DD0H 3FO9B 5BV7C 3NBNA 3BDBA 4U6VL 4OFKA 1CDJA 4XPAH 3ARQA 3P9MB 1FZMA 3EYUH 4Y5XB 5DK2A 3IDNA 3TEUA 5TDPA 1MFAH 3MUGB 1CXIA 4UT6H 1OTTD 1S9VA 3R06B 3O6FA 1CXHA 1S7VB 3H9SB 2J88H 4TNVK 3GSOB 2FO4A 1WVZA 3PV6B 4P5KA 3FKUS 4MA7H 4F33A 4KKBD 3C9NB 3ALWA 4P9HL 4JG0L 4HUUB 3TA3A 3NCEB 2X4PA 4JVPA 5DDHB 5LAXB 1GH7A 5E6IA 3LEXB 3OAZH 3F6LA 5E24E 2WBKA 4JB9L 2BFVH 2VXUH 4K71C 2EDNA 3QIBA 3HRZA 1YY9C 2D0HA 2QSVA 2HH0H 4M1CD 4F9LA 1ZGLM 1SEBB 3QI9B 3RU8H 2Y06H 1UEYA 2Y23A 4YK4C 5SWSD 4ZQKA 1P4LA 5EO9B 4HWZA 4KMTH 4MDJB 3DMMC 5I17B 4PV8B 1H8SA 2EE3A 3L3KB 3RUGF 5FUOL 4X8XA 4UDTB 2DTMH 3BOVA 1JNLL 4LDEB 5T3XE 5D2NB 2AXHA 4YEFA 1KCVH 4XHJD 1VESA 3MRNB 1NCUA 4JJHA 4RGOL 4TTDD 5E2VH 3AM8C 1AGFB 5IBUB 4JO2L 4JN1H 1GAFL 3MRBB 2NY1C 4JFZH 1M6OA 1MRFH 2GYSA 4GW5A 3PQYB 3OJMB 1J1OL 2CDGA 1ZANH 4MSWA 1HXMA 1A7QL 3ZE1F 4HKXA 3P0VL 2XZAH 5FGBA 1FG2B 1J86A 2V2XB 1JRHH 2X1QA 4JDTH 4PJDF 4U7SA 4R7DA 4LKCB 4Z7NE 4CN4A 4PGCB 2VISA 5E2TL 1QSFB 1RURL 5GRJH 4X6DB 5FK9B 2IBGA 2C26A 4XNMB 2OZ4A 5ITFA 4QRRE 2WAHA 1DEEB 2GJJA 1JZ5A 4HPOH 5CGYC 4PJGF 1GYAA 4NKDB 4C54A 5F7YC 3P3YA 4NO0D 1B4JH 1RQ5A 3U4BL 1JYXA 1QLEH 5DD5L 4Y4KC 5I8EA 5D1QD 2A9MH 4DGVH 4HWEL 2FYYA 3GSQB 5IB2B 2NNAA 4XMLH 2H8PA 4ZYKA 3MNZA 4OZHF 5DQDL 1KGCD 4GUPA 3EGSA 3FO2B 4K71B 4AH2A 3EYFA 2HYMA 4EDWL 5DHYA 4QCIA 1UKTA 4P3CH 4U1IA 5TQ0L 1YJDL 4QRSA 5DMGC 4Q9QL 4U1KB 4FXGA 1E4KA 3E2HC 5T1DL 5TDNA 1FNGB 4MJ5B 1NQBA 3LKRA 5B8CC 1IKFL 4YHIB 3TH4T 3AU1B 1RZFL 5ID1B 2XQYK 3G6AB 2XN9A 3TPKA 2NX5D 2OI9B 2IADA 5F21B 4L29A 5E08L 5DQJB 4OLUH 5DT1H 3VFUA 4HIJB 3FN9A 3LDBC 4CVXB 4X6EA 2CR3A 2NW3B 2GFBA 5A2LH 1QZ1A 1K8IB 2DWDA 2IPTL 1F00I 2BNUA 4UIKH 4B5EA 2XKNA 4NUJA 1M05B 2KH2B 4TVPL 1R0AL 3NABH 3UTZB 3N1FC 3H3PH 1T21A 4Z76A 4LARL 2V5YA 3P0YL 2EZ0D 1A6AB 1S9WA 4GKNA 2BK8A 5EZLA 3E8UH 5EOCJ 1A47A 2VRAA 2NTSP 3W9EB 5K9KA 2Q7YA 4L4TD 1UM6L 1WWCA 1G7JB 5HI3D 1KFAH 1EEZB 4HLZH 3S35X 3QXDA 1UACH 1OWRM 1XIWD 3KHQA 1J1PH 2WBWB 4N5ED 4WEBH 2CK2A 1MQKL 3I85A 1FYTA 4WFED 4YE4H 4OCWH 5T1LA 1RD6A 3HC0B 1BHGA 2D7OA 3OKNA 1IT9H 1S7WA 2P4AB 3SKUD 3IT8D 4GG8B 1G9NH 3VJ6B 3G9VA 4BSWB 3HZKA 4FHBD 1ZVSA 4UINH 3WD5L 4JZOB 3MYJA 4N8CH 2H9GB 2ATPA 3G04B 4KI5C 1ETZA 2YPLB 3FQNA 4LEXL 1IEAB 2AJVH 3LRHA 4P23D 2MMXA 4MYWB 4NZDA 3R0NA 1GZQB 3D6GA 3RL1B 3LN4A 3HMWH 4FQXA 5C0DB 4KGJA 4RQQA 2WV3A 2CRIA 3GHBH 1MIEL 4GRLA 4XTRC 1HZHL 5BV7L 5HPMB 3A0OA 3U7YL 2YXFA 4XPBH 3BYTA 2BRRH 3ULUF 1NDGB 1YYML 3QJFA 4NRZA 1F6LL 4YJZL 4JFYA 1J1XL 1FV1B 1R3IL 2H1PH 1KCVL 5TGBB 3RWGB 2CRMA 4CU7A 3VXTA 3K4AA 5JXED 4NDMB 3MLZL 4K7PL 1F58L 1KJVB 3TIEB 4N0YL 5CD5D 2EE2A 1HEZB 3DX8A 3LPFA 4PR5A 12E8H 3OKLA 4MJ4A 3HG1B 5D6CA 1AIFB 5DJDB 4DWHA 1BF2A 2ESVA 4HAFA 2C1OB 1TVBB 2IPKB 4H26B 2WBJB 5GPRA 4RDQG 2CDFA 2FJGA 1PEZA 5C07B 4F7CB 3EZJB 3JV0A 5AYUH 3CFJB 4GXUM 4N90D 2A73A 5FA3A 4UTBH 4Z7UE 2QTEA 2C1PB 3BXNB 1TZIA 2GITA 1PW3A 1WGOA 3HPLB 3UTQB 5DJ8B 1KCUH 3QISA 1NUFA 2WWMD 1N5YH 3O45B 2EDOA 2L4OA 1MCCA 2NYYC 5ADOH 2C4FU 1T03L 2APWA 4YHZH 2CK0H 1KJ3L 2EDHA 4YHOH 2IFGA 1K4DA 3D3VD 2XACC 3WDHA 5E99H 4JKKA 4WGWB 1QPXA 4UTAL 5C0GA 1KTDB 1F97A 1M7DB 3WUWG 4FXKA 3BZFB 4NHUA 5C0JA 5I1LB 4DQOH 3VFGL 3WYRA 4ZUWA 1YN7A 4F37F 4X99A 2IAMB 4NKMB 4PJBF 3FQWA 2ICCA 2BC4A 3P11H 3G6DL 4HEPG 2DQCL 2WWMC 2DLEA 2F8OA 3PGCA 5KANG 2H2SC 1IKFH 4OB5L 2DMKA 4XPAL 3KDMA 4XC3H 5KSAC 5LWYH 2CLRA 4OLUL 5DT1L 3LKPA 4HDIB 1FVCB 4Z7QF 3PNWB 2CR6A 4AEFA 1T6VN 2ORBH 1A22B 2G5BA 1FVDB 5E94A 2R1YA 3ZKMC 1KLFA 4XTRD 4RZCA 3SE4A 4LLQA 4P4RA 4XPTH 4EOWH 3QRFM 2YHGA 1JF5A 2OP4L 4K8RC 4P46B 1EZVY 5ESVB 1D5BA 4G43A 3GIZL 5MP6L 4G8EB 4Y19D 2VZSA 4LP4A 3SKOB 3SDXA 2NY5L 1RMFL 3BZ4B 3VFPA 4ZS6C 4QF1B 5FM4A 3MNVA 3BKYL 5HGAA 2FGZA 2BSED 3T3ME 4HX1A 4OJFH 3UC0L 4FNLH 2EE9A 1P7QA 2P5EE 3FFCB 1JV5B 1D5XB 3GSUB 3IFOA 4I77H 5HGGS 3RVWC 1CFTA 4KK9D 2XNAA 3I2CH 1JGDA 4JHAL 1Z6JT 1FVEB 1EGJH 3N1QC 4U4BA 3FOLB 1AJ7H 1G9MH 5TH2A 3WN5C 5FOJA 2R4RL 5I1GL 1G6RB 4PYHA 4J6RH 1U8OA 5KS9F 5I74C 2R0KH 2PXYC 3EOBB 1ORSA 4HLJA 1AI1H 2J7LA 1P1ZB 4P5TA 4XBGA 3RNKB 4F2MA 1Q94A 3L9RA 1IRAY 3VGEA 3OG6B 4O00A 3HZVB 1D9KB 3EOAA 4X4XA 4ZUUA 4OIBA 1NCCL 4LHUA 4KZEH 4OZFB 4KI5F 1JK8A 4G9FE 3VRLF 3Q3GA 4E9LA 2V2WA 3BPCB 1QRNA 4PJEE 5FEBA 1V7ML 3QXAA 3LN5B 5L7XH 2XTLA 4YXHH 1DLHA 5EBMA 3REVA 3UP1A 4LLVB 2AAVA 4GRMA 4L9LA 1XGYL 3PG2A 4FQLH 1DEDA 3VE0B 4QT5A 4ODUB 5EZOH 4R7NB 4QOKE 1JPFA 3UZQA 3H7BA 3I02A 1G7IB 3PXHA 4PTUB 4X5XA 5GGQL 4F58H 3L3IB 3LKSA 3D18A 5FKPA 3T4AB 2RIKA 4XNXH 2GTZB 4QOKB 1MNUL 3O0RH 5E08H 1DQJA 2EO9A 4LCCC 3E6HB 1EXUB 3CX5K 1BQLL 1PZ5B 3O81A 1N64H 3B6SA 3L6FA 5D7LA 1CDUA 3WIFA 1FYTE 4Q9CA 2FLBT 2ADJB 5L6YL 5JR1L 1JPGA 1CVSC 1WBZB 4KTDL 2V2TB 3UZEA 3RGVC 3BP6A 8CGTA 1CIUA 4YHNA 3CSBA 3ZHKA 1KTRL 2R39A 4AL8H 1V7NL 5I1KH 1QR4A 3VFOB 4ZNCD 1DQTA 3D25A 2YD5A 2FEEL 3KS0H 5I2IB 1MHHB 3AUVA 2ZPKH 5HYIA 4JRYA 4ZTPH 1CL7L 4DQOL 1UM6H 5IV2A 3BH8A 3M17B 4OCRL 4QNPE 3HE7C 3GJFH 5EC2A 5F8RC 3S8WA 1J1PL 3SE9H 5LGKA 1NCBL 2I9LA 2HT2C 4W6WB 3V7MA 3DTXA 1GHFH 1AD0A 3O6KH 1OW0A 3DPBA 3PWVB 1VHPA 4NGHL 5J1AB 2JB5H 1Z5LA 4LCYA 4TNWF 2ZUYA 5T1KB 2P8PB 1RV6X 3VXRD 2OP4H 4UU9B 2NY2C 2VZ3A 4OI9A 4PREA 2BSSB 2PO6A 4IMLB 2FEDD 4J12A 1NMAH 5ACLA 3PHQB 1YUHB 2E3VA 4HIXH 1D6EA 3CFBB 5EU3A 4X4MA 3BRDA 5MHSE 2A0LC 3TBWB 4UOW1 3BE1H 1IAIM 2YSSB 3MLXH 2X89D 2Z31A 4ONHB 4ZTOL 4XAKD 3BDYL 1ONQA 2ZNWA 1FZJA 2CIIA 1C16B 3HCVA 4L3EE 4MA3A 2DQTL 2XKUA 5IF0A 3IF1A 4P2QD 4M7LT 5I71C 4FN0A 4JRXE 4O5LL 3NH7L 2CKBA 3MV8D 5FYLD 1D3CA 3NTCL 4AEHL 3SDCC 3QO1B 3MLZH 2P5WE 3MFFB 4UT9H 3O8XD 3GRWH 1G9NC 1GGCL 2A6DA 4MB4A 5IMOA 1F90L 4EI6B 5JQ6L 2NTFA 4L8SB 4MS8C 4D0DA 3BGFC 1YNKL 3PP3K 5C0CA 1WFOA 5BJTA 1JNHA 3DX7B 2HFGH 3SDYL 5A3IC 4YBQD 3MGOA 5DUBB 1U91B 5ENWB 5ID0B 4LFHG 5AYUL 3WL9B 2GTWA 5B38A 4PLJD 2UV3A 2YD4A 3MRRA 1WF5A 5JPMB 1FORH 2EDDA 4KJWD 3ZDYF 1CBVH 4ETQA 1N5YL 1Q9WA 2IMMA 4HSQA 5DD3H 3MODL 3V6ZB 3N06B 1GZPB 4EN3B 3QUKB 1XGYH 6FABL 4OF3A 3Q1SH 3P40A 5IWLC 4EEEA 4HMDA 3WXWH 3T3MF 1DE4A 1I9RL 5EU6A 3T2NL 2VR9A 4FP8L 4PJBE 5L0QB 5EO0A 4PB0L 1LO4L 2YC1A 1YC8A 5F3BB 5GGRY 5BQ7A 4X5WA 3DMMD 3MO1A 3CPLB 2HTKD 4LK4A 1WAAA 3RBSA 5AZ2H 5MENE 4M48H 1UQSA 4MSWB 4DGIL 3RWCB 4GSDH 1YNLL 1BIHA 3OHXB 4PJXF 1JMXA 3EJYD 2ARJA 3KJ6H 4YQXL 5DR5L 4HZLA 1B0WA 1KJ2H 3ARBD 5BOZG 4ISVA 2EH8H 2VISB 4CDHA 3BO8A 3OKMA 2ED9A 5DJZA 2V9TA 1A0QL 1H15A 4L3ED 1LEGA 5ACMA 3B9VA 3AXLB 4Y5VA 1A8JH 4R90H 5E5MB 3WKML 1JHTB 3DVNB 4ZFFA 2JJUA 1NBYA 2R2HA 1BQLH 4MMXC 3SEPA 5GGSY 2X4NB 3VRIA 4Q0XH 3PWJA 4LLMA 1WZ1L 4GW4A 1D5ZB 4P5MA 4R96A 5EOCL 1JCKA 3EO1B 4YXKH 1I7RB 3AC0A 3ARBC 1TITA 5C09B 3O3AA 3MROB 5DRXB 2B39A 1IEBA 1HHIB 1T5XA 3O3BB 5DC4B 5FYKE 4ONFH 1J05B 5IVXF 1II4E 1VSCA 1WBYA 4XH2A 4F7PA 3IVKA 4Z18A 4YNYA 2IH3B 3CC5A 3QZWG 1KIUA 5C86A 4J6RL 3MSPA 4AEEA 2CLZB 1LQSR 1BOGA 3EFFA 4PLJC 3CDYA 4LFHD 4M62H 4OZHA 4QY8B 3GUTA 4JZJA 4FQHA 4P2RD 2I60H 1FGNL 1WUNT 5HYJA 2YZ1A 4C56B 1NBVH 2OS7A 3T2PA 4KUCF 2WSKA 3NN8A 5D1XB 1K8IA 2DWDB 1J88A 3SDAB 35C8H 3UX9B 5C0RL 3RPIA 5D7LE 4EKXA 4HG4J 5TFSL 5GHWL 2BMKB 4KI1A 3TZVA 4OV5B 2OJEA 3U46A 1IGTA 3S3JA 2XXCB 2NLJA 2X7LA 3C5SA 3PWUA 5E56A 1HH6B 4ZFGH 4U7KA 3TN0D 2ID5A 2ITDB 4XVJL 3W9EA 1GGCH 3EIFA 2XQBH 1R3JB 1PKQA 4CVZA 4QHLA 1YNKH 3DRTB 4KKAD 5HDLA 1XZ0B 5CLTA 4P2RB 5H2BA 3H7LA 5C0BE 3QPXH 5DHVB 1SMAA 1LP9B 5JXAL 1WTLA 2LFGA 3WLWD 1NC4B 2PO6D 3MACL 3LOWA 1JL8A 2HVJB 3FMGL 4LMQI 3DROA 1C5DA 4JN2B 1CDCA 3SN6N 3PDOA 1RIVH 1XF4A 3EOTL 3NH7H 4UI2A 1RIUL 4JCLA 5KG9A 4N5EC 4PGZA 2FIRT 3RL1A 3CSYA 2NX5B 3IJSA 5GGUA 2H2PD 1PG7X 1NCNA 2OR8A 1P9MC 2X1WL 2YK1L 2ZSVA 1XCTA 5FHBL 3V7AG 1A7NL 2Y07H 3IFLH 3MRGA 2DLGA 3H42L 5HYQB 5GRJL 3CU1A 2HWZH 3L95A 4O4YL 5JO5B 4JFFE 2GIYA 3DV4A 4X4ME 1G9EA 4D8PB 3V7AE 5JIIA 4QHKJ 1LEIA 5HVFB 3WFZA 1LO5B 1FL3A 4QHNB 4N0RA 3WXVH 1FRGL 3K81A 5JW5B 1F02I 3BN3B 3OKOB 5F7MC 2JJSC 2HT3D 4PR5B 3WO4C 4OCNC 3ULVE 2XWBB 2IANB 4PTTA 5MEOB 5DQDH 1NEZA 1FFPB 1T83A 4MD0A 2AP2A 3MV7B 1LE5B 4YC2B 5IHZB 5DRNA 2GAZA 4FFYH 2Z93A 4P4KB 5LGHH 4XAWH 3SJVB 5JZ7C 3NIGF 4KHXL 2X4SB 3TT3L 3P9LA 4I18A 1DR9A 3BPNB 1I8KA 4PRNA 1CICD 1P7KB 5D72H 5C0CE 2Q20A 3RGVB 4LSUL 3IDJB 1T1ZB 1C08A 4FP8H 4OFVA 5GGRA 1HDMA 3O45A 5CUSH 1DQMH 1SYVB 5HY9A 3O11B 3QPQD 3TN0C 3GMLB 4ELMB 5FM5O 3X12A 3UTPE 5FYJH 3HS0A 1R0AH 1YC7A 4U1HB 3M07A 4GSDL 1R3KB 4NPYA 3HB3D 4ZSOE 4UT7L 3GBNH 1S8DB 3MBXH 3WSQL 3FN0H 4JO1L 4L9DA 2AS5M 1RUAH 4GQ9L 3EKCA 2FGWH 2R69H 2WM0A 4ZUWB 3W81A 2VN7A 3EO9L 4AIXA 4JFZL 3G08A 5IJVA 3QWRA 1EK3A 3O6LH 1CGVA 4JM4H 2ZCLH 5DQ9B 3QB7C 5D7IA 5FUCE 3NIFF 1LO3L 1J0ZA 4KH2A 2J5LB 4WFGD 4OCXL 1QYGH 1DQDL 4RWYH 4Y2DD 4PJBA 4S1QL 2FATH 2GK0A 4WRLA 4ZFZA 3VXRB 4XNYL 5DI8A 3GMPA 3O8XB 2X41A 5ESAB 1XGQB 5GRVL 3GJEA 1MAMH 2APXA 3ROLA 2FHBA 4H20L 1XMWA 5SV4A 2VZUA 3IU3A 3EYVA 3ZLQC 1R24A 2W9EL 3PJSB 1RPQA 2P5EB 4LRIA 1QUNA 4APQA 4CVWA 3SKOA 3UJJH 4OM0L 1CFNA 3U1SL 4RWHA 4ZFGL 3D3VE 5I8OL 4U33A 3D1MC 1P6AB 3IJHA 5CAYB 2EH7L 5E7FA 2YD7A 3Q0HA 4PP2B 1I4FA 43C9A 1R5IB 1NCAL 1HHKA 5CHNB 1YNTA 2G2RB 4K7PH 1FFOB 2EDXA 3JUYA 5FYJD 2YUWA 4LIQL 2DLHA 2APFA 3V9FA 5F7HA 3UPAA 5K59F 1MVUA 4LNRB 3T0DA 1F4WH 3QQ3A 3VXOA 5TE6L 4POZC 4R3SB 1KF9B 3MGTB 4A2LA 5BS0D 2AV7B 1LE9B 3PP4H 4UNUA 4JDZB 1KN4L 1KBGH 4RFOL 4CKVX 3BI9X 2EDBA 5CJ8A 2GUOA 3O2WL 3NFPA 1NSNL 4M48L 5DMKB 1F13A 4L4TB 3C60D 1SM3L 3RTQA 1G9MC 4C56D 1CXKA 3TNMA 4DVRL 4JANA 1I8IA 4EQ3A 2CIKA 1U8MB 3QUXC 3QEUB 4NZRH 4WU5A 5LBSL 3GDBA 5HYJE 4LHUB 1NAKH 1ITCA 5EOCH 5LVEA 2P8LA 1RJLB 1RZFH 3DUUB 3QXAB 1MCWM 2JB6A 3WKMH 2YOCA 4KK8D 3ZSTA 1W72L 2G9HA 5T5FH 5MEPB 1R3HA 4M1DH 4TN9A 4C57C 4R7NA 5DK3A 1Q9LA 1JHLH 3VFGH 1A7NH 2Y07L 1I7ZA 3VFVA 1V3KA 3VD9A 2D7PA 5K9OA 4KHXH 5D1ZA 4BJLA 2VABB 4RX4D 3VI4F 4OLEA 3CSPA 2NZ9D 3VCLB 4IDJL 3WFHB 2VNCA 2MOVA 4P59H 3WNNA 1T1WA 3RY4A 1U93B 3L3HB 3S97C 5LWYL 3I3EA 3VFNB 3UJIH 1BF8A 1HNFA 4M03A 4XCCL 4XPHH 3UTTD 3RVUD 1RI8A 3C6SB 2FEDC 4PJCA 4QGTA 1NBVL 3RJDA 1TETH 1E6JH 2N7AA 2C3WA 3NZ8B 3B9DA 3OXRA 1WZMA 4U3HA 2OZ4L