3MJ9L

Crystal structure of jaml in complex with the stimulatory antibody hl4e10
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
209
structure length
209
Chain Sequence
b'YTLTQPPLVSVALGQKATITCSGDKLSDVYVHWYQQKAGQAPVLVIYEDNRRPSGIPDHFSGSNSGNMATLTISKAQAGDEADYYCQSWDGTNSAWVFGSGTKVTVLGQPNAAPSVTLFPPSSEELKTNQATLVCMINGFYPADVAVTWEADGTPITQGVKTTQPSKSDSKYMATSYLTMTADAWKSRNTFICKVTHGGNTVEKSLSPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Junctional adhesion molecule-like
molecule tags Immune system
source organism Mus musculus
publication title Molecular insights into gamma delta T cell costimulation by an anti-JAML antibody.
pubmed doi rcsb
total genus 42
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2010-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj9L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj9L01
4HC1A 5BVPL 2ITDA 2JJSC 4OV5A 2B1AL 4D0CA 3UTOA 1C5BL 4KKLC 4OGAD 1QSFE 1KTKE 4PGDA 1JP5A 5JIIA 2HFEB 5DS8B 4PP1D 4F7MA 4IS6B 3RWGB 1WBYA 2YA1A 1MUJB 5HYJB 4JAMB 4PYHA 5J11B 3MRHB 5C92A 4LPYA 4PJAF 5EUOE 2P5ED 3MBEA 5CBAA 2DIJA 3WFBL 4F7MB 3TESA 4RAHA 5I8EB 2I9TA 4XRCB 2Q8BL 3KLHD 1F45A 1T0MA 5J56B 3PQYE 2R0KL 1FNFA 5KSUB 3GFUA 2NZ9D 4ZOAA 4YXLH 1UYWL 3D2UB 3EIFA 3L3OB 1GGIH 1QSED 1J10A 4W68A 5E8DH 3P77A 1DVFC 2ARJQ 3BVNB 1S9XB 5HDQL 3U30C 4X4YA 4DZBB 1AGCA 2CLZB 2IAND 3QO0A 1SMOA 3Q6FB 2I07A 4FQXD 3ZYIA 3KPSA 4NC0B 4UBDD 5F7WC 1NBZB 1G7HA 3GSNH 2EIDA 3HB3D 4LRIC 4LMQI 4UINH 2H2SD 3QJFB 2YD9A 3KDMA 3TA3B 3PL6C 3HZYB 1NFDF 2NY1B 2WBWB 3LZFL 4HF5H 5MP6H 4OZIA 4L9DA 3VXPB 5B38A 2DQGL 4F7CA 1QFWI 5BZWA 2N7AA 4NM8L 5D2NE 1Q1JL 4RGND 4HKJA 4G42B 1QLFB 5J4MA 2R1XB 3OAZK 4E5XB 5TE6L 3IJSA 4JY5L 3WN5A 3DX6B 1MHEB 4P0DA 1HOCB 4AEEA 1NANH 1LP9B 1DDHB 4GBXA 1RD6A 4GUPB 2BRRH 4Z7UB 3PP3K 3Q1SH 2AEQH 4PJAA 1FLTX 5GRWA 3SKMB 3MROA 5E2VH 2J8UB 3O2WL 3TIDB 5IHZA 4X4ZA 3LN4B 3V0WL 3IXAA 4PGJA 1A6TA 1FORL 2EXYC 1NMCB 3MV8A 2DL2A 1MWAH 1UJ3C 2CK0H 2CLRA 2QR0A 3DXAA 4JG1H 4J3SA 4ZMAT 4GW1B 4M4RA 4BFGA 4ZS7L 5EPMB 1YA5A 1E4KC 3BN3B 4HIHB 2ZOLB 4OFVA 4CADB 2YUZA 4N9OB 5DJAA 3TO4A 2ZCKH 4KPHL 2B4CC 2VXVH 2W59A 3V5DA 5BRZD 3V6ZB 3TC9A 3PHQB 5DI8B 2WUBL 2ZUYA 5MHSE 2V7HB 3KWWB 3BZ4A 4KK8C 5ISZE 3DTXA 4Y16B 1T7XA 4FQXA 1MRFL 4DN4L 4ZTOL 4GH7B 2PTTA 3O3EB 3IXTB 3QDGB 3O6FA 2AJYL 4OT1L 1D5MA 2HFGL 1BD2B 4XVTH 2O5ZL 4I4WA 3KR3L 4I2XE 3T0XA 2X4PA 5INDA 3RVVD 4XBGB 1FFPA 3UYPA 3EFFA 4MAYC 4M61B 1XGYH 4R7NB 1TNNA 5D5MF 1J1XL 5C2BL 5EWIH 1MI5A 3GBMH 3CXDL 3VFPA 5IBUB 1V5JA 4YFLF 5CWSB 2FLRT 1U8IA 4Y19A 4WU5A 1JGLH 4LVEA 4I48A 5E5RB 5ETUB 3KLAB 2BFVL 4XVUC 3OKMB 4GG8A 4X6BB 3Q0HA 3QP3A 3SKJH 3RKDC 3TFKD 4QLRA 2J5LB 3LS4L 4OJFH 5TPWH 4HC1H 3W39B 2GSIA 1G0DA 3SCMA 2R4SL 1WC7A 5IJVB 3TA3D 4A6YL 4F8QA 3FOMA 1VFMA 2VDRL 4OKVB 4QHMB 3NIGF 3RVWD 3CH1A 3QRFM 5BV7L 1FNHA 3OXSA 2M2DA 3T0EC 3CU7A 5JLZB 1JYNA 1IAII 1MLCB 3IFPA 4ZTPH 1U8MA 2EEBA 3PXJA 5T1DH 3O6MH 4FQHB 4N90E 3PJSA 1KJMA 4OSUL 2XNAB 1KXTB 2GJ6B 4OFYA 2XTLA 1OD7A 2WMPA 3JUZA 3O41B 4PJDE 4XGZB 5D96C 1PQZB 1U8OA 4TUOA 3WIIH 1MHPL 4JCMA 1U8MB 4ELKB 3X11A 3AB0C 1XGUA 1N6QL 1D5XB 3SGJC 3C08H 2K9UA 4DW2H 1U8KA 4FP8L 1IRAY 3BEVA 2J3SA 5EPMA 2UYLB 4M7LH 4NKMB 2O5ZH 4OCYH 4MAYB 1LE9B 4TVPH 1XGUB 3WLWC 1UWGH 5MEOB 3FQRB 4BK5A 1JHLL 2V5SA 1EO8H 4LIQE 4JFXB 1KENH 4HIEA 1D6VH 4JO1L 3WD5H 1P4BL 2XZAH 4JPWH 1EHLL 3BKMH 4Y8DC 4LSPL 5HXMA 1FP5A 1MQKL 3ARVA 4X9FA 5CGMA 4MD4A 4L8BB 2CLRB 4Q9QH 3WJLC 1LO2H 1DN2A 3HNVH 1ZGLA 1Z0MA 4GS7B 4JN2B 5LAXB 2JKXA 1S7RA 2AABL 2P45B 2VUYA 1FL5B 4OLWH 4LVHC 2X4PB 4QHUB 1T1XB 4NQEA 1FL3A 5ELIA 3MRNA 5I1JL 4KVCH 5CUSL 1T1ZA 2Z31D 3BUTA 2B1HL 4NUJB 2BMKA 4U6VH 3MFGB 4S2SA 5CGTA 4DKAA 4JQIL 4WFGD 3ZYOA 2EDRA 4FHBD 5GS2D 4QRRE 4K71B 2Q87A 5JORA 1N0XH 2IAMD 3IFNL 1A1NB 2DQHL 1HE7A 4LSQL 4P2QA 5J6GA 5DA4A 2MCG1 4WO4C 2FJHA 5FUZL 2G9HA 3IETA 4LDEB 3V7AG 3V4VL 4GAYA 4QTHA 3HFMH 2DQJL 2EYTB 2BXZA 4BUGA 3C09B 3TNMB 1NGQH 1MVFA 3SDXF 4PPTA 2XXCB 4YR6B 1F02I 3GJFB 3ROLA 4LLMB 4Y4FA 1JN6A 3VFSB 4PJ5A 3P73A 2MWCA 4FQLL 1RK1A 3DO3A 2I07B 4QCIA 3C5ZA 4W4OC 2R1XA 1FJ1B 2DDQL 2OS7A 4AQOA 1F90H 2BVQA 1OSZB 1ZWIB 3G6JB 1HHIB 5FDWB 1DDHA 4GBXB 4FOMA 3U1SH 3F58H 3R06A 5TF1H 3F6LA 4H25A 3U1SL 1KIRA 3OR7A 5JXED 2XRAL 5ID0A 3WUWG 4NNPH 1LP9A 5C0BA 1UKSA 4WUUA 3VD5A 4JRXD 4XPBL 3OAUL 1NUFA 3MUJA 1BEYL 4JAMA 1YY8A 3R0MA 1FNSH 3U4AA 3NGBB 4HBCL 5DLML 1M05A 3TVMB 1XGQB 1JHLH 2Q7YB 3SE8H 1KIPB 4XCNA 1PKQB 5B4MD 3MNZB 4QXTB 4JG0H 2VXTH 1TJGL 2EICA 3L3KB 4Y2OA 1I1AA 4DJMA 4MNHB 1RVFH 4KQ3H 1PKQE 3S5LG 3V6ZA 1FAIL 5F7UA 3QZWB 4PRNB 4W81A 2OP4L 3U36A 3ARRA 3L3IA 4Y2DB 1KPRB 4HWEL 4G9FB 3HI1A 1KN4L 5D7LA 2R8SH 3IDIB 4HMEA 3P0VL 3MA9H 2PYFB 4LHUG 4L4VD 4M7ZB 4Y4KA 5C0CA 2X4SB 4N1CA 4HDIB 5D7SH 1DSFL 3E6HA 2BRQA 1VGKB 2XOTA 3DROB 1DBML 5FYJH 5F7LB 4F7CB 5CEYB 1YEJL 1A1OB 3QUXC 1EEUA 1U3HC 3ZT7A 1WZ1L 3QHFH 4I4WB 3HMXL 5DQDH 3SO5A 2ZNXA 2FH6A 4HXAH 3QG7H 2A1WL 2VC2H 3FO1B 4HAFA 2GUOA 2QV2A 5DMKB 1H9VA 1JGVL 2HH0H 4LNRA 2MQ0A 3G6AB 4PY8J 4QOKA 2AK4D 2NY3C 4N0UA 3UTTE 2P5WA 1VFBA 1DE4B 2J8UE 2PXYD 4O51A 5CKAA 4JDVA 2GQHA 3U9PH 4M7LL 2NXYD 3TBTB 4V1DA 2KKQA 4EI5C 1SEQL 5GGSA 5KVEL 2EEDA 2WWMD 3BJ91 2P1YA 2O5YL 1X5HA 4PJFF 4KK6D 3X3FH 5C07A 3HG1A 3P4OB 1NBVL 3ECBA 4LLYA 4MA3A 1U92A 3TGXA 3VJ6B 3DETC 4NPYB 2MCPL 3TV3L 3BEWB 1W0VB 2N1KA 3VFOA 3G04A 3TBYA 3GMPA 4NCC1 6CGTA 2DWDB 3VFMA 1KYOK 3VFUA 4U31A 3ECBB 3O4OB 4LLYB 5KSAB 2FHFA 5J3HD 1IEHA 1I3GL 3RNQA 1E0OB 4OUOA 5IESL 1UB5B 2XY2A 4C59B 3LV3B 1M7DB 3BQUA 3S36X 3L7EB 3MRMA 5EZIH 3HMWH 3WDHA 4NQDD 1H3TA 1P7HL 2IBZY 1GYAA 1TXKA 3AAZA 2I5YH 4FN0A 2WWKT 5I1IL 4BZYA 1NEZG 4ZNCD 3L7EA 5EUKB 3TBSA 2SEBA 5I74C 3MOAH 1XAUA 5KN5A 3ESVF 4OZGA 3NFNA 5KSBE 1BBJA 1K2DB 1KB9J 5EG6C 1MJ8H 2NW2A 3BKYL 1DEEB 4G9FD 1KIQB 3QFDB 5GGTH 4Z77B 1T66C 2GITB 3FB6A 4M1GL 1MHPH 1KJ3H 4M43H 1OTSD 5E2UL 4JR9H 1A4JA 3TZVD 4UOJA 4TPRL 3S34H 3IDIA 3U7YH 1LEIA 1QOKA 4LARH 5DD0H 3DRQB 5HVGB 4Y88A 4KMTL 4P3WA 1TJIL 2CQVA 3VWJD 4UDUA 4NZUH 4KKCD 3M1BA 3PL6A 4HGKC 5F93C 4NO0A 3E2HC 2ZWLT 2FO4B 4KVNL 5ENWA 4P2OD 3T8XA 1EV2E 1LP9F 4FFWC 4R8WH 1RZKH 5JDSB 3HG1D 3D25B 2CO6B 1U2HA 3WXWL 3GSRB 4FRWA 4PJDA 1MFBL 3BX7C 4ESKA 4G43B 4L8CB 3Q3GA 4JFFA 2VXVL 5I1DB 4M8QB 4NZUL 4KI5F 3GRWA 2RCSL 1INQB 2OZ4H 3H3PH 4LPTA 2UWEA 1DQLL 2MFNA 2WIMA 3S8WA 4M7KH 1KV3A 2ADFH 1QSFD 1QFOA 1FL3B 5CMAB 3TVMD 5ERWB 3P9LA 1PAMA 3QDHA 4P46A 1MRDH 4K94C 3B9KC 4LCWE 4XBPA 1WT5C 1I1RA 2H1PL 4TUJA 4DK3A 3CSYB 4U6YB 5CZVH 3UTPE 4PGBB 1MQ8A 1YEHH 1NGZB 2VR9A 2A74B 4M6NL 5MENA 3B9VA 1RZFH 2AEQL 5F9WB 1E27B 3HFML 5AD0B 1AC6A 4KRMB 2GW5A 1GGBH 4AG4L 5HI5C 3L3KA 4NQDB 5HPMB 4F33B 1HZHH 1OGAE 2FX7H 2EIZB 3S3JA 3B4NA 2OR9L 5DDHB 4QRUB 3F65A 5K9JL 4IRZL 3LS5L 3QXDB 2VZVA 4NOFA 1S7XA 3HE7D 1NFIB 3CUPA 1T2QL 5IVZB 4LLAA 1V7ML 5I75C 3QIBA 1XGQA 1ETZB 2JB6B 3I75A 3BP6A 4YDLC 4LSSL 1UGNA 2J88H 4J4PC 2AXHA 1N5YH 1DN0B 3NIDE 1YY8B 3RY6A 2Y7QA 4PJ7F 4JHZA 2P7TA 4OZFA 1SVZA 4ODWB 5EO0A 1S9WA 2B4CH 1JWMA 3TN0A 3F7YA 5J12C 3WIIL 4OM0H 2FWOA 4RNRA 5EIVA 3NN8B 3RWIB 2O5YH 3S5LA 4BQBA 5JHDD 2NXYB 3EJYD 3LH2H 5KSBA 1EBAA 4XH2B 4NC1E 4WTXA 5FKPA 5TDPA 1ZK9A 2XWBB 4ZDHA 2EDKA 2BSTB 3ALXA 2R0KH 3PWUA 1EVUA 3WXVH 4Y5YB 4WI3A 2EDQA 1T7ZA 3MLTA 2CKNA 5IHUH 1NCDL 5GZOC 2XTJE 1U0QA 4JPKL 3WFBH 2D0HA 2JIXA 3L3DA 1ZT7B 5BO1L 4WHTA 2ZCHH 2VXUL 2F54E 3DYOA 2JK5B 2ESVD 2ORBL 2LVEA 4YQXH 3BD3A 2QQNL 1ZTXH 4PP1C 2BSSA 4LOUC 3BIKB 3IFLH 3QUML 4PGCB 3QAZC 3TYGH 4HWNA 4PGZA 1PQZA 5DGQA 2NY0C 4LMQE 3LB6C 5F88A 1X5KA 4EIZC 2H26B 3GSNL 3IS1X 2A6DB 3OKDB 2YD8A 5D7KD 5TDNB 4NO5B 4Z7QE 3SDAA 1H3WM 1Q94A 4MNQA 2PO6C 3H2WA 4G6JL 2KBGA 4LP5A 1NCCH 1E4JA 1FO0L 3NTCH 1CS6A 2GCYB 3ZSSA 1KJMB 3QDJD 3FO2B 3SGJA 4KKNA 2NY0D 15C8H 1FZMA 1N8ZA 3QQ9D 3TT3H 5JOFA 4JG0L 1U8OB 1DR9A 1KCLA 4UUJB 4P4KC 5F6HI 1ADQH 1CFQA 4FFZH 1INEL 1OLLA 5D1XC 3VWJB 4KRPC 4JRXB 4BK4A 5I1AB 5GGRY 1MEXH 3WS6C 4OFPA 3G5VB 5T3XD 5GGVH 2X44D 4QRRA 4X83A 2IGFH 3D0LB 2R39A 4QF1A 3CGTA 1KXVC 4ENED 3DGGA 5D1ZD 1A14L 4GW1A 3P4NB 4OLYH 1K4CB 1T2XA 1QBBA 4FXGB 1P7QB 2NX5B 3CVHB 1X7QB 2PXYA 3NFSH 4X5XA 3QUXB 1ZGLP 1SYVB 4GMTH 4PB9L 1T0NA 4PJ5E 3QXWA 5DI8A 5DMJB 4UT9L 1WCBB 3T3PE 3IDUA 4JRYA 5HY9A 5CD3A 4WIQA 5AZEH 4V1DE 1IL1A 1G6RA 4G3YL 4LSUH 3PWNB 3QUYD 4JFED 2XWJB 5KVMC 1N6VA 1JK8A 5D71H 4FNLH 3KPLB 4JKLA 5I16B 5I0DA 4LCUA 2FATH 3B9KB 4KKLD 4OGAC 2VLJA 4TRPL 1JNHB 2WW8A 3GSOA 1G7JA 4WI4A 5F70A 5F1IA 3IDNB 1T83C 5MERB 5DEGA 5EORL 2CR6A 1J7VR 4K7PH 4YX2H 3BXNA 3ES6A 3QCTH 3SKUD 1VGEH 3QIWC 1JWMB 4XMLH 5F7NC 5IIEB 3P9LB 1KFAH 1L7IL 3HUJE 4CN6A 3GSOB 3VD9A 3QFJA 4HGWA 1GHFL 1KUMA 3GSNA 4FTVA 5C9KA 1U58B 2F58L 5KVDH 1MRCH 5FHAL 1N5AA 3BW9A 4HWBL 5HGBB 1F58L 1B0GA 1NBZA 3O2VH 5MENB 3LRSB 3RWCB 1Y18A 5I1JH 4WU5B 3H7BB 5EOQL 2V2WA 1QA9B 2E7MA 3V4UH 1BM3H 4QGTA 3SGEH 1RHHA 2DQTL 1KEML 3GSRA 3IGAB 3UJTH 3MCKA 3MA9L 4JQVA 5JIKA 4EOWL 4Z8FH 3VXPA 2X9YA 3KXFD 3S3SA 5EO1A 3HB3C 1L6XA 3T8XB 2NY2B 2F58H 2AK4A 4S0SD 4GUPA 2YA0A 3WXWH 3KPQB 4OM1H 3C60C 5DT1L 1AC0A 1MIEH 1W8NA 5GRZA 4S1SL 3MRQB 1NMBL 5ACZB 5I66A 2PTUA 1CXLA 4KKAD 1NGQL 3RTQB 4GLRH 1P1ZB 5GIRA 1TJGH 4JFFB 4A2LA 1JWSA 1GH7A 8FABB 5C08D 5IEHB 4O2FB 1X4YA 1A6TB 4RAVB 3CCHA 4X5LA 2CLVA 5DK3A 5T3XL 3AUVA 1RUAH 1FC2D 5H2BB 3DX6A 5FYLL 1ZLWH 1CQYA 4ODWA 1BQHA 5D6CA 5DWUH 3T65A 3W9EB 4DW2L 4PJ5D 3O6FD 2GITA 1RIVL 5CLWA 1CL7H 3WCYA 3UP1A 5IQ9A 4I9WD 2EIEA 4RIRB 5IF0A 5FKPB 2B1AH 5EOCJ 4YIQA 4HT1L 1E6JH 1Q0XH 2D31A 2DBLL 1QRKA 4YXLL 1BGXH 3U48A 3OV6A 4X99A 3TEUA 4XP6H 3TH4T 5IROC 5DUBB 3UTSB 2VLKE 2APVA 4FXLA 4Q0XH 5CJ5A 1A02N 1LO2L 2XFXA 3ULUE 3ULVC 3X17A 2IADA 4NKQB 1U8JB 3VXRD 2H2PD 2JB6A 3I75B 1AHWA 5C70A 1EXUB 4R2GB 4YBHA 3TJHD 1JZ7A 4CBPA 4M6OH 4U3XA 1G6RH 3ZDXF 2AVGA 2A6KB 4JANB 4F37K 2HT3C 4FQCH 3V7MA 4NC2B 3WFHA 4X98B 3JWDL 4OLVH 1MFDH 4XPHH 3CFBB 1DQDH 4U1SB 2W60B 4LCIH 4U1GC 2OI9C 3FHQA 4X7SL 5JDJA 2ICEA 5FIEA 4MX7B 5DYOA 4EI5A 3OJDA 1MWAA 3PHOB 3NCFB 1MCOH 1GJIA 4XRCA 1KCRH 4P9HH 5FYLD 4HH8A 2DWDA 1KCRL 3ALWA 1S9VB 4MMZC 3HZYA 4U6YA 4PGBA 2BZDA 2B2XH 4LAJH 3VA2C 1I85A 5F72S 3HUJA 2VDKL 3VFPB 4Y4HC 1HKLH 5D7JC 1HQRB 1LEKB 4MCYB 2BNRE 3QFJD 1HNGA 2R4SH 4ZAKD 4IOFC 3I6LD 4BH7A 2XKNA 3RU8L 2AGJH 2IAMA 5LJYH 3RQ3A 4C56B 1VKXB 5LBSL 4F3FB 4BELD 4NFBA 4P9ML 1A3LH 2FD6H 3UYRL 4KI5E 5AEAA 3DUSA 4UQ2B 3CLEH 4WRLA 2P43B 3DRTA 1BHGA 5EBGA 1I7RB 5HYIA 3FONB 2LABA 1MI5E 1T1WB 3JXAA 1J1OH 2BOCB 4OBSA 4RZCB 4KAQL 1EEYA 1NUDA 2G2RB 3MV9B 5FGBA 4JDZB 1J1PH 4TNVK 4OZHE 4MLIA 1KTLA 5DD6B 5BZDB 2AXGB 3GO1H 3MBED 3D3VA 2D03H 2AP2A 2VDMH 1GZQB 5F44A 3HE6C 5CJBA 3T2NL 4P2QE 2EH7L 4JFPA 4NT6A 4PB0H 4XVSH 2X4TB 4B53A 1GCFA 3X13A 4ZUSA 3QRGL 1DCLA 2CKBL 2GYSA 2HG5A 2YPKB 2ZG3A 3MACL 5HYQB 1N3NA 5DGRA 2Q86A 1S8DA 5ID1B 3IFLL 5IMLA 2B5IC 3FB7B 1AGFA 2VABB 2NY5H 2VISB 5GRJL 4HBCH 5DLMH 3AU1B 4JKKA 4A2MA 1IM3B 3WO3B 1A6AA 2OR9H 4U1NA 2BHYA 3UJIH 1X4XA 4P2YA 4B5EA 3KPOA 1KSRA 3TP4A 4X9GA 1OAUL 1K5NB 2AQ3A 5KS9B 3L3GA 1YPZE 1UWXH 1B4JH 3P30L 4L5FH 3ULVF 1FVDB 3MGAA 4O2EA 3WFHB 2EZ0D 4YHLL 1IC4L 4XZUB 2AAVA 3UJTL 3L9RB 4LQFH 4Q74A 5C8JB 2A6IA 3GK8L 4P2RD 2GJ6D 5IVXA 1QSFB 5IVXF 3L5WB 5C86A 5DHVB 1DZBA 1KJVA 1RULH 1YMME 4HCRL 5F9OL 4Z9KB 4AL8H 4LSVH 4ODTH 5HHVH 3SDYH 4XP4L 4JO4L 5CCKL 2DKMA 4NM4L 5FO8A 1U93B 5CEZH 4E0RA 1X9QA 5F96H 4AL8L 1GAFL 1GGCL 1W72H 1T03L 5C6WH 3T4YA 4ZXBA 3PUCA 2XV6B 4J8RB 1F4WL 2KQMA 3JTSA 2BNUA 3SCMD 1MCIA 3H3PL 5KANG 4D0DB 4KXZI 2BNQE 5DVOA 2V2WB 1MCJA 2V2TB 1EFQA 2QHRL 4QTHB 1KEGH 4K3GA 1W0WA 5C9JB 3HPLB 2VN7A 4KJPD 1JPST 5E5MB 3IFNH 2AJSH 4L4TD 4LVOB 2ERJC 4MQ7A 3KYOB 3OJDB 3PHOA 4YR6A 3QPXL 4S1SH 5CGYC 2CDGA 5JW4N 5BS0E 4PJIF 4EI5D 4ERSH 3ILQC 1FZOA 2WQ8A 3ET9F 4O4YL 4LIQH 3WFCL 4ZFZA 1G7LB 1OAXH 4PV9A 1KG0A 5SX5K 2ZP0T 4N8VB 5IFHH 1GGBL 4GW5A 1RURH 4OGYH 4M00A 2IPKA 1FIGL 3CFDA 1V7NH 4HEPG 2IADB 3T2NH 3EYVA 1ZSDB 5ICYA 2E7LA 4XHQA 4UTAL 4H25B 4YUEH 3UJIL 3WJJC 4Y7MA 2FYYA 1QLEL 3FQTA 1NGXB 1BF8A 1HH6A 3IYLW 3PWLB 2NY4D 4XNQA 1SJHA 4RMRA 1U8QB 4R4NC 4JFXA 1QVOA 4HKBB 4PS4H 1S7VB 4X7EC 1J5OH 2JLLA 3EOTL 4O5LH 4CW1A 4NO0D 5BRZA 4LGSB 2NW2B 3RVTD 4BSJA 4KJQD 3D1MC 5E7FA 3PQYB 4XWOC 4NQXB 4MNHA 4TOYL 1U91B 3U0WH 2FBJL 2VXQL 4EI5B 5I1IH 1WJ3A 4JJ5B 3I6GA 2VSCA 2CJUH 3JBG7 4P4KB 3JVGA 2IQ9H 3QI9B 1OQOA 2P4AB 3PGFH 4OUUA 5T1KB 4BSVA 3DXAD 5K9OB 3QNZB 5HHQA 5I17A 1PYWA 5LQBL 1AY1L 1UJTA 1AO7E 4PG2A 1XH3A 2A6KA 4PB9H 1VACB 1KXQE 3WFEH 4JRYB 2VKXA 2KL6A 3SDAB 4J3TA 1CTOA 4PY7B 3ZKSD 3UPCA 3RNKA 4E42A 4L8BA 3OKNB 5EUOB 3SCMB 1ITBB 1F6LL 3S34L 4X5WB 3VFTB 1BAFL 1PKOA 5T1LA 3HZVA 2AI0H 7CGTA 1ZTXL 2C26A 5DXWA 4KZEH 2WIIB 5TE4H 5LBSH 1MAML 1NAMA 1T89C 1BZ9B 3MCLL 3VDAA 3QH3A 5IVXE 1UYWH 5HVHB 3D5OF 3PV7A 3RVTC 4JGJA 3V6OC 3GBLA 3FAWA 4PRHD 1DJSA 3LQAH 2AEIT 3C60D 1EMTL 4P2RA 3ARBA 1S7SB 3NZHH 5L2KE 4TUKH 1DBAH 4QXUH 3FO9A 4PJBE 3W9DA 1WWWX 2DMBA 1OAYH 3AREA 4WGVB 2G9HB 3IETB 4DQOL 3ME0A 5C0FA 4MD0A 1QTYT 1CFQB 4OZHF 1QLRA 5K9QG 2VSDA 1S7TA 4HS8L 5EIQA 4R2GC 1RAMA 1FZKB 4PTTA 3I9GL 2HN7A 5DFVC 4I0PD 1G9MC 4PV8A 4XAKD 4OZIE 1XCQA 3TZVA 5E56A 2BNQB 4OFDA 4QOKE 3LKOB 4TQEL 3L95A 3HLAA 1MELA 4P2CG 4JEGB 1A3RH 1WIOA 1JF1B 5EOCH 3LPGA 5BOZG 2VAJA 4K3DL 4ONHB 4UV7L 2ITCB 1RVFL 1I9RH 5DUPL 4PJ7A 1SJHB 1X5XA 3PXHA 1MCPH 3KLDA 5D5MB 1IAOA 1JWUB 2AK1L 1BECA 2FIRT 1FZJB 1VEOA 3WDJA 1DQQA 4DKEL 5I73B 3HMXA 4DAGL 4DTGH 2APTA 4J2XA 5K9QI 3QG7L 4MHHI 3A6OA 4QXWA 2FJHB 3PNWA 1IEAB 4NQUA 1S7WA 4KH2A 4GRWE 3SKMA 3ZKXC 5HPMA 1IAIM 3GKZA 2FEDC 3QYCA 1INDH 1T7VA 1YEKH 4CVZB 3MMEB 1J8HA 3VFRA 5CEXB 2W0FA 3F7RA 3MLYH 3ZDZE 4DOHE 1KIUA 1CCZA 3O2DH 1DL7H 4YDJB 5FYKH 4PJBF 1MFBH 4TVPD 5KVDL 3B5HA 3MJ9A 4XPAH 1C5DA 3UXFA 1RFDH 4PBXA 2F5AL 3D69A 5DEFA 4OZHA 4KUZH 3MUY1 2E5EA 3MA7B 3IRPX 4P5TA 4XP5L 3GKWL 3QUZA 5D1QA 3RX8A 5HI4C 1OCWH 1T20B 1UFUA 1I3RA 4M8QA 3TLRA 3W5MA 4X0KB 3C6SA 3P4MB 5FF6A 1FFNB 4FQJH 1FG2B 5E5MA 3FQWA 1KJVB 5GSRA 2HVJB 5F96L 1NDGB 4HXBL 4LCYA 4LKCB 1JL8A 3QO0B 2BVEA 1S9YA 1D9KA 5MI0B 5FGCE 2PF6A 4MSWB 3LKNB 1N0LA 4EIGB 2VDOH 5E9DB 3UBXG 5F1NB 1H5BA 5GS2H 5I0ZA 3VGAC 3DVGA 4U6HB 1OP5K 1EGJA 1XF2B 5L8LB 2UY7A 2IEPA 2HKFL 2VISA 4MAYD 2FD6L 1I1YB 1YEDA 1B9ZA 4ODXB 1CI5A 4KJQC 4N0YH 3MGTA 4M3JA 5GS1C 3MV11 2BY3A 3I2CH 3T0BA 1G7LA 1X4ZA 4HS3B 5E4EB 1J0KA 4HAGA 4JREC 3BKJL 3DX7B 1P69B 5J8OA 3O3AA 2IBBA 4GW4A 4PJ9D 2OL3L 5CJOH 2VMFA 3QQ9C 4M5ZH 3HC0B 3HAEH 2E9IA 5IKCA 3F5WA 5DHVA 2J4WH 3S98A 4ZG1A 2OTUA 5D2LF 2NY0B 2OM5A 2Q8AL 1H3VA 3TBSB 3RZCA 1I7ZA 5DEZA 5L7XL 1KCUH 4S1DD 3KXFB 4F7TA 1KB5L 1JPSL 5KSUA 3HUJB 3QH3B 1YDPB 4R97C 4CAGA 4LSDA 5LVEA 2ED8A 3CX5K 4XI5D 2UY6A 4HIIA 3X14A 2FJFB 4ZDHB 5J9PB 4HJ0C 1F3DH 3FB6B 1C12A 1JFQL 1QSVA 4F3FA 5D1XB 1A4JB 5LG1A 1CFNB 4HFWA 2JCCE 3L3DB 1RMFL 1A3LL 4MA1C 4XB8A 1G6VK 1QRNA 3KG5A 1ZT4B 3IKCB 4P3DA 4APQA 4ODVH 1RZGB 3P3YA 3OR6A 4LSPH 2CIKB 4RZCA 3QIWD 5IESH 1S9KC 1MHEA 3IT8D 4HJGB 5EZLB 5ANMA 5F89A 1EERB 4DN3H 3QEQA 3CU1A 4OB5H 3BGFC 3EJZC 3UO1L 2E27L 1VKXA 4K3EH 4PG9B 3AAZB 3N1GC 3KJ4C 5DFVD 5B38B 2I60H 1JUFA 3GSVA 1ZVHA 4YWGH 2H9GB 2BDNH 4QHNB 4IM8A 4Z7NF 3RIFF 5FGRA 1CLOH 1NGXA 3FQTB 5DUML 3ILQD 4BUHA 5GPRA 2Y6SD 5F8QC 4C56D 4R96B 4M03A 4BH8B 1V8HA 4NGHH 5E2WL 5T3XH 3TYFA 5ITFA 2CO7B 5BV7H 2P8MA 5BS0D 1H8NA 1JRHI 3I6LE 2ICWJ 5JPNA 1DBKH 5JZ7D 4D0CB 4FTVE 3EUUA 5I1GL 5TFSH 4KY1H 3REVA 4Z7QF 5TPWL 4MLSA 1LE5A 4OD2A 2BNQD 1DQTA 3NMEA 4KRPD 4TULL 2EKSA 2QEJA 1HH9B 3FN0H 3RA7L 4YXKL 3L5HA 5KTEL 5HDBE 4PJIB 3HHRB 2F74B 1LE5B 2RGSA 5A3ID 3D25A 3QULA 4YDVB 4M48H 2R56H 4OV5B 3NA9L 4LVOC 3BP7B 1S3KH 4QRSB 2YPLA 4P2RE 1NL0H 3G08B 4DGIL 3V79C 1NAML 2ADIA 3QHZL 4X7TA 2VDLH 2GKIA 4OIIH 3EO1B 4XCEB 4LHUD 3U4BL 1ZE3C 5J9PA 2F8XC 5KOVC 4LVNC 3QZWA 1IARB 3KR3H 1VCAA 3G08A 3QEUA 1BJ1H 2LFGA 2EE9A 3VXRE 1UXWA 4GKOA 1ZHBB 3QJHA 4NO2A 4IRSD 2ICEB 1LO4L 4N0FA 3EYFA 4F58L 3VXUA 1Q9OA 2XACC 4FG6D 5DVKA 4JB9H 1A4KA 4U6VL 4UNUA 4AEIL 3TNMA 3DMMB 1CGYA 2DRUA 3MV8D 4WI8A 3NCJL 4F15B 4KUCF 1T04B 2R4RH 2JIXD 1OW0A 1FBIL 5DD3H 4OLWL 1G7MA 3AC0A 4ONFL 5MEQA 1RJLB 4GKNA 3IB4A 4G9FE 3P30H 3RY6C 4R3SA 3MTRA 5C08B 1XR8B 3UTZB 4ELMA 1OWRM 1MH5A 4MNGB 3RHWF 4G9DB 1JYXA 1QFUH 4H8WL 5E95B 4PIRF 1OVZA 5GGVL 1R3KB 4PJGA 2A6JB 4I8DA 1JRHL 1FN4A 2BP3A 2X42A 4J4PD 3QQ4A 3RTQA 3ZKXB 5C0JA 3QCUL 1C5CL 2V2XB 2BRRL 1EAPB 5FUZH 3LEXB 3KYMB 4RWYL 2R29L 1T22B 3G6DH 1A6WL 4R0LC 4OCSL 3R8BB 2IWGA 4LPCA 3QIBD 4K2UH 2OTUB 5A2IH 2J1KA 3IAPA 3NACL 2GTZA 5EBMA 3WMSA 4NKDA 3KYAA 2AJVH 2XYCA 4UUJA 3QDME 5F3BA 3JV5A 3RVUD 1I1AD 4I18A 4N0CC 3S37H 2YUVA 5FO7A 2C3XA 4UT7H 5BW7A 4WEBH 3MR9B 3VXNA 5GGUA 3VW3L 3UX9B 1YPZB 2V5MA 4UINL 1IL1B 2E27H 4KKCC 5C09A 3IF1A 2NYYD 4WV1B 1T1XA 2ZZUT 1V3JA 4M5YH 2FBOJ 4RGMB 1ND0B 3BGFB 3KJ4B 1LVEA 3REWB 1BQLH 3RL1A 3EBAA 3MRKA 4ZQKB 1AO7B 1M7IA 2G60L 3VFMB 4GW4B 2FO1A 1IGJB 4MZ3A 1ZEAL 1OHQA 3EYOB 3DX9A 4HJGA 5EZLA 4XNXL 5ICZB 3RZCD 1Q9WA 4HS3A 2EDNA 4XT1C 2AXGA 1R5VB 2AEPH 2Y07L 5B22A 3U83A 4XTRD 1KT2B 2QADC 3KXFA 5E2WH 1ACYL 4LASH 2CKBB 1RZJH 1CZ8L 1RK0A 1GL4B 1FIEA 2C3HA 4XXCA 1HNFA 1ZT7A 1CLOL 5I2IB 2CH8A 2R2BB 3KPSE 4G5ZL 4UIKH 1G7JB 3DV6A 5EWIL 2MPAH 4WW2B 3AY4C 1J8HD 4LCWB 5T3ZL 4NP4L 2NMSA 5HDBF 4QHLA 1RZGA 3OR6B 3NBNA 4AM0B 1B90A 4Q6IA 4NO3B 5CJQH 3KPSD 5DJXA 5GHWL 2VDRH 5C0AD 1NSNH 3HR6A 1NLBL 4X6BA 1CTNA 3FFDA 5LQBH 4POUB 1F3DJ 5IMMA 2Q3ZA 4IDLA 5FYKU 1D9KD 2XG4A 3MRFA 5C7XH 3HMXH 3NACH 1HHJB 3MYJB 1IGFL 2GJZB 2A83A 4G6FD 3SDCA 4OTXH 3FFCA 4HULB 1YECH 4ZUUB 4O58H 5CSZA 3BIBX 1M05B 1R3JB 4H88L 1CE1L 1LNUA 3OXRB 4KPHH 3FN9A 4HPOL 1SHMA 3VD3A 3V0AC 1SJEA 5HYJD 5DK0A 3GMLA 4XCCL 2OI9B 43CAB 3BD4A 2V5TA 5TQ2H 4ZO8A 5HGDB 1V3LA 1NUGA 5EB9A 1XGYL 1GC1L 3K2UL 4IRJC 4R4FH 1EA9C 3HPLA 2H8PB 3TBWA 4LKXA 1CXFA 3UPRA 3H9ZA 2DTML 1S7VA 4XWGL 1A5FH 3WIFB 2EECA 3MRRB 2D9QB 2O61B 3W2DH 5I19H 1S7WB 4LRIA 4KTYA 3QXDA 4XX1E 4C83B 3A0OA 4R4ND 5GGTA 2HFFB 3LDBB 2ATKA 2R1YB 3DVFA 1AI1L 5I8KH 4K8RC 4JQVC 4Q58C 3H7BA 5DD5L 3QWOA 5T33H 1RUKH 5GSVB 1F4XL 1I3RB 3ZTJH 4MJIA 4X4ME 3TCLA 3MLVH 4FQ2L 2VWEE 3IGAA 2EYRA 1JHTA 4KK5D 3HRZB 1I8IB 1VACA 3WN5C 4L3EB 4WFGE 3NVQA 1DUZB 2ZUVA 2DQHH 1N64H 1UH4A 3O8XC 2YWZA 3LKPA 4XC1L 2PYEA 1HHHA 1K8DA 1JWSB 4D0DA 3W81A 3RJDA 2X9WA 4APQD 1GZPA 4GOSA 4KK5C 2F5BH 3QEUB 2DLTA 4M43L 1HHKA 4ODSL 3HE7B 5ICZA 3OF6A 3QISA 3D0VA 1T5XB 1EJOH 4XMLL 2ESVA 1S7QA 1JMZA 2R0ZH 4L4VB 5I1CH 5HDLA 1G9NC 4RNRB 4XBPB 1MCEA 4O2CB 3CFKA 3HZMA 5B8CC 5D1XD 1RHHB 3D2UA 5F7DA 4ODUA 2FATL 1L9NA 2DQEH 2VDNH 3VCLB 4IMKC 2CLZA 3ARGD 1NPUA 4OCRH 1QSEB 1P4BH 4JPWL 1BZQK 1JPGA 2DJ4A 1CLZH 4PRHE 5LCVL 1OPGL 4JZJA 1XT5A 1WCQA 2YEZA 2ED9A 4Z7VB 5J1SC 2NZIA 3FT3A 2DLFH 3K1DA 4QHLB 4D0BB 5HGAB 2CUIA 3QXTA 5DDHA 5ICXA 1PG7X 1CICA 4OCYL 2YBRA 3WSQH 2X1PA 3EGSA 2WBJB 3GSUB 4LRNL 4ORZC 4R4FL 43CAA 5DMGD 2APWA 3DBXB 4N1HB 1QHPA 1CGSL 3RWGA 2X4TA 5EIIB 2XWTB 1BIIB 2GJ6E 4MAUL 2ZSVB 4OCLC 4X7CC 5ITFB 4MAYA 5ILTH 1BJMA 5KG9B 3DX9B 2YPKA 3VFVB 4PJGB 4RMQA 1TVHA 5JUEL 4Y5XC 5CSBA 1U3JA 1BBDH 2X5PA 4IIQB 1CZ8H 3FQUA 3UPAA 4WW2C 3AREB 4KV5E 5DJ6B 3IF1B 3TT3L 4GG6F 2ZJSL 3N9GH 4WY7H 4EUPH 1E4XL 1RSFA 4P4KD 4X4YB 3V5HA 4HZLA 2YZ1A 1YEEL 5IEKA 1B4RA 2YHGA 4GRWH 3T0EB 3DUHA 4QXGL 1X6NA 4Y1AB 2BVTA 2XKNB 3BT2H 4X98A 4OUUB 5T1KA 3PWVA 2NY4B 5JW4M 2CKBA 1JHKL 4AIXA 4P4RB 3NA4A 2OMBA 1ND0A 3REWA 2VYRE 5JZ7C 1FLRL 2GT9A 1IFHH 1EJ6A 3SJVD 3KPPA 3QDGA 1FSKC 3N50A 4MA3B 1EMTH 1TTGA 4RFNC 1OAZH 3T2PA 2VTFA 5ADPH 3CVIH 1A7BA 4QHNA 4FQQB 5F7KC 3U9PL 1LD9B 4NWTL 3VRIA 4ONOA 4QRPE 1MCSA 3WS3A 1MPAH 2Y06L 4NDMA 2ZNWA 5JR1H 1I8LC 1ZHKA 4NN6C 4JHWL 1U41A 2W92A 2W9EH 2KDGA 3QNXB 4LPUA 3QEGH 1OD9A 3T1WA 1SJVA 5FUOL 4OCNC 4FQPA 1YEJH 3OAUH 4LHQB 5F3BB 3TIEA 4GO6B 1WAAA 2K1MA 4Z0XA 3HZKB 3MR9A 4ZO9A 1HILA 3ARFC 4J3WA 1QYGH 1DEDA 5GS0D 1MJJB 3S88H 5F7FA 1S7XB 8CGTA 4OZ4A 5LGJA 2LTQC 3LMJL 2ADGB 3UMTA 1M4KA 3JWNC 5C0JB 1NGYB 4HWEH 1OARL 5FO9A 3QIUC 2A6IB 3E6FA 1KIRB 3OR7B 1W8OA 1R3IL 1UXWB 4TUJB 4ZD3H 3O9WA 4ELMF 3PWLA 2P42B 3QPXH 3NABH 1AD9B 4PRHB 5IHLB 1OY3B 2X70A 5F71A 1PZ5A 3MLXH 2FGWL 2VLME 4E0RB 4JHAH 3L3IB 3HI6H 1DN0A 3ARPA 4GXVL 5CILH 5IKCB 3LSOB 4F9PC 2FHCA 1P4IL 4U3CA 3IDXL 1QFWH 1J8KA 5KOMC 3KLHC 2IJ0C 5E08L 4W70A 3MXVL 5DHXB 1TLKA 1VSCA 1I9JL 3SE4C 3P0YL 4UMGA 4LCCA 3ZDXE 4POYA 1K8IA 3BN9C 3VMOA 3VWKA 4G8IA 3RAJH 1PSKH 1K5NA 1S7UB 3C2SA 3NPZB 4P2OB 1MCRA 3M45A 2NW3A 4I9WE 5IOPB 2XN9B 2XPGA 5EA0H 2NY2C 1EXUA 4XTRC 4L3CA 3LEYL 3C60B 2X4NA 1D5BA 3WFCH 1F8TH 1K6QL 4OLXL 1LK2B 5E6IB 4HDIA 1T0MB 2NY6D 3QWRA 4PTUA 5TF0A 1CT8A 4JFDA 4J8RA 1LO4H 2NY5L 2R9HC 4MZ2A 2GEEA 4RISL 4F7PA 5MP6L 3C5JB 1OTUD 4YFLI 4RGNC 2AV7A 1G9EA 4KMTH 1LEGB 5DTFB 4L8SA 1K9TA 1Q72L 4F2MB 5FA4B 4QGYA 4R0LA 4JQIH 2P5EB 2I24N 4IJ3C 5FK9B 5E2TH 4O51B 4XP1L 2BY2A 4LVHB 5T1MB 1G7IB 1PDKA 3WEXA 5F9OH 2D7NA 3MNVA 2IG2H 3FKUS 4M93B 3K80A 3KPPB 1FNEA 2FECI 5SWZA 2BVQB 3BEVB 4BH8A 2IQAA 3QNYB 1ZT4A 3IKCA 4P3DB 1UB5A 5EU5B 4PG2C 4PLOB 2H6PA 4MJ5B 4PJFB 5L0QC 4KGLA 4GAGL 4OIAA 4KJWC 5F9JA 5J11C 2BNRA 3UDWA 4QY8A 2VQ1A 2DYPD 4K94H 5FOJA 5EO1B 5FDYA 2DM2A 4TSCL 1X7QA 2NY4C 1KC5H 2NY3B 5D6DC 5IHBA 1MNUL 4PV8B 5JLZA 2Y5TB 4NQTA 2AGJL 2XA8H 2OK0L 1T89A 1ZGLB 4YAQB 3ZT5A 1B0RA 4WHYH 2MMXA 2PXYB 1KNOB 5E8EB 4ZUWA 3OGCA 5KW9L 2C1PA 1BIIA 1BLNB 2UZIH 1IKFL 2PO6B 1WAAF 4ZOCA 4R7DB 1XIWA 4ISVB 3W9EA 1KYOJ 2VLKD 4LSTL 4HS8H 5T3ZH 5HTSA 2GT9B 3A67H 4WFEE 1JWUA 2C3WA 4KMLB 1FLRH 5JXEC 4MCZA 1YEFH 3AM8A 3IDNA 2VDQH 1IEBA 1I9IL 5FM5M 1X5LA 4Y1AA 1T5XA 4YIQB 1U8KB 1M7XA 1RJZB 5T3ZE 4HH9B 1KCVL 4LF3A 4DEPB 4EZMA 1SQ2N 4IMLA 1MJ7H 2NNAB 4MXQC 4R9HA 3HPJB 1AY1H 2DIBA 5HYSG 3LQAC 3FRPG 4Z7UE 4HUVA 4JY4A 4HZLB 1S7RB 3U0PA 4S1RH 1JYWA 5DQDL 4IHOB 1L6ZA 1B2WL 1F6AA 4KC3B 5L9DL 1FRGL 2A2QT 2YEZB 3U0WL 5ESAB 1Z3GH 4Y4KB 4MS8D 4YO0B 5GSRB 5JMRA 2K3TA 2EYSB 1ROWA 3ARGC 3KPQA 1GZPB 3T3MF 3ZDYE 4B7IA 4X6CB 1SY6A 5D7KE 4P2RB 5DRZB 1IAIH 5CJ8A 4X8XA 3GUTB 5IIEA 4U1KA 2R8SL 2CK0L 5J1AA 1J86A 3MREB 5H37G 3ZKMD 5ETUA 1J88A 3FO1A 2ZOLA 1H5BB 3OKEA 3QWRD 5FF6B 3BDYL 4UV4H 5D72H 4X9IA 1V3MA 4NWUH 1WIUA 2DLIA 3IJYB 2J88L 3DYPA 5HHPB 2QSTA 1A7QL 2NXYC 4D8PA 4PUBH 1T4KA 5I71B 5ANME 1JGEA 4FQ1L 4WNQB 3B9AA 4J3VA 3MJ7A 5ESQA 4HIXL 4YPJA 3QDMA 2VZ1A 1CFTA 3DWTA 3O8XD 3UBXA 1F4YL 2ADJB 3ZKQD 1JRHH 2B20A 2A9ML 3RWHB 3F7VA 1AQKH 1OP3H 2MHAA 4QCIB 1FNEB 4Q0XL 1W72A 5AWNH 4KHTL 3KPLA 3VXNB 2P24B 3UCRA 4G8EB 4JFEE 5I1HL 3DBXA 4XP6L 4G6KH 4Y16A 2RHEA 3D69B 5DEFB 3FO0L 1L0QA 3GBNH 3SDDD 4HKXB 5ECJE 1YN7A 4M9OA 3ZHKA 3EOBB 4WWKB 3BZDA 1VPOH 2QQLH 3LB6D 5I15L 3BFOA 2VLLA 5FYJD 1TTUA 4MXVF 3VH8G 4I48B 5GGVY 2RIKA 5FHBL 1QO3A 1MCBA 5I8CB 1F4AA 1WT5A 4M02A 4F57L 3O6KL 2Q6WA 1RUML 4BQ8A 4OF0A 3TWCH 4Z78A 3ULUH 1MCLA 1HDMB 3SN6N 2XQBL 3GMQA 3R4DA 2CMRL 1URLA 2UWEF 3STLB 4KROC 1WV7T 4KMQA 1KPUB 1OCWL 3ISWA 4YHIB 1TJHH 3VFGL 4GMSL 1F2QA 5B8CA 2HAZA 3BO8A 1I75A 1W0YT 3PGDB 4OLZH 5FHBH 1JZ5A 1GOGA 3STLA 2C3GA 4AIOA 1UZ6E 2X09A 3MODL 4QHUA 4YWGL 1KBGH 1U8LA 1WBZB 1I7TB 4EDWL 5F21B 2PR4H 1MFAH 3S35L 1EBPA 3CC5B 2XQYK 3GMNA 1D3CA 2B5IB 5C0IB 5JQ6H 3FFDB 1U3ZA 1WEJL 1MOEA 5DFWH 2HJLB 3QXAA 1KELH 1FFOB 3FFCE 3ZE0E 3GUTA 4JR9L 5EU6A 5LGHL 4ZPVB 1CU4L 3KYMA 1A9BA 5GS0L 1UM6H 3RHWK 2NTFB 2Z4QA 4FFYH 5E8DL 2BNUB 4OLEA 4CGTA 3AXLA 3QQ4B 1N7ML 3HZVB 3CSPA 4WI7A 5JR1L 5IFAL 5D4QA 1UACH 1KJ2L 2XA3A 2XKUA 4FZ8L 4LFHG 1BZ9A 1UACL 1JBJA 5KAQG 1CE1H 2WUCH 4I3RL 3MLZH 1R3HB 4W4NA 4WTWA 1YECL 1FV1B 5DRXA 2WLYA 4LSUL 3ARGB 3JUYA 3LEXA 1CWVA 4Y0GA 4EKXA 4PD4K 3QDAA 5EU4A 3TZVB 3OWEA 2H8PA 4L8DA 3LKRB 3MJ9L 4EUPG 1KLFA 3DYMA 4DGVH 5E9DE 4HH9A 2EKSB 1JHKH 5MEND 3SGKA 3WSQL 3QO1B 1SJXA 3P40A 4U1IB 3H9SA 4OD2B 1Q9KB 5C0RH 5ID1A 1FNLA 5GRUH 1QBAA 1UADC 3BYTA 1FVCB 3MRLA 4KZDL 4OZFB 3MXWH 4ISVA 1NLDL 4N8VG 5KSVB 3OXRA 3SO3C 1YPZA 1A1OA 1DVFA 4GBXD 4KDTA 1SY6H 5IV2A 3OKNA 5EUOA 4P5TD 4U2ZA 2PO6A 2IQ9L 2FR4A 4L4JA 1OTTC 5JXAL 1UWEH 3SKJL 2YXFA 3BZEB 4GMSH 3X12A 1M7IB 3MX0A 4NJ9H 1ZVSA 2VDKH 2HJKB 1HIML 3EO0B 4ZO7A 1RK0B 3G6JE 4WCYH 4QO1A 2YWYA 3I3EA 5JA8B 2BNRD 3L3OA 3QFJE 1NDMA 1LEKA 3H42H 5JUEH 5KJRH 4JJ5A 4Z77A 4ZSOB 4F7EB 1KT2A 3LH2L 1XGPA 3FJTA 1KLUB 3LCYA 1B88A 2VDQL 4U4BA 4KZEL 5D9SA 1FFRA 1PW3A 4DVRL 3EJZD 2KUTA 4ZUVA 3KPOB 4JREB 5F6IC 5ACLA 2IPTH 2BHZA 5F89B 1XR9B 3RRQA 2R2BA 2V7HA 3KWWA 3MC0A 4BZ2H 5EN2B 3HKFA 5F7EL 3OKMA 4GG8B 1UEMA 4OLVL 4H26A 5C9JA 1RURL 3HC4L 3OKLB 4RMSA 3RDTC 2HJFB 3RI5F 5BV7B 1J0HA 5I30L 5E2JA 4U1HA 2VQ1B 3ZSTA 5L88L 4NO0B 1UXSA 2FO4A 1CGXA 2QQNH 5E1HB 1OQXA 4MB4A 2Y6SC 4PJDF 4HPYL 1IGML 3BKCH 5DVLA 2FYYB 1NAKL 1BD2E 1PVHA 3LQZA 4RWHA 1RZKC 4OCSH 4OAWB 4WJ5B 4X6DB 3EHBD 1C16B 1NGYA 2QL1A 5HGHA 3NIGE 4OZFG 5HHXL 3ULVH 2R2CA 1G7IA 2PW1A 2CMRH 4OF6A 1IGIL 4XCFL 4ALAL 3DHMA 2P7TB 4G8FA 4NQDA 2DTMH 1KIQA 2DM3A 4OF3A 1YEHL 1BEYH 5AZ2H 3MRJA 4RGNB 3MRCB 4OM1L 5DT1H 4AIZB 1LQSR 1OL0A 1FH5H 2CXKA 4L4VE 4Q7DA 4HCRH 2VIRB 3I02B 1OB1A 2OJEA 3L3HB 4P5KB 4Y2DD 5E9DD 2Z0BA 4FABL 2HRPH 4HQQL 2I25N 3L1OH 1HHGA 1UQSB 2FH8A 3GBNL 4EDXB 4YBQD 2HFEA 1U8JA 1A1MB 1NFDA 1A7NH 2F54A 3TO4B 2GAZB 5C07D 1AE6H 5I6XC 3S7GA 5DR5L 2FLBT 2NY1C 1YNTB 1CFVH 4HEME 3N1FC 2DM7A 4FQLH 4PGEB 1MY7A 2HTLC 4LHUB 2IH1B 2A77H 1VGKA 3VG0L 5CJXA 3O45B 1L7TL 1I8KB 4E41B 3KJ6H 1P4IH 5C09E 5E4IA 1ONQA 5MEPA 1PY4A 1RZ8B 4Q9RH 4KU1A 4Z7WB 2UVFA 4BKLB 4ZFGH 1KEMH 3OJVC 4C4KO 3UBXI 5F7EH 2ZOKB 1ACZA 2CRIA 1P2CB 2B0SH 3G5XB 3Q6FA 1ZHBA 3PHSA 4PRBB 1EJOL 5DZLA 3NABL 3BXNB 3ES6B 4MDJA 3BDYH 1S9XA 2CUMA 1QP1A 1YQVH 3OZ9H 1CDGA 2OBGA 4LL9A 5CEZL 1AGDA 3WL9A 4GSDL 2UUDH 5M95B 4RX4A 2X4QA 4ZUVB 2CRZA 3AXLB 3LKQB 5HDQH 3VGBA 1P84J 1JTTA 4RAUB 3T1FB 1WUNT 3GSXA 1GGIL 3SY0A 4GMTL 3B6SB 4YDIL 2JJTC 1JPFA 3LVEA 2C1OA 2CIKA 3WS3B 3T0EA 1Y6KR 2YC1B 1QRNE 4CL7A 5DHVH 5ALCH 4A6YB 4U7MA 5EH1A 3O81A 5I74B 4YDJA 1DUYB 3CDYA 2OK0H 5E00B 1FRGH 2X41A 4Y1AE 3U4EA 4YHNA 5I1LA 1PG7W 1CL7I 3CC5A 3BN9D 4HV8B 4JCLA 3BPCB 5FCUL 1ITCA 5I1EL 2X1XR 1HQRA 3B9EA 3OKKA 1G9NH 3BDXA 5HGBA 1DFBH 1U8LB 2E9WA 2E8ZA 1OT1A 3NCYP 3NOIA 1MCQA 2H32H 4IOIB 1T7YA 4BYHA 5I76A 4G6FB 3MV9D 4N8CH 1QYGL 5E70A 4WHYG 3G5ZB 1FGVH 4JRXA 2NY6C 5CBEA 3AROA 1CBVL 3W9DB 1YEGH 4OV6F 3VRIB 1DQQB 2IGFL 4MHHG 5JXEA 5IVOA 3AS3A 2Z4QB 3O6FC 3LKRA 4MQSB 3P4NA 1IGTA 3H7LA 3X12B 1K3ZA 2MOVA 3B2VH 4K23L 4F37F 5DFTA 4M6ML 3D0LA 2VNCA 3UTSA 5CD5D 5T3XE 1E28A 4ODHL 4H88H 2ZSWA 1CFSA 4OGXL 3AMKA 4Y5VC 5L9DH 3RKPA 1UZ6F 3VXUD 1JGUL 3QZWG 3MNWA 3VFTA 4NYLA 5IK3A 1FPTL 1S5IH 3OPZL 1WAAE 1FE8H 1ZA6B 3BW9B 4L8DB 1RMFH 2ZJSH 3N9GL 3BJLA 2PYFA 4HJJH 2XIDA 4K94L 2GK0A 1WLHA 3SDXB 43C9A 3E3QC 3O6LH 4P59H 1CD1B 1D5MB 3WUWA 1C5DB 1NEZA 3PWPB 1I8MB 2CRMA 2JE8A 3F6IA 4NQVA 1NGPL 2FR4B 2EXWD 4B7LA 1L9MA 4G7VH 4WEBL 2PKDA 4X6FA 4XP9L 4MX7A 2Z31A 5KSVA 1U8IB 4OQTA 1I9EA 4Y19B 1AXTL 4O4YH 1OM3L 4AENA 3T0AA 1A0QH 1A6VL 3CFKB 3HZMB 4PJIE 4ZOEA 4K3JL 3DNKA 5FYKD 4PJ8D 2LU3A 1XF3A 4GG6B 3GHBL 4WUUD 2Q76A 5IEHA 1AQDB 1QEWB 4MMXC 3EFFB 1Y0LA 5F3HA 1MFDL 4XPHL 1G1YA 1WTLA 4YJZL 3DPBA 1ZA3B 3EOTH 3LPFA 4O5LL 4BQ6A 1QACA 3CLFH 3VXUE 5EBWA 3ULUL 2OJZH 3S36L 2N4IA 4RRPA 3IS0X 4ZD3L 2W1NA 1IAMA 4PJHB 1ETZA 3SDYL 4Y4FD 4B50A 5T3ZD 3TPUA 4Q2ZA 3QNYA 3ARZA 1P1ZA 2PCPA 4MVBD 1I1YA 1YEDB 4ODXA 5JHDE 3L6FA 2BY0A 4WW1B 2XWTA 3QDGE 3TCLB 25C8L 4K8RD 2W65B 3BPNB 1NCWL 1ZMYA 1IT9L 1AD0A 3BQUD 5FEBA 3PWUB 4JFDE 2GJJA 3BP6B 1OLZA 1CL7L 4X6EB 1LE9A 1QQDB 1JVKA 1UZ8A 2XWJA 3R1GH 4FZEH 1VADB 5IB4A 1A6WH 1GIGH 1LO3L 1HEZB 1EHAA 2OZ4L 5KVGH 4G9DA 1SYSB 4MVBC 4ZFGL 3D39A 3X11B 4KJYB 1QO3B 1V3KA 2VR5A 3TCXA 3KGRA 3Q5YA 4HUUB 1VFUA 2DKSA 2CDFB 4NNYB 3C09C 4YHZL 4FNLL 3MV7B 1IGMH 3BKCL 1TPXC 4RFOH 4XPAL 1A6VH 4O2CA 5BJTB 3I84A 3U0TB 2DQCH 4PY7A 4F9LA 5C0EB 4NCDA 3JWOH 5FA3A 4C4KT 1OM3H 1JNNL 1CVSC 1RJZA 5KVFL 4GLRI 5TDOA 3KS0J 1CIUA 3T3ME 3ZDYF 4O2EB 2DTSA 3NCBB 5F9DC 5GZNC 1RUPL 2DLEA 4YK4C 3Q6GH 2VLKA 3VRJA 4UDTA 2I27N 4YE4L 1TITA 3OBAA 4L9LB 2QQKL 1YNKH 1CICC 5B21A 3QQ3A 5DMIL 3HNVL 2HKHL 1IM3A 2JELL 4N90D 3SGDH 5E8OB 1B2WH 1ZHNB 2ZKHL 3QEQE 2R69H 4PR5B 1AXSA 1A2YB 3LKSA 5B39G 2ITDB 3QEGL 2F8OA 5ESAA 3FTGA 3VRLE 3WD5L 4N0UE 3UTTA 1M6OB 3Q3GB 3SDXA 5FB8A 1DBJL 3VXSB 3EFDL 2BMKB 1PFCA 3UJJH 3CXHJ 3GB7A 1KGCE 5EU7C 2ID5A 3MOQA 4WW2A 3CSBA 4XNYL 3NFPA 2BVOB 5JXAH 2NX5E 5E94B 1JV5A 4RQQB 3BESR 5I8EA 4FXGA 3U7YL 5IB1B 1DUYA 5C07E 2V9QA 5A43C 1JTPA 2H3NB 5DJXB 4MQXC 2NPLX 4OD3L 2IANB 4U1JA 5D2LE 5BVPH 3BAEH 3HE6D 1J12A 2ICWI 1H0DA 4JFYB 2DQIL 4H0IA 4BFIA 3PF2A 4I1NB 3EYQD 3SGKC 4KAQH 1BP3B 1S7TB 1WGOA 2AXFB 3TJHC 4N68A 4OLYL 3KYOA 2ZUQB 3FZUC 5LGKA 4DVRH 2FRGP 1HINH 1MFEH 2XA8L 2OYPA 5DD1L 2C1PB 1J0YA 4Q6IB 1XIWD 5C09B 3SDAC 3ARDA 4KDTC 3T2OA 5E99L 4Q2ZB 1KG0B 2GK0B 2DQEL 2VDNL 2OXHA 3I6KB 1FDLH 1RZ8A 5D7IA 4P46B 3QPQC 1H15B 3K8LA 3AS0A 4FXKA 1MFCH 1NCUA 1KB5A 4PRDB 3EOYG 4NQXA 5DJYA 4LLDB 3G5ZA 5F8RC 3TV3H 3MRPA 4GRWB 4NN7C 5HVWA 3F7YB 3O6KH 1MWAB 4QHKI 3MUGB 5FOBA 3WIHA 2XPGB 3MLRH 3P9MA 1A6ZA 4QWWD 3D87B 2F54B 4J7RA 1PYWB 1CK0L 4NBXB 2VZUA 1U8NB 4X7SH 2EIZA 1EEQA 4Z7OF 4NYLB 1DQDL 1V05A 1ES0A 5FYLE 4NZTL 3BGMB 4P3CL 4LHUA 4MQ7B 4U6XA 1OWWA 1RY7B 4AYFA 12E8L 5KSBF 1WFOA 2HH0L 1YN6B 1L7TH 2XN9A 2VDPH 5C8JA 5C0CB 3BI9X 1C8PA 1NCTA 2ZOKA 3QIUA 2EDJA 35C8L 4NQED 5T33L 1JJUA 3V2AR 1FGNL 2Y23A 5KS9A 4LNRB 5C08A 1S9WB 2CGRH 2XI9A 3QI9C 2P5EA 1NQBA 1IZJA 1U93A 3ULSA 5LWYL 1Z5LB 3ILPB 1C5CH 1QNZH 1LEGA 5JNYA 2Y9RT 3TO4C 4Z76B 2X10A 1UM6L 3UTZA 4ELMB 1KJ2B 5ERWA 5FK9A 1F97A 3THMH 1VFBB 3UTSE 3U7AA 2PW1B 4XMPH 5DJDB 5EZJA 3UEZA 4QYOB 1WFUA 2HLAA 4GQ9H 4NT6B 1WEJH 3F62A 4NRXB 1RU9L 3IDXH 4M7KL 1WICA 1NCAH 3IDGB 4PYGA 4NC1C 4KTDL 4C56A 3VXSE 2DLFL 4PJ8A 4ZFZB 2BVYA 3PV6A 2ILLA 4D9LL 1HYSD 3ARED 5ID0B 3GJFH 4LGRB 2DJUA 3KJ6L 3JWOL 2NW3B 3RUGB 5E9DA 4MD5B 4RFOL 3MSPA 2BOCA 4MA7H 4YXHL 4XPBH 3C60A 1BQUA 5I8KL 1F4YH 3I50H 2X6MA 4TTDD 4I2XA 5HSFA 2YPLD 4PRPE 1LO5B 1U6AH 2V7NB 5E8NB 3QEQD 5JPMA 4HHAB 2ZSVA 4YE4H 1KCVH 1A5FL 3TIDA 3DI2B 4N0FB 1BVLB 4FABH 5BV7C 5EUKA 1S78D 1JNNH 4BKLA 5TE7H 3KYKL 4EEEA 1FNAA 2JJUA 1VESA 2F53E 3M8OL 4GBXC 1NC2A 1HSBA 3V6FB 4G8GE 3OKYA 4DAGH 4RMUA 5JW4R 5LWYH 3HNSL 4NN5C 1PY9A 2IAMB 2CGRL 5DJYB 5K59F 3EYFB 4ZSOA 4F7EA 4C54A 4P46C 1YMHA 5T5FH 3Q48A 3RWDA 1T1WA 3V52H 1FL5A 1F4XH 2WINB 2J8UF 1CFNA 3QG6B 2P8PA 2A73A 3DVIA 4TSCH 4RBPH 1OP9A 5DR5H 3RL2A 1FO0A 4PJCE 4WI6A 5I18L 5LXGH 4P5MA 4OI8A 5GHWH 4S2SB 4UQ3A 1EVTC 5C6TL 4V1DB 1UXSB 2E9BA 2YMXH 2IALA 4OD3H 1TETH 4LNVA 3KS0H 3IKKA 2QJDA 3H0TA 1TETL 2YD4A 5F1IB 1MCDA 4XXDB 4BSWB 5IT2H 1QSZA 3D48R 1D6VL 4JO1H 1YNLL 3G9VA 3BWAA 4GS7C 4Q6YA 5C1MB 1NGPH 3MLWL 1KTDA 4PJEB 4BFIB 2VXSL 4ELKA 5L2KA 5GQBA 2GCYA 5E6YA 4PRDA 4LSRH 2Y07H 3EHBC 5K9KB 3CVIL 2H32B 2BVOA 1JZ8A 4ODUB 1DBBH 1ED3A 4DVBB 3BSZH 4NNXA 4G6AC 3K74B 4U6TA 3R06B 1UC6A 1XCTA 1TZHB 5ADOH 4NDMB 2BDNL 1AGEB 1CGTA 1GC1C 3L7FB 3FOMB 2PW2B 4HX1B 1YNKL 3HUJF 3O4LA 2FCBA 4WO4A 4NHCL 3SPVA 1WISA 4LLVB 4MJIE 4X4MA 1N4XH 3UAJD 1HHHB 1K8DB 3ZE2E 3I6KA 1DQJA 4KK8D 3ARTA 4UIKL 1MCWM 2WANA 1REIA 4FXKB 3DGCR 3WLWD 2AJVL 3OMZA 1IC5L 5D1ZB 1MFNA 5HBBA 1CICD 1JTOA 1KPVA 2AEWA 2FDBP 4HIIB 2FEEI 4LCUB 4JGUA 5HVFB 2UZYB 4K7PX 2VZOA 4J12A 4XNYH 32C2B 2OL3B 1IQDB 1KN2H 5F1KC 3P9MB 4XI5C 5C0AB 4JM4H 4H5SB 1MF2L 3VFRB 2PYEB 5CEXA 1O7VA 1UWEL 1BF2A 4YC2B 5FYJU 5EOTA 4LU5H 1LO3H 2ATKB 2R1YA 5AG8A 3MCLH 3U79A 4Z78B 5IB1A 4XCYB 1ZVSB 3TVMC 3CFIC 4ODSH 2LU7A 1NAMH 3KLAA 3NCEB 4JFOA 4TN9A 4ZODA 4GAJL 2W0FB 4JZJB 2JB5H 1FVEB 4GAFB 1OAQH 1B0GB 5CSZB 3RVXD 3LKNA 2FL5B 1XEDA 4LGPB 1TDQA 3NZ8A 2YSSB 5L2JA 5J89A 5CD5C 4PJHA 2KH2B 3MJ8B 4R97B 2YK1L 2YRLA 2VLRB 5F7DB 4Y16C 4PR5A 1HXMA 4WVRA 5DJ2A 3DVNB 4WWKC 1UWXK 3DUUA 4Z76A 4BFBD 1T20A 1FH5L 3FQWB 3MV9E 4HK3J 1HEZA 1XGTA 3L6FB 4RAVA 3IDJA 4BZ1L 3ULSB 4FG6C 2WM0A 5FUOH 2IBGA 4QNPF 4FQJL 1IM9D 1XFPA 3TJEH 2OJZL 2NTSP 4P2QB 3EDDA 2E9JA 2O26U 1NDGA 1R6VA 4LKCA 4MXWH 4YNYA 5H2BA 2GJ6A 1SJEB 5ESVA 2HFFA 1FG2A 1X5FA 3GHBH 1A7PL 2EDWA 4ZO6A 2ADJA 4UAOC 4O2FA 3T0VA 5AG9A 3QWOB 4XMPL 3BD5A 5F1NA 3QUXA 2APBA 5IW3A 3N85L 1JPGB 1KELL 2GTWB 3ARBD 3TBWB 1WC7B 1J0JA 1CQKA 5H94B 3UTPD 1JI2A 3C5SA 4JN2A 3I3BA 1J1PL 5H35A 3C8DA 5C0DB 3K8KA 4FFVC 1G7QB 5AAWA 3LOWA 2HRPL 4QWWC 3V5DB 1U95A 3K8MA 1ZLVK 2FEDD 2DQFA 2FEEL 1CVRA 4TULH 5D2LA 1AFVH 2QSVA 3LRGA 1IM9B 1GGTA 3VFWB 2BVPB 3ZYZA 4L9LA 1XF4A 1YEEH 1HHKB 1HCFX 3MBXH 4NFCA 2YXMA 3QUYB 4JFEB 2DMKA 3T09A 4FFVD 1MF2H 4OGXH 5TDPB 5JOEA 3RTQC 1UA6H 1KEGL 1NSNL 1JNHA 5I2IA 3K2MC 5EULV 3W2DL 1A7QH 1JK8B 3NIDF 3EO9H 5D71L 2JIXB 4HMCA 2XN9D 1T1ZB 5SWQA 4J1UB 4NSKB 3BH8A 4EJ1C 5JOFB 4BZ1H 3D6GA 2FX8L 1YEFL 3QJFA 4PJXA 4MD4B 3K1KC 4XP9H 5CFHA 2ZSWB 1FVEA 4YH6A 3GO1L 3NAAH 5GJSH 4OZFH 2AJ3A 4ZAKA 3GMOB 5C6TH 1RZJL 4OB5L 5CHNB 1ORQB 4ZNEE 5EOTB 1ED3B 5EZOH 4GKNB 3O3UN 4RBPK 1AIFA 1WIPA 5ADOL 1QHOA 1S5HA 5JW3L 4IIQC 4DFHA 4UDUB 3ALPA 4WUKL 5E0QA 1UH3A 4H1LH 3HA0A 4PBVC 2E8YA 3BDBA 1PEWA 2PW2A 1FN4B 2Z91B 1INEH 4LLWA 3IVKA 2WP3O 3MV01 4ODHH 4U0QB 4IOIA 3MREA 2ZUUA 1N8ZB 3VFNA 2VOTA 1AR1C 1MLCA 3IFPB 2DN7A 3FFCB 1HXMB 1T22A 3H9SD 2B2XL 5DUMH 2OCFD 1BVLA 3BAEL 1LNUB 3EYVB 4PJEF 1CK0H 1TMCB 3GMMA 5TE4L 1AGBB 1MIMH 3T0EE 1SBSL 2APXA 1E27A 5AD0A 4GG6E 1QBML 4AY0A 3OB0K 3QIUD 1A21A 1ZA3A 1SBSH 3FRUA 4ZSOE 3U9UB 2XG5A 5KVEH 4ZFFB 4JM2A 4M5ZL 1TCMA 4NHCH 1MCNA 1MLBB 2EC9U 2R29H 1N64L 2NXZD 5CJOL 4QRUA 5HPOA 2P8LB 5DZNA 5GZOD 3HI5L 4XVTL 4X80H 1NJ9A 3FB5B 2OSLB 2CDFA 1CLYL 1BVKB 1FE8L 1G6RL 1O7SA 4YPGB 1IKNA 2MNUA 4QRPD 4GRMB 5EFIA 1MNUH 3QHFL 4V2BA 1I8MA 4I18B 3U7WL 1P4LB 5D8JH 3MRGB 3C6LA 2W38A 4UOW0 1U3HD 1FL6A 2Y1VA 5JDSA 1OGAB 2QQKH 2HRLA 4QRTB 4YLQT 4ODBD 1A6UH 4ZXBB 1FG9C 4LLVA 1RJLA 2NY6B 4R7DA 3L5XL 3L1OL 1Q9LA 5GGSB 3GJEA 2BK8A 3B3IA 1J11A 4P23B 5C2BH 5HGHB 4ONGH 4DGYL 2AS5M 4WV1C 1R3KA 4KK9D 3TT1L 3DMMA 1LEIB 2Y5EA 1KLGB 1WF5A 3S35X 5E4EC 3Q1SL 4MD5A 1Z0NA 3V4VH 3GEWB 3L5JA 2IFFL 3OKLA 4K7FB 4Y4HD 1DFBL 5FA4A 4HFUL 1X5ZA 3QCVH 4PJ8C 4XVJH 2WNGA 4BQCA 4NKDB 4JY5H 5SWZE 4FZEL 35C8H 4MJ5A 4PJFA 4NRZB 2E7LC 3OAYH 5DJ0B 3KPSB 4Z0BH 4YDLB 4F33A 3S36H 5SWZB 2EE3A 5AUMA 4PV9B 1AE6L 4I13B 4GXUM 1IMHC 1HHIA 2L7UA 1JF5A 4KJWD 3W0WD 3GGWB 3QDJB 2WBKA 4ELME 4UV4L 4WI2A 5D72L 1JGDB 4Z7WE 4QY8B 1Q0YH 1ORSA 2P44B 3IJHA 5GGQH 1IVLA 5FUCC 3LN4A 4MJID 5MEPB 3BRDA 4YHMH 3LN5A 5C2UB 3D3VB 4MNGA 4GRLB 2YPLB 4OZGB 1C12B 5IBUG 3L3JA 3GGWA 5EO9A 3BKML 3UC0L 3RBGA 4WFFD 4ZPTB 4YHZH 1VGEL 5DHYB 3VWKB 3DO7A 1D9KC 1AGFB 3BWUC 3NZHL 4FMKA 4XVUD 3KPRD 1YMHB 4JM4L 1MFCL 4HPOH 3ORJA 3HI6L 5SWSD 5I1HH 5IK3B 5A2JH 3BP5B 4PJGF 3QEHA 4CNIA 1CDHA 4YGVB 3VDCA 1UKTA 2HMIC 4RA0C 5F9AC 5DK2A 4LLQB 5D8JL 3BPOC 4YXHH 1Q9OB 2ZPKH 5DRWB 1N6QH 1QPPA 4DKFH 1YUHA 3CX5J 1F3JB 3IFOB 2W0PA 1IFHL 4U49A 2G60H 5DO2D 1OP5H 3O3BA 1P4LA 3LRHA 2DBJA 1K8IB 5I15H 4QRRD 3L3GB 3ZT6A 1ZLVH 3S6CA 5A2KH 1UB6A 2AQ2A 1SEBB 3SE3C 3HRPA 3STZB 5I19L 1KCSL 5FO8B 2DI9A 1NJ9B 3FB5A 4XVSL 3D39D 3TYGL 3GMRA 3LEVL 3O2VL 2ZUQC 3IU4L 5D7JD 5BOPA 2KPNA 3GJEB 2VRAA 3D39E 5DQ9B 4L3ED 1S5HB 5DYOB 3QDGD 3MLUL 3EKCA 1OAKH 1N26A 5I76B 1MUJA 4GAYB 4IOSD 3LS4H 3MRLB 5DO2C 4DTGL 2DS4A 1L0YA 2X2YA 3UTQB 3MBEB 5CBAB 3MJ6A 1VERA 1YJDC 3QBTB 1BQHG 3UZEA 2R15A 3CDGB 4EN3A 1KN2L 5IFJA 3G9AB 1TVBA 3GSQA 2YD5A 1TCRA 1C1EL 2EDHA 3WNMA 4XNZB 5KSAA 4UV7H 3B3IB 4RQQA 1I1FB 1VFAA 2JJSA 4MA8L 3SQOL 1AGBA 5JOPD 3F8UB 2DD8L 3B9KD 2GIYA 4LFHD 1XCQB 3PP4H 1CU4H 3KPRE 4OM0L 1TNMA 4CVUA 4RA3A 4EQ3A 2ICCA 1CBVH 5DURB 3MJGX 1P7KA 4CN4A 1NMAH 2HLFD 4YHPB 1V7NL 4G7VL 1N4XL 3HI5H 5FO9B 4B41A 3PIQA 1MCWW 3SDXE 3O6LL 3NPSB 1A9EA 2VLRD 4N0CD 4YPGA 3IVKB 2CDEA 1RIHL 8FABA 1EAJA 2HTLD 1ZHLB 4X0KA 3DIFB 3ZE0F 4PRPA 3FAXA 4H26B 5JHDA 4LSTH 4KFZC 4QXUL 3W0WB 5KZCB 3AVEA 4PJEE 1DBBL 1CXEA 3KPTA 4LLWB 3WNNA 1BJ8A 4JM2B 1LMKA 3H3BC 3MFFB 4JHBA 2VLLB 2EZ0C 4PRNA 3BE1L 4JFQA 1HCVA 2DYPA 3BIAX 3VXQA 4FZ8H 5BJTA 1DLFL 3MRQA 5AYUL 3HC0A 4CDGC 4OBRA 5B39B 3GSUA 3TWCL 1KULA 4XGZA 2FB4H 3M8OH 3WBDA 3QHZH 1H15A 1AP2A 1FZJA 2IC2A 4CVZA 1MWAL 2WWMC 3WE6B 2VLKB 5ILTL 3HE7A 3C8KB 1KLGA 3DV4B 2Y36L 4YBQC 4GRLC 1DP0A 3QUZC 3LEVH 5D1QC 1DSFH 2D7TL 1FBIH 1J0ZA 1AHWB 1ZHNA 3UTSD 2N7BA 5D1XA 2ATPB 3RTQD 3RUGE 3D85D 1B3JA 4HT1H 1XF4B 4CJ1A 1R24A 3EOAA 4EDWH 2RB8A 4P4RA 2E6JA 1Z9LA 2UV3A 1BVKA 3KVQA 3DX7A 1YC8A 4PJCA 5F7YC 4OFKA 3LS5H 4DN4H 4UDTB 1ZT1A 1DUZA 4R8WL 3VRLF 2HWZL 3CFEA 1FHGA 5C0IA 5AUMB 1FFNA 1M6OA 3NFPB 4KI1A 2UZXB 4GG6A 5CWSA 2DLHA 2HVJA 5FV1L 3ZYJA 1HDMA 3QUZD 2ZCKL 5D1QD 4PUBL 2IMMA 3CAFA 1NMCC 4X7FC 1OTSC 5I6XB 2M26A 1E4WL 3T77A 5ABDE 1T21A 1ZV5A 2DBLH 4HLZG 3UTTB 5EU6B 3GMLB 5J12B 2YOCA 1UVQA 3BO8B 3MZTA 3UC0H 1H0DB 3M17A 2G75B 4JFYA 2DWEB 4CMHC 2F53A 1GC1H 1GGYA 3D39B 3OB0H 1EFXD 1AXTH 1NCWH 1YQVL 2MHAB 1RIVH 4G8GA 5GS1A 5IVZA 5AZ2L 1F11A 4Q97A 2XRAH 4XMKH 2NX5A 3CVHA 3G5VA 4KDWA 1YZZA 2DWEA 2NYYC 1WWAX 2GSIB 5DRNB 2RCSH 5EOQH 5GGSY 3T0ED 1PD6A 3VWJA 3DGGB 2EDOA 4L1DA 2YD1A 1B4JL 1WCBA 1I9RL 1FFOA 1TIUA 5LCVH 4LLMA 2O93L 1M71A 4HPYH 5ACMA 4S1RL 5EZIL 5E6ZA 4LAQH 4XPFH 2EDXA 5GRJH 1P7QA 1PX3A 4RRPG 3F7PC 1I3VA 1MPAL 5T1LD 5ALBL 4D9RE 3MV8B 4PRAB 3FB8B 3B2VL 3VE0B 5I1KL 4MB3A 1A9EB 3TT1H 4L8SC 1I4FB 1DQJB 1BOGB 1A47A 3P2TA 2UYLA 4NKMA 3BH9A 4Z7UF 5M7QA 1YEIH 2CSPA 2BX5A 4LK4A 5D1ZA 4OGZA 4QF1B 5HJ3B 1C7TA 4I0CC 2GK2A 3SOBH 5IB2B 1HQ4B 5BW7C 1NCBL 4IRJB 5C0AA 3DTXB 4YHLH 1J8HB 1AJ7L 1PLGH 4L29B 5KZCD 2RAMA 4G80B 4TRPH 1F4HA 4FS0A 3P9WB 2NX5D 3U7WH 1R5IB 1MQKH 1FPTH 1S5IL 1T5WB 3OPZH 1NEZB 3FOLA 3LDBC 1R0AH 3EYQC 5DJ8B 3RU8H 3DV4A 1P7KB 1Y6MR 4GRLD 5FAAA 3SE9L 4LSRL 4MNQD 1NLBH 1TJIH 4TVPL 1CF8L 5JMOC 5BQ7B 4AENB 5HGDA 2CD0A 5DMYA 5BCAA 3RVXC 1VA9A 1LDPL 3D3VE 1DANT 2KZ1B 4RGMC 2ADGA 4GQ9L 3C08L 5GJSL 4ZYKB 5T1KD 1NBVH 1KTDB 2AV1A 2NY2D 4MB5A 1BWWA 4MAUH 5F3HB 3SDDC 1A0QL 2V2TA 5IVXB 3LIZL 5FXCH 4X6CA 1CG9A 4H1LB 4DQOH 1XGRA 5K9KA 1DANU 4JFDB 3T0DA 2B8OT 4XC3H 1UM5H 3WO4C 3WHXB 1CDYA 1T0PB 1HWHB 3GM0A 4JHWH 4NNXB 5BS0B 1BOYA 5HHOA 3WLBA 5EU5A 4RFEA 3HAEG 2ARJB 2HYMA 4Y19E 5B39A 3OHXA 3PDDA 3OF6D 4UOW1 4UTBL 5IJVA 2I5YL 1NC4B 4XPFL 4WUKH 5GRYA 3FHAA 4OKVA 4QHMA 4HIHA 1CN4A 1KC5L 2OTWA 4JQXA 2EE6A 4G6JH 2RQ8A 5D7JB 4JKMA 12E8H 1CFSB 3ULVD 5DJZA 4C56E 3MV7D 1WWCA 1BFVL 2J8HA 4P23D 5E6IC 3FN3A 5HVHC 1KNOA 5E8EA 4YHOH 4AEHL 4M61A 1XZ0B 4GAGH 4KRNA 4K23H 4R90L 5FYJE 5D7SL 3NN8A 5IW1A 1U95B 3GM8A 4H8WC 5I8OL 4MDJB 2O5XL 4APQC 5EU6D 3W82A 5J57B 4KDVA 3V6FA 3QT2A 4XBEL 5HHNA 5EC1A 4N5ED 3W5NA 1YEGL 1Q38A 2D7OA 2VE6B 4Y4FC 5E08H 1CT8B 5MENE 4XBGA 1VDGA 4RAUA 2XTJB 3EO9L 1ZSDA 3G6DL 3QHTC 4GXVH 4S10A 3Q5TA 1NCDH 5DRWA 3RWIA 4JFOB 5IEKB 3QXUA 1KJ2H 3IRZA 5I18H 1HH6B 3M1BB 1E28B 1PBYA 4LCCB 2W07A 4BA8A 1AKJB 1SM3H 1OPGH 4ZTOH 2W91A 4YHNB 5I1LB 4L4TA 1UB6B 1D7FA 1MREL 4XPTL 4ACPA 1TQBB 5IMKA 3N1MC 4UIMB 1R5WA 5IGXH 5FYKE 4KWUA 5DQ9A 1IJ9A 1WBYB 3RWJA 4DOHB 3H0TB 4NBZB 4NQSB 1RZFL 2YKLH 1CD0A 4IDJH 4OZIB 1F3RB 4OZ4B 3S37X 3QUKB 3NCJH 5ENWB 4YEEA 3WUZA 4F7PB 2BOBA 4X9HA 2R9HD 3WDIA 4Z0BL 5I9QC 2Z8SA 1GHFH 3MODH 4IRZH 3LD8B 4CMMA 3HNTH 4S1DC 5L2KB 2P8MB 4QNPE 2Q7NA 2K7QA 2X4QB 1A7PH 1Q72H 4I18C 3BWAB 3B43A 3CH8A 5E2VL 3QCVL 4JHAL 5HHXH 3ULVL 1BREA 1WSST 5IBTL 2VWEC 4NJ9L 4I3SH 3EJJX 2BY1A 3QUMB 1OF2A 3PABA 4YC2C 3MBXL 1NC4A 4PJXE 4LLUB 3MLVL 2CDGB 4FQ2H 3GZKA 1HILB 1FNGA 2OQJA 1UH2A 1F5WA 6FABL 1GGUA 3HG1B 3P4OA 4CNIB 5ISZB 2APFA 1IT9H 4P5KA 1I8KA 2A74A 4E41A 3WFDL 2ZUWA 3WLBB 1ZVYA 2AKRA 3B5TA 3U46A 3O6ML 4IS6A 4EDXA 2E7BA 4I0PC 5IV2B 3BMWA 3G5XA 1F90L 1NMAL 3BRFA 3QFDA 1PZ5B 1UCTA 5D7IB 4XZUA 3MXVH 3VFNB 1AQKL 1RZKL 5B3JF 2J8OA 5D7IE 4LU5L 1B0RB 1EO8L 4XNUL 1CLYH 1C1EH 5GXBB 5E1AB 1IKFH 3WO4B 3BUYB 4ETQB 3CVHH 1MJ7L 3BE1H 2FZ3A 4WDIB 3EJYC 2CKBH 4W6YB 1FYTD 2WSKA 3V5KB 4DUXA 3PDOA 4QT5B 5IG7A 3VD4A 5A2LH 1FDLL 3JZ7A 3RPIB 1QD0A 3ZZ1A 3MLWH 2HT4D 4HKZB 1AKJA 4FP8H 4OTXL 1U8NA 5CEZE 2I9TB 4LBEA 4G3YH 2FZ3B 1D5ZB 3RGVC 1I9IH 1FQ9C 1Z9MA 2NY7H 1I3UA 5D5ME 2RFXB 4L29A 5E94A 2OSLA 1CDIA 4Y5XB 4CVWA 3IDYB 3RUGF 2NCMA 4DZBA 4Y2DC 2FSEA 3FONA 3QDMD 4GRMA 1U58A 1X5GA 4E9LA 5D93B 3I9GH 2R2HA 3E8UL 4K55A 5CEZD 3UROR 3DX8B 3SKNB 1IC1A 3JVGC 2NY7L 5E8OA 3TM6A 3MUHL 3MRBA 5I1EH 4DFIA 4Q9CA 3DLQR 1T1YA 2VN4A 1A2YA 3LKSB 3MNZA 4QXTA 1KB9K 1JGUH 2VLJE 1OGTB 3VXMD 2HKFH 1T3FB 4WUUB 1TJHL 3VFGH 2YD2A 1X44A 1AJ7H 3B8YA 2F9BT 1J5OL 1F00I 1BGXL 4N1EA 3QUMA 5CP7B 2MJWA 4CU7A 4ZYKA 1P5VA 1U3HA 5C0AE 3JWOC 2C3VB 4KROB 4L4VA 1R3LB 3ILPA 4XAKE 5DD1H 3C6SB 2AI0L 1AR1D 3GMPB 4NQCB 2H41A 3HE7C 5D7LD 2BCKA 4IRSA 5A16B 2J4WL 4OSUH 3AS2A 2EO9A 1J8HE 1MLBA 3MCG1 3O11B 4MJ6B 1WFNA 3QO1A 5EA0L 2MSPA 1EZVY 4QTIL 4WFED 2Z35A 3TO4D 4JY6A 4YDKL 4P59L 5FA3B 1R3HA 1KF9B 2AJYH 2EO1A 3S37L 3GKWH 3P0YH 2J5LC 5HGAA 5C0DA 3KAAA 1RFDL 1N6UA 2VB5A 1QQDA 4UIMA 1JHTB 3QUYA 4JFEA 4LP4A 1YJDH 2BJMH 4OLXH 2Q6WB 1AI1H 2R1WB 4R4BA 2XWBA 4X6CE 3H6JA 3BHBB 3MACH 4JRYD 4EQ2A 5FYJL 4AG4H 1YYML 4G6AD 4M62L 4LEOB 3MPCA 1E4KA 4UAOB 5TGBA 3S5LB 1DBJH 3MRDA 1P9MA 3PG2A 3CFEB 3MRIB 3U4BH 3J8F7 4F57H 3S9DB 1F11B 3TO2B 4JVPA 2ZKHH 1FAKT 4GQPH 4XP4H 3RWEA 3KYKH 2WBJC 3LKPB 3U0TA 5TJWK 3RVUC 4LRNH 5JW5B 3DI3B 5INCA 5B4MC 5GGTL 1P53A 1A1NA 4PGCA 5FB8B 1L0XA 4HIEB 3GMOA 3NGBC 1QA9A 4F7TB 4XCFH 3CMOL 1T5WA 4Z6AT 3V8CA 1EFXB 1A7RH 1OAQL 4FTVD 5I1AA 1CFTB 3I2CL 3DVNA 4PLKD 2ED7A 5E24E 3GSWB 4HGWB 4XPTH 3PGDA 3TN0C 3RDTD 3PGCA 3ZMRA 3ROOA 1JZ6A 3M07A 5IMKB 5SV4A 5DJZB 1DBKL 1TENA 1J0IA 3QUZB 5D1QB 4PTTB 4ZNEA 3FT3B 3SJVE 2PCPB 4ZPVA