3MJ9L

Crystal structure of jaml in complex with the stimulatory antibody hl4e10
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
209
structure length
209
Chain Sequence
YTLTQPPLVSVALGQKATITCSGDKLSDVYVHWYQQKAGQAPVLVIYEDNRRPSGIPDHFSGSNSGNMATLTISKAQAGDEADYYCQSWDGTNSAWVFGSGTKVTVLGQPNAAPSVTLFPPSSEELKTNQATLVCMINGFYPADVAVTWEADGTPITQGVKTTQPSKSDSKYMATSYLTMTADAWKSRNTFICKVTHGGNTVEKSLSPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Junctional adhesion molecule-like
publication title Molecular insights into gamma delta T cell costimulation by an anti-JAML antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2010-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj9L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj9L01
1JBJA 1QLEL 5JUEH 4K71B 1QACA 3O4LD 2X1QA 4PY7B 1FL5B 4M48L 3BPOB 2DI9A 1TJIH 3IF1B 3WS3B 4ZMAT 2EXWD 4X4MA 1PSKH 4Y4KB 3C09C 3BGFC 4F37F 2JJSC 1F11A 4OKVB 3WSQH 4FQXA 1NGWA 5DSCB 1Z0MA 3TIEB 3VXRE 3KG5A 3ULSB 2ENSA 3DLQR 4E41A 4WW2A 5IP4A 2FJGB 4A6YL 3B2UD 3TO2B 4PJDB 5JLZB 1U3HD 3I02B 1WBYA 2ICWA 3IVKA 4KTYA 3MRQA 3IXTB 2NY2C 4KKCD 5CMAA 3O41A 2DTMH 3O6FA 1A7RH 4NNYB 2W60A 4UIMB 4LHUA 1IAIM 2DICA 4HXAL 5ESVB 3V5KB 2PR4H 3MGTB 4HCRL 4HEME 3IU3A 1KPRA 1NC4A 1JZ4A 3RKDD 3RUGB 3TN0C 4XAWH 3EOTL 4EI6A 5D70H 1A4KB 4ELKB 5GPRA 3MZTA 5K9KB 5I1KH 5CGTA 2DJUA 1NEZB 3NZHL 3S37H 3BP6B 3D39D 5FO7A 2DBJA 1U8OB 4JAMA 2GAZA 3V5DB 4G7VH 5ANMA 4U6TA 2HH0H 5ANME 5GRZA 3S8WA 4RAVB 5MEQA 4R2GC 4UT7H 3RY6A 1J10A 4WFED 4KK5C 5IIEA 5JHLL 3SHSA 5F89A 4NO3B 3VI4E 3H9HA 5A16B 5KVGH 1H9VA 4EVNA 4XBEL 1BF2A 5I18L 3UTTA 2Q3ZA 3KJ6L 4ZUSB 1CGXA 3K4DA 1CICD 1T1YA 4J8RB 2AKRA 4XPBH 3BVNA 2BC4A 3CH1B 5DVKA 5GS0C 3QUKB 2BVTA 2YBRB 1A9BA 1BJMA 1QFUH 2AABH 4PV9A 1XGPB 2ARWA 2VH5L 1IGJB 3LMJL 4OZHB 3P4NB 4M6AA 3UYOD 4M62H 5F96L 2ZUUA 2BOCB 1QUNA 3CFEA 1T04A 5EIVA 4DUWA 1URLA 1XIWC 2HTKC 4KHTL 2VLJD 2ZUTA 5JPMA 4M93B 5JIPA 2XZZA 2X6MA 3VH8G 3ARBB 1FBIH 4PJ9C 2H2PD 1SBBA 3EDEA 1QSZA 3E6FA 1G7IA 3TP4A 4HQQL 4MAUH 3U46A 4MSWA 5KW9L 1RZKC 3EFDH 2FIRT 4RMQA 3WV0A 1SJHB 1I7RB 3SO3B 3A6CL 3ARED 1INEL 3OPZL 1CGSH 4F7EA 2FECI 5FKAB 5KSAD 1MRCL 5CUSL 1M05B 4OFYD 4RWYL 1J86A 1V7NL 1RJYB 3WNMA 5C0EB 2EDBA 2VUYA 2WINA 3DO7A 4MJ5A 4JREB 3QQ9C 4MNQE 3TYGL 1NBQA 5IB4B 1LO5A 3VFOA 3DX7A 4HPYH 4DGYH 1UA6L 3OWEA 1DQQA 4I2XB 5DTFB 12E8L 4BSVB 4LDOB 1HILB 1TJHL 1LEIB 4X7CC 5CBEA 3TVMB 5F1IA 1MWAB 4PRDB 1AY1L 1FNGA 4JPVH 1JGUL 2W91A 5GS0H 1XZ0A 4UOW1 5BJTB 4UB0H 5CZKA 4HKJB 3FB8B 3JTSA 4LP5A 4UUJA 4RISL 1JL8A 1JPGB 1ZHNB 1L7TH 2IG2L 4XNXL 5TF1L 3ORJA 4XWOD 4O2FB 3WHE0 3EYVA 1K4CB 2JCCE 3K1KC 3STZA 1BBJB 1T6WA 3ZTNH 1F02I 1MJ8H 2P4AB 3OX8A 4JFFD 5IM7B 2I9TA 1Q1JH 2APTA 2EH7L 3FTGA 1E4XH 1MQ8A 2DLGA 2C3WA 3T0DA 1CFSA 2Y36L 1NGQH 4U1HB 3HE7B 1IGFH 1VGEL 1UFUA 2C3HA 3EHBC 3CSBA 1A4JA 4OCRH 2DAVA 3WJJA 2GEEA 2EDTA 4UBDD 4X4YA 4ZYKB 4CVUA 1A14L 3WFBH 1NL0H 4WHYH 1J1OH 2DQHH 5AYQA 2I9LA 3WIIH 4TNVK 3BH9B 1CDYA 2P5EA 1A1OA 1NFKA 3BQUC 4U1MB 5D1ZA 3SJVD 4Y7MA 3GSOA 1HZHL 2N7BA 2Q8BH 4LU5H 4PJCE 4XP1L 2X7LB 4DCQB 1DLHB 4U6XA 2XZCL 4MXQC 3QZWB 5KAQG 4WTZG 4P59L 1JNNH 1MFDL 4LASH 4OM0L 2NR6D 5ESAB 3RVWC 3MJ8A 2AEIT 3U7YH 2RCSL 3Q3GB 2YPKB 4HKXB 1CE1L 5IVXE 1CVRA 4WFGD 4AK1A 2HMIC 1MF2H 3H7BB 5E4EB 3EGSB 3RL2B 4ZNCD 1NCDL 3MV7E 2Q20A 1XCQA 4K3JH 2WBKA 3FQUA 4G6AD 4LSUL 3ROLB 4KKLC 3L5HA 1QSFA 1U8MA 2VL4A 4GAJH 2VR4A 3K7UA 1GGTA 5FYJL 5DJ8B 1JGVL 5FHAL 2DQDL 4HJGB 1ADQH 4V2CB 4LSVL 1TQBC 4YH6A 4LCWD 4FXKA 4U1IB 1J0JA 5DT1L 3VFMB 4KMTL 4MD4B 5D7JA 4PJ5D 4NPYB 1MFAH 1XGUB 4U6HB 5D2LB 4GW4A 4ODWA 3RL1B 2C4FT 4AQOA 2NY1B 2LABA 4RFEA 1I9RL 2E7LA 5F1NB 1A6WH 2K7PA 5FO9A 4ORZC 2VE6A 4RA3A 4ONFH 5IBTL 3MR9A 3T0EC 3RNKA 3CZFA 1KFAH 4MQ7B 4FQ2L 4BSWB 4JY4B 5KVDL 5H94B 2NZ9D 2OQJB 3ILQD 3OXSB 3MRPA 3MLSL 1WZ1L 3LQMA 4X7EC 1VSCA 1MCEA 1RHFA 2X4UA 2ILLA 3MXWL 4LSPH 1DBBH 4LRNL 5J1AA 2O5ZH 1F4WL 2DI8A 4KGLA 3RVUC 3O11B 3MO1A 2QJDA 4BELD 5INDB 3S88H 3AY4A 4P3DB 1F3DH 1WC7A 3MRFA 1RD6A 3I6KB 4XNQA 5HI5C 1NUFA 3C6LC 4X7TB 2EKSB 5FV2A 5IT2L 4LCUA 4LLUA 1YMME 3SKUD 1C08B 3MLYL 4JM2C 3OKNB 4ZAKC 3IFOB 2YMXL 3MRHA 4W68A 4HZLB 2D7PA 5F3BA 5E6IB 1ZGLA 2ZCKL 4KKAC 5HI3D 1JPTL 2YD3A 4MA8H 4U7MA 1YA5A 4Z0XA 4GAYB 3WIHH 5CP7A 3I6LD 1OTUD 5C0DA 3W9DB 4K07A 1P4IL 5C09A 3GBLA 1T7ZA 2IQAB 1RMFL 1UQSA 4IHOA 5EUOA 1ORSA 1IGYA 32C2B 1DQML 1ZOXA 1KBGL 5IBUG 2X9WA 1NMAH 4BUHA 2VZVA 3DMMD 1LE9A 4K55A 2NY3D 2SEBB 3DVFA 3NCJL 3MV01 1MEXL 4JR9H 1MAMH 5SV4A 4U0RB 4U05A 5MEPB 5J0BA 4G5ZL 4KTEH 3G6DH 1OY3B 3WO4B 1ZV5A 3N1FC 5B8CC 2IADA 4OLUL 3N1GC 4Z6AT 3HPLB 1XF4A 4TVPD 1MRDH 4HBCH 5D5ME 5C0BD 2J8UE 1KLUB 4NKIH 3HAEA 5SX4I 2WV3A 3BH8A 2IALB 2Z92B 3KYNB 4PLNC 3D9AL 4ZXBD 5BV7C 3PP4H 4JFQA 1HHJA 4NWUL 1NFDF 4PJ8C 3U7WL 3DX8A 3L3IB 5AZEL 5IMKA 5CEXA 2C5DC 1JGLL 3LVEA 5C0CD 2MCPH 3IJSB 1WISA 3SCMA 1MHEA 3STBA 4YFDB 3D18B 1U93A 3V0VA 2BNQA 1OAKH 2XTJD 4HK0A 5DMIL 5ICXA 2FNBA 4LSSH 5ENWA 1JNHA 3LS4H 3E6HA 1KIQB 5DMKA 3GI8H 4H8WC 3SGEI 4TN9A 3HS0A 5E9DB 5EOCL 3GK8L 3LH2H 3R06A 4JM4L 3WKML 4L4VA 4L4VE 4JFYA 2R2BB 3S35X 1JN6B 5D7IB 3ZHDA 2V2WA 2VRAA 5TE4H 4C83A 3SDAA 5F7FA 3HI6H 1EJ6A 1JTPA 1MVFA 3GMNA 3PXHA 5ETUB 5T3ZD 5IW1B 1CFTA 1DBJL 3CFDA 2A0LC 3U1SL 1FYHB 3F7VA 4DVRH 4L9LA 4FQ1L 3QEHB 3U0TA 3SE8L 4D0BA 4QHMA 4K3DL 2Z93B 1OCWH 5HPOA 3RGVA 2FEEI 2ORBL 1VFBB 2XICA 5GS1B 3ARDB 2X4RB 1OPGL 1T5WB 4KZEL 1UCTA 1JNLL 1WEJH 1Z5LA 4CJ1A 1DVFD 4AT6B 3BGMA 3EJYC 4PRPE 4U4BA 4GRWH 3CLEL 4D0CB 3CXHK 2YPVH 4B7IA 5C2BH 1EGJL 3MGOB 3W82A 2ESVA 1BQHA 5DZOA 2ESVE 2VXUH 4RA0C 4E42A 3QDGB 2AP2A 1XGTB 5D1QD 4KXZI 4L8CB 2Y07L 3CFKB 4OLXL 4IDLA 2V7NA 4J6RH 4M43L 5EU7C 1YDPA 4HX1B 2CLZA 1KN2L 3LKNB 1KTDA 3LRSA 5C9KA 3BWUC 1RHHB 3GRWL 5IEHB 5L88H 1LO3H 3PHOA 2ZUYA 3BD3A 5SWZA 1PQZB 4WVRA 5SWZE 5DK0A 5DEGB 5DD1H 5SWSB 4U1LA 5L9DH 1YECL 4IRZH 3KPRD 4OI9A 1DEDA 2MQCA 1CE6B 3OB8A 4M3JA 5IWLC 3V6OE 4Y5VA 4DFHA 3WE6B 3ZE0E 5MERA 2VYRE 4IIQB 3HI5L 2FB4L 1JGDB 3DI3B 1ZEAL 2CDEB 1ZT7B 5C07E 3WUWB 1GJIA 4XRCA 1MCPH 1J0KA 4Y4KC 3ZT6A 4Y19E 2EDOA 4MAYA 1Q9KA 1QR1B 2YOCA 1EA9C 4JFOB 2Q7NA 1GIGH 2GT9A 3QJHB 5L8KB 4JM2F 5CCKH 5HYQA 1F6AB 4PBWD 2FGWH 3ARYA 5DO2D 3T8XA 1OF2A 3P4MB 3SDXB 1P1ZA 3QI9B 3GMLA 4OLEA 1TVHA 4F80A 4LGRB 5IV2B 4NCC1 3HE6B 3KAAA 5B3NA 1S78D 5JOFA 3GSQB 4AEIL 1R3LA 3FT2B 3NH7L 4A6YB 2D3VA 1CFNA 1T22B 2ZUSA 2W65A 3QPXL 1I9IL 3NFPA 5FUZL 3E3QC 1H3GA 4MDJA 2C4XA 5DHVB 3VXPA 43C9B 3F62A 1SJEB 1VFAA 1VKXB 1AXSA 4JRYD 4G9FB 3QHZL 2H32H 1UG9A 3T2PA 5I16B 2W0PA 3WLWD 2JE8A 2RHEA 1M7DB 5MP6H 2GFBA 3VXMA 1H15A 1B3JA 4M9PA 5DD6A 2OP4H 2PETA 4PGDA 4TUKL 4HIIA 5HHMD 3U30C 2PKDA 5DMGC 4OCMC 1AO7B 4PB9L 3DROA 3L1OH 3WHE1 4H26B 4NSKB 1TCMA 4K8RH 5HDQH 3VGDA 1ND0A 5A2KH 3DRQA 2GHWB 2HYMA 3UBXB 4YBHA 2L7JA 4YXLL 1I7TA 3KLSA 1DDHB 1TFHA 1LP9B 1N7ML 2DYPA 3DI2B 4AZ8A 4YPGB 4YZFE 4OQTH 4ZS6D 4OM1L 4Q74A 1INDH 2E9IA 1XCTB 2XZAH 4QEGA 5FO8A 4WHTB 2QSQA 5HYJE 2BNUB 2Q86A 3RDTB 5DRZB 2CUMA 3P9MB 4N0YL 3IKCA 5HHXH 3MRMA 3DXAB 4FFVC 4I9WE 4TULH 2EIEA 2X1OA 2IQ9L 4P23A 4NNXA 4ZUWB 4OD1L 1A1MA 2GI7A 1IEAA 1IGMH 1JYVA 5D6DA 3JV4B 3OKKA 2G60L 5FYLD 4N0UA 4FQCH 1MI5A 3U82B 5I9QB 3HPJA 1I8IB 4HXBH 4GRLD 3PE9A 1A1NA 5IKCB 2AS5M 4OIAA 3WFCH 4OZFA 5J6GA 2MTPA 2F19L 3F58H 3U36A 1JJUA 5I6XB 3O3BB 2VJXA 3O3EB 4G42B 3STLB 1IC4L 1A7NH 1VADA 4P46A 3QIBB 2QKIA 3CNKA 4WI4A 4G6ML 1OGAB 3F7PC 1MQKL 2WP3O 3VWJB 2W9EL 3O6LL 2NLJA 3MREA 3MJGX 4YAQB 1TVBB 2IH1A 1SYVA 4GKNA 5ISZA 5ISZE 3VH8A 1IAII 4XC1H 3BIKB 4PUBL 3OAYH 1CVSC 2H9GA 4S2SA 1E6JH 1HDMB 4YHKL 3W39A 3SQOH 1DCLA 3IJYA 4JREC 3MV9E 1W72H 3O6ML 4M3KB 3V4VH 2A73B 4WUUA 1I9JH 2YUZA 3K74B 4BFEA 4NKMB 4ETQA 4FNLH 5F7MC 1RZJL 2ATPA 4PRNB 4XNUL 2CH8A 5ACMA 3BHBA 4QRPA 3LEXB 4QRPE 1F6FB 4DAGH 2OI9B 5AUMA 2X4NB 3MA9L 3IDNA 3ARGB 3GMQA 2XG4A 1KJ3H 4TVSa 3VFVA 5CIPB 4KMQA 3RWCA 4AMKH 4H0HB 5FYKU 5JOEA 3UTPD 3ILPB 3BP7B 4ZFZA 3OJMB 2VQUA 1A7PL 3SGJC 1FIGL 5BS0A 4IOIB 4YX2H 5C92A 2AK4A 3GGWB 4Z7WA 3SE9H 4APQC 3INUH 5BS0E 1KT2A 4MA7L 5D2NA 5MENB 2YEZB 3KPSB 5HGAB 4BJLA 5KS9E 1V05A 3L3KB 3RIAK 1NBVL 3G5ZB 1FO0L 1TXKA 3KPOA 1V3JA 3VXSD 5CJXA 2R56H 5ILTL 3QUZB 4RZCB 3RNQB 1CT8B 3JWDH 5E8NA 3WFZA 1R3KB 4CJ0A 1DN0B 5DQDL 4NHUA 2CKBL 4ELMB 3TA3B 4ZOCA 1FH5H 2X89A 2CMRL 4G8IA 1ETZA 2I26N 2NX5E 1JZ8A 3NCFB 4NRZA 2HFGL 2K7QA 2GW5A 2CK0H 3C5SA 1GXEA 4KDTA 4NKDA 5C08A 5C08E 3Q5YA 1M6OA 1TTFA 4XXDA 3VD5A 1NLDL 1TVDA 5D8JH 1FYTA 4M7LH 2BSED 4LSQH 5JXEC 4H5SB 2XTLA 5F7LB 2AJSH 4JE4B 4L8DA 1RUPL 5HYEA 1OTTD 5D1XD 4U2YA 1T7XA 3S3SA 1DUYB 2BVEA 5L8LB 3H9SA 4JZJA 4WTZA 3MJ9H 3QFJA 3BOVA 3NFNA 1G84A 2OCFD 5IB3A 1VFMA 4XB8A 1ZHBA 4ZOBA 2FX8L 3VFGH 1K8IB 1FV1A 4IRSD 2D2OA 1DQLL 1R3JA 4MD5A 3X12B 3CK0L 5JQ6L 5T5FL 2Y1VA 4GT7A 4X8JA 5L6YL 4XX1E 2HFFA 4U49A 4QF1A 4Q9QH 2KDGA 5F72S 3IDJA 4P2RD 2CDGB 3EOBB 4KKBC 2CLRB 2F5AH 1MVUB 3QEQE 3QNXB 3RUGF 1HHGA 1F90H 5I1CH 3H0TB 2CXGA 4HKBB 2YUWA 3TZVD 4WNQA 2DIJA 5F3HA 4YHLL 2FJFB 1S7XB 3PWPD 4ALAL 1TETL 5DDHA 4PJEE 4MJIB 3BO8A 2H2SD 3EOAB 5CILL 3RU8L 2Z4QB 1PX3A 3U4EB 4LAQH 1JK8A 1D9KA 4BH8B 5LGKA 1ZA3B 1B88A 4O4YH 5FEBA 3L3GB 3NACL 1QA9A 3IETB 4QXUH 3LDBC 1ZAGA 3PQYB 4ORGA 5J12C 5K93A 4IS6A 5ABDE 5GRJL 2F8VA 4GAGH 3IDXH 4LVNB 4CKVX 4UT6L 1HOCB 4GO6B 3W9EB 1WAAE 2F58H 3REWB 3PWLB 4NDMB 4J23A 4OLWH 1I8KB 1B4JH 5CEZL 3CPLA 1F6LL 1B4RA 1M71A 3GM0A 4ODVL 2JB6A 1UWGH 4Z7OE 3C60A 1JRHI 4G8EB 2ITCA 1X6NA 3HRZB 4U6YA 1BOGB 3MJ6A 4P4KC 4O58H 5E6IC 2DLHA 3EYQD 3T0WA 3BGAA 2JIXA 1WZMA 3G6JE 3C5ZC 1YY9C 1CXHA 1NGZA 3G9AB 1MRFH 4H25A 4J2XA 2MSPA 3UPAA 1GC1C 4ZUVB 5BW7A 4AIOA 5EORH 3VXNA 2VDOH 3CVHA 2IGFH 1AIFA 5HHNB 3RBSA 4I0CC 3RVXD 2XA8L 3BP5B 2CUHA 1CZ8L 1S9YA 3MRRA 4Z95H 3QIWD 5SWQB 1QFWM 2LQRA 3TBTA 5GJSL 5ADPH 2FZ3B 1KF9B 1IM3A 2DLEA 5SV3A 3BDYH 2P46B 4OI8A 4MA3A 5FF6B 1S7VB 1EVTC 2N4IA 5I1LB 1UXWB 4EDXA 1R5IA 5FECB 3L6FA 3NIDE 1FORL 4FQIH 3UPRB 2X2YA 1YN6B 2XQBH 3KGRA 4KKNA 3MLTB 4W4OC 4R97C 4Y16A 1CD1A 1J05A 2WMPA 4RAHA 5CGYC 3WO4C 4KVNL 2B5IB 1QFWH 1FAIL 3BPCB 4LLQA 4S1QL 4WWKB 2O5XH 5E8PB 4RGMB 1AC0A 3JTTB 1KJ2A 5JW4M 1FZJB 3KJ4B 4BQBA 1SQ2N 4PGEB 3L5WA 4E5XA 5JO5A 2LU3A 4Y5YB 4KHXH 1WQVT 1S7SB 2NY4C 2P8LB 1MLCB 1U2HA 4F7TB 4NBYB 5INCB 3LQZA 5FA4A 3JWOC 3HUJB 2EYRA 3DUSA 4QLRA 1UT9A 5I1DB 1INQB 2EXYC 4KJQD 4Q0XL 4FRWA 3W0WE 3TNMA 4D3CL 3MYJA 1AGEB 4E0RA 5B3JF 1EAPB 1MHPH 1QSEA 4OF5A 4OGXH 2LV4A 3GJFH 3GMOA 1GH7A 1GZQB 2OTUB 4L4TB 2RJMA 5E2WH 1YMHB 1SMAA 1LHZA 4JRXD 1I7UB 2VLRA 2HKHH 5ALCH 2VLRE 1UEMA 4NQTA 1IRAY 1T0NA 2VZSA 2VAJA 2EO1A 4M5ZL 1VB9A 3AXLA 4NUJB 4Y1AE 1WWAX 3CMOL 5GXBB 1HKFA 3NA9L 4OUUB 3B9KD 2JJSA 3CJJA 4GRMB 1D5IH 3HCVA 4K9EH 4MJ6A 5CJBA 4XTRC 1ED3B 2CXKA 3QA3A 1BZQK 4M03A 5I1AA 3QWRD 4X80L 2BY3A 4XP5L 1VPOH 4L3CA 4JY5H 4F7CB 2BVUA 4X6BA 4M1CD 3GSWB 3UC0H 4JVPA 4MHHG 3O45A 2WUBL 3QDHA 1FC2D 5DVMA 2B2XH 1SJVA 1BVLB 4N5EC 2XRAL 1FQ9C 4HS8H 2YC1A 4GXUN 1FFOB 2XA3A 3U9UB 5GS1C 3ARDC 4JRWA 4GLRH 3D2UA 3V6BR 5D7LD 1WCBB 4PGBB 1EZVY 3RWGB 1ITCA 1I7ZB 2AJYL 5T3ZH 4LKXA 1XH3A 3D3VA 4FTVD 1G7LB 1BF8A 5JORB 1KCKA 4HFUL 3WEXB 3NABL 5IOPB 2IANE 4FZEL 4GJTB 5H35B 1GGIL 2O61A 4GBXB 5BVPL 3O8XD 4QNPF 3UTOA 2XN9E 1A9EB 1GAFL 3ZTJH 2PYEE 1F8TH 4MWFA 1IE5A 3NCMA 5A2FA 2BX5A 4R7DA 3V4PL 4NM8H 5JTWA 3PWNB 5TDPA 4NQCE 5D2LF 1ZMYA 3FFCE 3SDCD 2C4FU 4H88H 2EDRA 4BFGA 5JW3L 2ARJB 2OZ4H 4U1SB 3VFNA 3FO1A 4JHWL 1F11B 3M17A 3P0GB 3MRBA 2H1PH 2WBJC 2CGRH 4DZ8A 4FQXB 1NGWB 4M7KL 4ZNEA 4NO0D 2JJTA 4WW2B 5JHDA 4POUB 3IVKB 1WBYB 2ICWB 3FN0H 5HDBE 3L7FA 3MRQB 1UWEL 3DSFH 5L2KA 1ZTXH 5L2KE 5CMAB 3O3DA 2UYLB 3O41B 1C7TA 3O6FB 4O2CA 2W60B 4LHUB 5GGVY 2EDXA 5JNYA 1DJSA 1LVEA 1XIWA 1F2QA 1EO5A 3IU3B 1KPRB 2E5EA 3HC3L 4HWZA 4Y4FC 3GSNH 4NWTH 2YPLA 2AERT 1NC4B 4FFYH 5DFVC 5AAWA 2R0KL 3D6GA 3QT2A 1EHXA 4EI6B 4O5LL 3WXVH 4EOWL 5I1JH 3AMLA 4GMSH 4NZRH 2HJFA 1J8KA 5FO7B 2X4SA 4ONOA 4U2ZA 4JAMB 3VXRD 5ANMB 5ITFA 1LK3H 4NQEE 5MEQB 1NPUA 3MUY1 1OW0A 3LS5H 3KLHD 5DMGD 5IIEB 1MFCH 3T2NL 5F89B 1CDIA 3H9HB 1JHTA 1I1FA 1KLGA 1BBDL 4EVNB 3UTTB 4XPHL 2ZUQB 3MOQA 2MKWA 1C1EH 1FGVL 5T33H 3VI3F 1KTLA 2VXTL 4O51A 5DZLA 1T1YB 2AKRB 3BVNB 1CYGA 2BC4B 1KENL 3FQNA 2D03L 4K23H 4P4RA 4AYFA 1IEHA 1NKOA 1A9BB 4O02L 4PV9B 2W0FA 3V8OA 1J8HA 4D9LH 2HFTA 1MHCA 4NZDA 2XPGA 1CF8H 4I77L 2CRIA 1NFDA 4XBGA 2X9YA 4WTXA 2D4DA 3CFEB 1T04B 1FNSL 3L3OA 4YHYB 3CZJA 1MCFA 1MCBA 4Y2DD 4LARH 5JPMB 1HEZA 4KUZH 3EYSL 3KS0J 4JPKH 1DBAL 1OD7A 1NAMA 2HRLA 1BPVA 3QDJE 4Z7NE 1T83C 3QR2A 1NDMA 2DL9A 3E6FB 3ARBD 1G7IB 4J4PA 4FABH 1TZIA 3ZSTA 3U46B 4MSWB 2YKLL 2NY5H 3U9PH 3Q6GH 1OP3H 2MKLC 5D4QA 1TMCB 1ZWIA 4F7EB 4KQ3L 3NTCH 4NO5A 4PRHA 1F3JA 1UXSA 4KJPD 1CTOA 1FPTL 3B2VH 3IDGA 2WINB 3GMRA 3DO7B 4MJ5B 3WDIA 3BQUA 4K94L 4LFHG 4EI5A 3VFOB 3DX7B 4HGKC 3GMMA 1DQQB 1UM4L 5I6XC 1NMCC 2HTLC 5D7IF 5CBEB 1HHKA 4JO4L 3QG6A 2CLVA 5F1IB 5I2IA 3QIBC 4TRPH 1FNGB 4LK4A 5DJZA 1S5IH 2EKJA 4IBLT 3TVMD 3VWJC 1XZ0B 3OGCA 4V1DA 5LQBL 5FYLH 1Q0YH 3JTSB 3UAJC 4UUJB 4Y4HC 5F6HI 4A2LA 4HWNA 1RV6X 4X9BA 2YK1L 3W11C 5FYJU 3EYVB 4ONGH 4UQ2A 4MA1C 3MTRA 3IS0X 4NJ9L 1Z3GL 1PG7H 3STZB 3I2CL 2I9TB 3OX8B 3BKML 2NY6B 5CJ8A 4X7SH 3FTGB 1T20A 2B4CH 1DSFH 1N4XH 1G1CA 3V6FA 1CFSB 1IKFL 3BD4A 2ARJQ 4CU6A 1RZ7L 4OLZL 1MY5A 1L0YA 3HE7D 5F1OB 2DQTL 1A4JB 4IMKC 5BO1H 1YPZE 4HWEL 4JO1L 5JR1H 4X4YB 5DVNA 3CXHJ 1YY8A 4Z78B 1G9NC 3IXAA 4OF7A 3HC4H 2P5WE 2I9LB 2VDNL 3U0WL 1J88A 4B7LA 2Z8SA 3E8UL 2P5EB 1A1OB 3GB7A 3G08A 3OZ9L 4MQTB 1LO4H 3ULUD 3ULVE 4PB0L 5D1ZB 1I75A 3MBXL 3GSOB 3T0EA 4FP8H 3I3EA 3QUZC 4MHHI 5C0FA 1GZPA 1QYGH 2CRYA 4U6XB 2DQGH 2ZCHH 5SX5K 3VFUB 2PW1A 3BDBA 4BA8A 4P2QE 4MX7A 3MJ8B 3TT1H 2QR0A 3BMWA 2L7UA 4PJXE 3KXFA 1MCQA 5HHOA 4QTIH 5HHOE 4NRYA 1PLGL 4BQ9A 1XCQB 2VXVL 2QTEA 2CDFA 3FQUB 5KTEH 1QSFB 1U8MB 4NQDA 4R4FH 2EDJA 1JV5A 1BD2E 4PJ7E 1I3UA 4R8WH 1E4JA 4PJBE 3LAFA 5I76A 4FQPA 2AXGA 3CVIH 3VMOA 2XY1A 1U8QA 2V5YA 3H7LA 5CP3H 5DD5H 3H6JA 4FXKB 4WO4C 4IOSD 2C3XA 1ZSDA 5D7JB 3BAEH 1AD0B 3EDFA 3T3MF 1OP9A 4KVCH 3BSZH 3BEVA 3ZDXE 4OCSL 4OZGA 4GW4B 1I3VA 1KB5H 4ODWB 3OXRA 1UYWH 1JPFA 2VQTA 3MRIA 4MZ3A 4C4KT 4Z7UF 4RFEB 1P4BL 5F9OH 1KCSH 5IW6A 2NY1D 1I1AD 4Y8AA 2R8SL 3BJ91 3OBAA 4XP4L 4XHJC 5J56B 4N68A 5FO9B 5C0IA 1FLTX 2VE6B 4OCXL 1CD8A 3MR9B 5CS7A 4JFZL 4WV1C 3RNKB 3CZFB 3MJ7A 5I15H 1U6AH 1CFVH 5FYKD 2N7AA 3K0WA 4EBQH 2X44D 3MRPB 1U3YA 5T5NF 3CGTA 5B8CA 5DUPL 5FGCE 5FUOH 2X4UB 1H3TA 4Q2ZA 5F9AC 4M6ML 5LCVH 5J1AB 1EJOL 2OTPA 3FOLA 1YC8A 1DBKL 3MO1B 1JHLH 2O5YL 1WC7B 3MRFB 2NY0B 5T1DH 1S3KH 4XNQB 1DFBH 5GZNC 1G6RL 2LU4A 4LCUB 4PJ8A 4LLUB 1IM9A 4X6CF 5A3IC 4I3RL 5CINH 4GRWE 4WUKH 3CVHL 1U8NA 1UCBH 1LP9F 3MRHB 5F3BB 4WY7L 1OOAA 1ZGLB 4NKQB 3E2HC 4Z0XB 4LVNC 1J87A 3O6KL 5CP7B 5C0DB 3D85A 4Z7VE 4YDIL 1G0DA 5C09B 1L4IA 1OLLA 3CSYA 5GHWH 1CK0L 1TZGH 4XVJH 1UQSB 4IHOB 4KPHH 5EUOB 1ORSB 1IGYB 5KVFL 3ESVF 4KRLB 4X6EA 4YHNA 5E5RB 5E1HB 1JVKA 3ZE1F 1LE9B 4XVSL 5CZVH 1OAUH 3LPFA 4RMTA 1AC6A 5EB9A 2VLKE 1RU9H 4TOYL 5C0AA 4N9GA 1N26A 4M5YH 1CXKA 3QJFA 5TQ2H 1KJ2L 2VC2H 2IADB 2VDRL 1LE5A 4RGNB 1XF4B 4LOUD 5F6IB 4WI5A 3HAEB 5E5MA 4JO2H 5DD0L 3BH8B 4JGUA 2A77H 5DI8A 3SDYH 4JQVC 3LQAH 2CIKA 4NQVA 4WRLA 3RWFA 2AW2A 4JFQB 3MV8A 5I1KL 1HHJB 1CLOH 3MV8E 3DX8B 1GPOH 5IMKB 1IAIL 4TTDD 5CEXB 1U91A 3QUXC 3SCMB 1MHEB 4G7VL 1YEFH 1U93B 2DIAA 2BNQB 4KY1H 2HH0L 3V0VB 3O4LA 2HKFH 3KNBA 3O4LE 4WWKC 4HK0B 5ICXB 1ZLWK 4QXGL 2HT4D 5ENWB 4PJGE 1A5FH 1JNHB 3E6HB 5DMKB 4RFNC 3WN5A 1GOHA 5T1LA 4QHKJ 4G6FB 4NUGL 2W38A 3HS0B 4FZ8L 3R06B 4YIQA 4L4VB 4DKFH 4Y5YC 2GJ6A 4JFYB 3ARPA 4X6DE 5E9DD 3GHEL 4D94A 1Q9LA 4NCC2 1E4WL 2V2WB 3GI9H 1HXMA 3V95A 1V5JA 3BE1L 5EG6C 3MLXH 4C83B 3SDAB 1T2QL 4HMCA 1U3HA 2H32A 1DBMH 1GHFH 4Z77A 3GMNB 3AS1A 5FK9A 1CFTB 3CFDB 2DQCH 3DV6B 1IMHC 2UVFA 3S37X 5IWLA 3F7VB 4L9LB 1FNAA 3OB0K 3U0TB 3X3GH 4D0BB 4QHMB 4G80A 3THMH 1Q8MA 3UJTH 1GOFA 3RGVB 1PBYA 1KEGH 1FBIL 3ZKMC 4EUPH 3S36L 1IGCH 5KJRL 4XC3H 1Z5LB 4FFWC 4NO2A 3SGDI 3BGMB 1MIEL 4ODXA 5IB2A 3EYUH 2DM7A 3D39E 1KIRA 5DSCA 2WSKA 3LB6C 4JB9H 4ZD3H 2ESVB 8FABB 1BQHB 2BP3A 1JFQH 2WQRA 4NN7B 2OR9H 4E42B 3UZVB 1PEWA 4WFEE 7FABL 4KZDH 1B90A 2H41A 2XKUA 4NNYA 1Y6MR 4HPYL 4DGYL 3QDGD 4KRPB 2FDBP 2C3GA 2V7NB 1MY7A 1YDPB 1QLFA 1V7MH 2CLZB 5DJYA 1GGYA 4XPFH 5GSVA 1KTDB 1JNJA 3LRSB 4NFBA 4TNVF 2WQ8A 2VUOA 2ZSWA 1KCLA 5ALBH 2FL5A 3PHOB 4JPVL 4XCFH 4XPGL 3IDIA 5GS0L 5SWZB 1RUMH 4G43A 5DK0B 35C8L 3GFUA 4MMXC 3W2DH 2F74A 4GBXC 4U1LB 2XOTA 4K7PL 3BPNC 5F1SA 1C7SA 3NIFE 3MSPA 5SWSD 3IFLH 4O9HH 2NW2A 4GW1A 3VGGA 4YWGH 3P9LA 2HWZH 3KS0H 4KI5D 4JKLA 5DJAA 1JZ5A 4Y5VB 4YBLC 3ZYJA 5CD3A 4PJFA 5MERB 2VLJE 3CFBA 5I19L 1UM6H 3JSSA 4GG6A 1NJ9A 1KEMH 1NGQL 2OR8A 4MS8C 1AE6H 3VG0L 4GG6E 3GBMH 5I66A 3PXJA 2ZOKA 2OL3H 4ZUSA 1KV3A 1RIHH 3LPGA 4Y19B 1RZKL 1WT5A 4OCRL 4MAYB 1Q9KB 2RBLA 1UWXH 1WBXA 3AREA 5BOZG 1RUAL 4MCYA 3CH1A 5DJ6A 1L0XA 2HT3D 5HYQB 1WSST 4HUNB 4TYUA 2Y72A 3WFBL 4OFYA 1NL0L 1J1OL 2DQHL 3I50H 1P9MA 3T8XB 3WIIL 1D5XA 3HC0A 1OF2B 3HZMA 4X4XA 2BDNL 1P1ZB 3GMLB 3KVQA 1TVHB 3NZ8A 4ONHA 4FQJH 3O6FC 4DQOL 4N0FA 3QI9D 3P0YH 4JFPA 2Q8BL 5ERWA 1TJGL 4XCYA 4LU5L 1FGNH 5JOFB 4OZ4A 2EC9T 1R3LB 3HE6D 1CFNB 2W65B 4LASL 2FBOJ 3T77A 3NFPB 4LQFH 1QFOA 3IS1X 4MDJB 3TPUA 5AYUH 2YN3A 3VXPB 5C07D 1H3UA 1VFAB 1AXSB 3NOIA 2VIRA 2ADGA 5BZWA 1Q72H 2PUQT 3FKUS 1EHLL 4HJ0D 2GFBB 2DM3A 4U1KA 1H15B 4JFFA 5DD6B 1KCVH 4PGDB 4JFFE 3RGHA 4HIIB 1X5AA 1KN4H 4GAJL 4HC1H 3IAQA 1JRHL 4XWGL 2LE9A 3NIGE 3DROB 2DM4A 1A8JH 4S1RH 3RY6C 1IJ9A 1ND0B 1RK0A 4UV7H 1AO7D 3DRQB 1FNEA 1NAML 1FE8L 1FL6A 4TPRL 1I7TB 3PWUA 5GJTH 3CH8A 3BWAA 1CBVL 2DYPB 4EQ3A 5E2UH 3FZUD 1N5YL 2Z8RA 3S96A 2Y6SC 2F53D 1FRGL 5FO8B 5DFTA 2VABA 2YRZA 1T7VA 5EO1A 2Q86B 4OFVA 3IKCB 2XIDA 3ZKNC 3MRMB 1A6WL 2BZDA 1X5ZA 3RDTD 3SGJA 3SJVE 4P23B 5EBWA 3MJ9A 1A1MB 1IEAB 4APQA 2XI9A 3DXAD 4N8CL 5EFIB 3OKKB 4MD0A 4N0UB 1MI5B 2EIZA 5D93B 3HPJB 4P2OB 1NDGA 4BZ2H 1SM3L 4CU8A 2VSDA 1A3RH 3E1F1 5DUMH 1A1NB 3C8KA 5T1MA 5ITBH 5C71A 4OZFB 5IVNA 5J6GB 3OAUL 3U36B 4WFGE 3MLZH 4F7MA 1KCRH 4LSPL 1JF1A 1DBBL 3HUJF 1VADB 3HNTH 1E4KC 2O5ZL 2QKIB 1JPSH 3GBNL 3BZFA 4X99A 3S88L 4BQ6A 2NLJB 3MREB 3IDYB 2IH1B 1SYVB 4GKNB 4JLRA 5ISZB 1MNUH 5MHSD 1T1WA 3VH8B 5EU6A 2PTUA 2H9GB 4S2SB 3W39B 4BUGA 2NXZC 1NKRA 3IJYB 4XCNB 4OFPA 1Q94A 4AEFA 2DLFH 3PIQB 5I1HH 4WUUB 4NZTL 4LCWA 3K3QA 5CGMA 4LL9A 3RX5A 3PWVA 2JELH 4PJ5E 5DQ9A 4ETQB 3K80A 4KROC 2P44B 3RVVC 2ATPB 3BHBB 4G8GD 4QRPB 4JFED 5AUMB 4ZS7H 1J0ZA 5EULV 3IDNB 3GMQB 2BVOA 4AEHL 3LN9A 4YR6A 3KWWA 3VFVB 4DN4H 1FJ1A 3UPCA 5GZOC 3RWCB 5DJDA 3ARGD 3GHBL 1IC5H 4ZFZB 4HV8A 1NMAL 3BRDA 3QG7H 4PJAA 4K3HA 5GGRY 5BS0B 4PJAE 2AK4B 3PDOA 1MAML 4Z7WB 4WI8A 2QSVA 3ARSA 1KT2B 2NY6C 5D2NB 4YXKL 5MEND 3OKEA 3MV9D 3KPOB 3PHSA 3R8BB 3MRGA 1YEEH 2Q76A 2J4WL 4AG4H 3UJJL 1ZLUH 3OV6A 5E8NB 4HBCL 4HIXL 1MCCA 4NHUB 3WJJC 2XQYK 4LQ1A 1P5UA 2I5YL 5F97E 2OX5A 4QOKA 4GSDL 4XVTL 2NX5B 4G8IB 4UTAH 4NRZB 4X83A 3TA3D 3BKYH 3LHPL 4IRJD 3C5SB 2ADIA 2VXQH 1HIML 5HI4C 4NKDB 2AJUH 5C08B 5D1ZC 3UTSA 2BERA 3TESA 4JG1L 5KG9A 1F97A 1M6OB 4P99A 4XXDB 1HWHB 3U6RA 1YEIL 2JJVA 5GGTH 4RMSA 1FYTB 1YQVL 1A6AA 3I6LE 3QCVL 2CUIA 5EBMA 1OGTA 1S5HA 4L8DB 5B39G 3LH2L 3TBVA 2A9ML 4HFWA 4Z0BH 1BFTA 3F6IA 4ODHH 4HMEA 4JDTL 1BFSA 4OT1H 3ULUH 1KB9K 2E6JA 1MREH 5HPMA 2DQIL 3QYCA 2B1HL 3H9SB 4JZJB 1QBMH 3QFJB 5KZCD 4JJHA 3NFNB 5K9JL 4ZFOL 5IB3B 5E00A 3CU7A 1ZHBB 3AAZA 4KQ4H 1NCBL 2CD0A 1QFHA 4GXVH 1FV1B 1Y18A 1R3JB 2J88H 4MD5B 1BX2A 5J3HC 4X8JB 5ICYA 1AFVL 2YUXA 4P4KA 4QF1B 2V5SA 2YWYA 4ZOAA 4TSAL 3C5ZA 4OB5H 4TVPE 1CDUA 4LMQI 5C0BE 1OCWL 1HHGB 2XFXA 3K8KA 5FYJD 5IQ7L 3W9DA 4F33A 1KCUL 4XP6H 1IEBA 2C7UA 4PLKD 1CL7H 2NCMA 3VW3L 2AEPL 3MXVH 4WNQB 1I8MA 1QFPA 5BV7L 1DLFH 5F3HB 1P6AB 3WCYA 4HWBH 5DDHB 3RA7L 3LSOA 5C0CA 3BO8B 2NY7L 2JK5A 3BUYA 1JCKA 2YPVL 1JK8B 1D9KB 3OG4B 5L7XH 5D7SL 3VI4F 2XTJE 1X5YA 1QA9B 2C9AA 4W4OA 3KPPA 4R96A 4ORGB 5LWYH 4IS6B 4J6RL 1NCAH 3H3KA 3PQYD 3ZO0A 2A9NL 4HUKB 1EEYA 3D0LA 1LO3L 3VXUA 3NCYS 2E3VA 5E4IA 2ICEA 3UXFA 5B4MC 2ZJSL 2NY0C 4MJ4A 5A2IH 1U8KA 3CPLB 3ARWA 1M71B 2JB6B 4RGOL 4IRZL 4UZGA 5T3ZE 2EDDA 5IR1A 4G9DA 3C60B 2ITCB 3QCTH 1Q9WA 2DLTA 4U6YB 1OAXL 4LBEA 5I74C 4UMGA 2JIXB 2FYYA 1NGZB 4H25B 1YJDH 1BM3H 3DUUA 2FX9L 3VXNB 1NUGA 3CVHB 1CIDA 1IAOA 1AIFB 4FN0A 3DBXA 3J8F7 5H2BA 1S9YB 3MRRB 4OZIE 1EBAA 2PTVA 2F54D 4LCCC 1CIUA 3BFOA 1LO2H 3TBTB 5E8DL 4HIHA 3HFMH 1IM3B 1MJUL 2P47B 4MA3B 1HKLH 3O2VH 2OZ4A 1SEQH 5TE6H 4YHPA 4EDXB 1R5IB 2QQKH 3AROA 1LD9A 1BZ9A 1TQCB 2EC8A 3L6FB 2I60L 3RTQD 2UZYB 3MBEB 4UIKL 4Y16B 2WWKT 5F7YC 1J05B 5DD3H 5F9WC 4LKCA 3T4AA 3B5HA 5IBUB 4LLQB 2UY7A 4RGNC 4QXWA 3FQWB 4XAKD 1ZGLP 1LO0L 4JHBA 4JEGB 4W6WB 4OJFH 1R5VA 1T2JA 3NCYP 3ZT5A 1KJ2B 3VCLA 5I73B 1CGYA 5H8DA 1X4ZA 4EZMA 3KDMA 3L5WB 4E5XB 3MCLH 2GCYA 5JO5B 4M6NH 5T1KD 3VD3A 3H9ZA 1GRWA 1G9MC 3KHQA 1OB1A 1E28A 3SKOA 1Q0XH 2VDLH 3KPRE 3LQZB 3QUYC 4K3GA 5FA4B 4MB3A 3IDMA 2EYRB 3DUSB 3SCMC 4QO1A 1NSNH 4AH2A 3TNMB 3MYJB 1EO7A 4OBSA 1WIPA 4E0RB 3L1OL 4S1DC 2P24A 3A67L 2HJLA 3FB7A 4YDLC 1IL1A 4K8RL 1QSEB 4ENEC 1BQLH 5HHVL 2E9JA 3RAJH 1JZ6A 3HB3C 1R3IH 2VLRB 1N0XH 4L4TD 4OI7A 1CLYH 1T0NB 1SY6A 3HMWH 2OM5A 3OMZA 3AXLB 5I1EH 2JB5H 3VXQA 5I8CA 3O9WC 2QQNH 3C09B 2MWCA 3GNMH 3V7MA 3HCVB 4MZ2A 4R26L 3WUZA 1FP5A 4MJ6B 2FX7L 3QA3B 4PJCF 2WBJA 4HF5H 5I1AB 1DQJA 3IYLW 4TULL 5ADOL 4L3CB 1H8SA 4X6BB 1IGML 1P4LA 2BRRL 5HHQA 2XKNA 3DX6A 3O45B 4L9LC 1B0WA 2F5BL 4NM4L 5EOTA 4BK4A 3IFNL 2OMNA 4PRBA 5IVXF 4GAFB 4L9DA 3RGVC 2NYYD 5I1IH 4KTDH 2YC1B 2X4PA 1A6UL 5FFLA 3QUMH 4WW1A 3F58L 3ECBA 3NFSL 5IMMB 2ICCA 3D2UB 1OAYH 2OTWA 4JRYA 4JRYE 1X5HA 4QT5A 1A7NL 2EIBA 4Y4FA 4LKXB 3FJTA 1IC7L 1XH3B 2ZCLL 3D3VB 2C1PA 4PGCA 5EZOH 1G7QA 2VDQL 1O7SA 4Y1AD 5ID0A 3B9DA 2KKQA 3FB6A 5HHME 2O61B 1WLHA 2EDFA 1EXUA 4KFZC 4C56A 5C7XL 4MWFB 4K7PY 2FH8A 4Z7UA 1HINH 3V4VL 1BIIA 1MCWW 1WWBX 1FVDA 3O0RL 3PGFH 4R7DB 5TDPB 4QY8A 4R2GB 1Z9LA 4UAOB 2PYFA 3FO0L 2K1MA 3Q5TA 1UB5A 1FL3A 4DGVL 4OQ1A 4M1GL 4P9HH 1KJ3L 1FLRH 2B0SH 4OD3H 3FO1B 2ZSVA 1QNZH 2W9LA 3M17B 2MPAL 3MRBB 4DZ8B 1JWMA 1BVKA 4FHBD 4XNZB 1EPFA 3INUL 3V6OC 5FYLE 4FQXD 5DUBA 4Y5VC 4DGIL 4U1GC 5JHDB 4GRLA 2EYTA 5EZIL 3L7FB 4YUEL 4E41D 5I1GH 5L2KB 3O3DB 2EEDA 1QRNA 4O2CB 5HYSG 4AENA 5JNYB 2EIDA 2R56L 1E0OB 3L5XL 5FCUH 3VRLE 4X6CA 3UO1H 3QEGH 4JPIA 1XIWB 4LHUD 1K4DA 2X05A 4HWZB 5DLMH 3FFCD 5IJKC 5C8JA 2YPLB 5J89A 3Q5OA 3M45A 5CSBA 2GTWA 2PNDA 1T83A 2XWBA 1FH5L 4UINH 3HG1E 3FRPG 5GISL 5DS8B 3P9MA 2CK0L 4HLZH 2HJFB 3GEWB 4MNGE 2X4SB 3PF2A 4K2UH 1CI5A 5CJ5A 1FFQA 5E6ZA 4I3SL 2HRPL 2JLLA 5ITFB 4OGAD 2WM0A 1RULH 4M7LL 2JF1A 1Q9OA 3QRGL 4GQ9H 1JHTB 1I1FB 1KLGB 4M4PA 1TENA 4YHIA 2KPNA 3CMGA 3C2AL 1KTLB 4O51B 1U0QA 5J4MA 3PV7A 2PO6D 3MLWH 1UH4A 2X42A 3B8YA 1KTKE 1PKOA 3FQNB 1S9VA 1MIML 4P4RB 2IPTL 5EOCJ 4QHNA 1KG0A 1VEOA 2VLMD 2W0FB 2PXYC 1J8HB 4Y4HA 1XGQA 3VFGL 1KGCE 1MHCB 2XPGB 4A6YH 3IFPA 3LOWA 5D5MF 2J8UF 1NFDB 3VXSE 2WK2A 3BZ4A 2H26B 4XBGB 3DARA 4HXAH 3UYRL 3C5JA 3N85L 1XGYL 5DJCA 1HEZB 4HCRH 3TJHD 1HN1A 3WBDA 1NAMB 3TH3T 5FGBC 4JFDE 1NDMB 4ODTL 1TZIB 5EZLA 4IMKA 3EOTH 2UZIL 2H8PB 5DA4A 3MFFA 4N0RA 4OLVL 2XKSA 2IAMC 4QCIA 1ZWIB 2R4RL 4P23C 4LAQL 4PREA 3GSRA 5LGHH 4WFHD 1HYRC 4TQEH 4O4YL 5D6DC 1KXVC 4NO5B 4PRHB 1G6VK 1F3JB 1UXSB 3EJZD 1LEKA 3IDGB 3GMRB 5EU4A 4P2OC 3BQUB 3V7AE 4HHAA 4EI5B 4I3GA 3GMMB 5JHLH 2RGSA 4JN1L 3OKDA 4XBEH 1HHKB 4GAGL 1TNMA 3IDXL 2Z31D 3KJ6H 2CLVB 3QG6B 1M7XA 4Y8DC 5D1XA 5I2IB 4PJHA 4PJHE 5C0GA 4GXUM 5DJZB 1TPXB 3OGCB 4D8PA 1C8PA 3IDYC 2YA0A 3HI1A 4XMKH 2P49B 3N1PC 4POZD 5IBLD 1DEEA 3RJDA 1N6VA 4UQ2B 2VH5H 2GJZA 4YFLF 1H0DA 4LVHC 2X1PA 4P2RE 4URTB 3HMXL 5F96H 1T20B 3V6FB 1YNTA 3VE0A 4KHTH 5EORL 1TQBB 5GGUA 2EEBA 1KPUA 2VDKH 15C8L 1F58L 4PRIA 4WO4A 3QDME 4PJIE 1DUZA 3PWPE 2VMFA 1A7OL 5GRVL 4OAWA 1YY8B 1YEGH 3MRJA 2CKNA 3IXAB 2XZQL 1INEH 4PTTA 1NC2D 3LPWA 1K8IA 1MRCH 2DF3A 5CUSH 25C8L 4RWYH 1V7NH 3VU2A 2XQBL 3GB7B 3G08B 1RY7B 2NXYC 1KELL 3CFIC 4LLMA 5AG8A 2P5ED 5IESH 3TYGH 3T0EB 4UDTA 5CJXC 4WV1A 3AB0C 5C0FB 1UA6H 1GZPB 3VD9A 5IB5A 1ZK9A 4HS6A 2O5XL 1MCRA 4X9FA 1GYAA 4P2QB 4P9MH 3RPKA 2PW1B 1AY1H 4MX7B 4QYOA 5JA8B 2QR0B 3KXFB 2AQ1A 2YD2A 1TDQA 2PW2A 2EDQA 1MAJA 5HHOB 3EYOA 2IPUK 3LKRA 4DN3L 2DWEA 4NRYB 1T66D 1VACA 2BOBA 3DECA 4RISH 1RZFL 4KDTC 3ZE0F 2IG2H 4XNXH 2CDFB 5TF1H 3NPZB 4FXGA 2HLFC 4F8TA 1LILA 3QIUD 4NQDB 3M07A 5MEOA 1NCWH 1JV5B 2H45A 3U79A 2EH7H 1MHPL 3WS6A 1A7QH 2R1XA 5I76B 4OGXL 2AXGB 2Y36H 3QQ3A 1U8QB 3RQ3A 2XV6B 4CVZA 4M7LT 1OAZH 4F2MA 1ZSDB 1RIVL 1BAFH 1NGPL 2M8XA 3BEVB 3U83A 4G7YL 3MUZ1 5D7JD 3UZEA 2Y06L 4OZGB 4YHZL 3OXRB 2C1OA 1WCQA 1JPFB 3MRIB 1YQ2A 1A14H 2V5MA 3FAXA 4N0CD 4B0MM 4K9EL 3L7EA 5IW6B 5IHZA 5ID1A 5B39A 1MJ7L 2EYSA 2GK0A 1FZKA 4JY5L 2EC9U 5C0IB 3O3AA 1AHWC 4LPYA 3HAEG 3V4UL 1ZLSL 1HZHH 3MJ7B 4YGAB 2B2XL 1BD2D 4XP1H 1JZ3A 3DETC 2GTZA 3R1GH 2DMKA 4HS8L 2KQMA 5JZ7D 4P59H 2MQ3A 3P73A 5B8CB 5FGCB 3KLAA 4C54A 2ZNWA 2RCSH 3JXAA 4Q2ZB 1CE1H 2VAAA 5C1MB 4FG6D 4OCYH 4FXLA 2XXMB 4JG0L 3DTXA 2YA1A 3FOLB 5T3ZL 5EBLA 4F58L 3JWOL 5HYIA 2HA1A 1NCDH 4JQVA 3KPLA 4NP4L 5EA0L 4LSUH 3RVTC 4YBQC 2X41A 2XWTA 5FYJH 1IM9B 1P7KA 5GGSA 5FHAH 5BRZD 3QUXA 1U8NB 2DQDH 1VEPA 2HVKA 4YZFF 3WDJA 4JRXA 4NM8L 1JZ7A 4CAGA 2E7MA 5DR5L 1AD9A 5JDJA 3PJSA 4MQXD 2DD8L 5LVEA 5F7WC 5HSFA 1HK6A 4KMTH 4R90H 5IHUH 1UH3A 3D85B 3P11L 2E7BA 4H88L 1KTRL 3CSYB 1OLZA 1NQBA 4L3EA 4U7SA 2OZ4L 5C09D 2RQ8A 1JHKL 4X6EB 4YHNB 2BCKA 1I9RH 4LIQL 2CGRL 3C60C 2J8OA 4Q9RL 1INQA 3ARRA 1YEKL 2VLKB 3BIAX 5C0AB 5CEZD 1F45A 1D5BA 1HQRA 4N9GB 4P3CH 2Y23A 1ZTXL 4FQ2H 4HWUA 3QJFB 4IM8A 3JV6A 5KVDH 3RIFK 2LU7A 4WTWA 3ZKQD 3IDUA 5GRXG 1LE5B 5D7LA 2BHZA 5D7LE 1WZ1H 4TSBL 4LRIC 5IFAH 5JPNA 5HGHA 1J5OL 3MXWH 4QRRD 4RGND 4LRNH 5E5MB 4FTVE 1F4WH 2DWDA 1RJZA 1AXTL 5DI8B 2QEJA 4U1NB 2OL3A 2CIKB 2OK0H 4NQVB 3RWFB 3ZDZF 3MV8B 1JE6A 5IT2H 4YE4H 1TQCC 3MLYH 1K6QL 3MBEC 5ECJE 4ZQKA 1U91B 4Y16C 4YQXL 1LK2A 1WWCA 1L7IL 2UZXB 1AGDA 2YMXH 3PGDA 3HZKA 2ZP0T 3O4LB 3KNBB 1Z2KA 3VRJA 2ZCKH 4YNYA 2BNQD 4M6OL 1JPTH 1SY6L 2AGJL 2C3VA 3WN5B 2QADD 4KK6C 1ORQA 5T1LB 1DE4A 4HK3N 4XT1C 5EWIH 3LN4A 5IVOA 5I73C 1P4IH 5FA3A 4YIQB 3CX2A 4LHQB 4S1SL 2GJ6B 1RMFH 2VKWA 3GDBA 1Q9LB 4K23L 5KS9F 4JFHD 3RX7A 4NO0A 1HXMB 4Z5RA 3NCJH 3DUHA 1MEXH 2DB8A 1U3HB 5T3XE 2H32B 4Z77B 3M8OL 3SDAD 5FK9B 2FEDD 4WGVB 4PJDE 2Q7YA 3MC0A 3HKFA 4IOFC 2CQVA 5FOBA 4OLUH 4G80B 4LARL 4YDVA 1S7RA 1BWMA 3GSXA 1DL7L 4FOMA 4ACPA 4RSVA 5C3LD 2LTQB 2ARJA 1NANH 4U1SA 3SO5A 1L6ZA 4NO2B 3RUGE 3D9AH 4ODXB 3ZT7A 3U9PL 5IB2B 1RZIA 3Q6GL 1RUQL 5FB8A 3LIZL 4NWUH 3VDBA 4N8VG 1YNKL 1KIRB 2FATL 3VXRA 1W2KT 2DQEL 1JGLH 1WFTA 2J3SA 3MZGB 5E2VH 5E99L 3NTCL 4JQXA 4JHAL 3SDDC 4GKZA 3IRZA 5DMIH 2R0LL 2JJWA 3D69A 2UYLA 4LNVA 4J3XA 4UILL 4WDIA 4WEBL 1IAMA 1QLFB 4Z18A 5DJYB 5FIEA 1UZ8A 4KRPD 5GSVB 5KAQF 5EOCH 3GK8H 2ZSWB 4TRPL 4JM4H 3AS2A 3WKMH 2FL5B 1S5IL 1LMKA 3IDIB 1KB9J 4G43B 4ZSOA 2NQCA 4ZSOE 2DDQL 1WZKA 3DVNA 2D4FA 5JW5A 1PW3A 1Q0YL 2QQLL 4QWWD 2F74B 4LVEA 5CWSA 1Y0LA 3V52L 1CWVA 4ONGL 2NW2B 3BISA 4GW1B 1D3CA 1PG7L 3BP4A 3P9LB 1DBJH 4OZHE 4LDLB 5DJAB 3U30B 4BK5A 1ZT1A 5CZXD 4ZUUA 2A38A 5CD3B 4Y2DA 4PJFB 2B4CL 4FQ1H 4UAOC 1JMZA 3CFBB 1N4XL 4U7KA 3SE8H 5DC0A 3EKCA 4GG6B 1QQDA 4K3DH 1AKJA 1NJ9B 4MB5A 1KJMA 4LSTH 4TSCL 4AQ1B 3K1DA 3GO1H 4R4NC 1JZ2A 4G3YL 5I66B 2EE3A 2ZOKB 4PJEF 3QDAA 2NTSP 1XGRA 4X9HA 5C0RL 3EBAA 3KYKL 1OPGH 4KZEH 1JNLH 5E7BA 1WBXB 3AREB 5JR1L 4XNYL 4MCYB 5DJ6B 1T0MA 4MAYD 2OJZH 1FVEA 3CLEH 1ZLWH 2ZUVA 2ID5A 4YEFA 4XNZC 2JJTC 1EGJH 1D5XB 3HC0B 3CC5A 1GGCH 3HZMB 4OZFG 4X4XB 4XPTH 5K9QG 2ADFH 3LD8B 3NZ8B 4ONHB 2VSCA 4N0FB 4JFPB 4KJWC 1WAAF 4FP8L 5ERWB 4XCYB 1JGEA 4UNTA 4HG4K 4OF8A 4OZ4B 1A3LL 1QYGL 4OLXH 1PG7X 4FQLL 1HE7A 3G5YA 2DQGL 1KN2H 3MFGB 4OCLC 3T77B 4PD4K 3GRWH 4OIBA 1N0LA 3ARFC 3TPUB 1Z6JT 4Z7OF 5HYSA 1E4KA 2VIRB 2ADGB 1X5KA 5BZWB 4QTIL 3IT8D 4P5TC 3HN3A 3EO9H 4LDEB 3OB0H 5EZJA 3G6JF 1BWWA 4U1KB 4JFFB 3TFKD 3OKMA 1R3HA 1MFNA 1D5ZA 3VFWA 4DK3A 3VXMD 4JGMA 1OW0C 4MNQA 3FRPA 1RK0B 4ZO6A 1FNEB 4M00A 4UT9L 3VGAC 1FL6B 1AGFA 3CVIL 3RHWF 2P7TB 4Q7DA 3MROA 1X9QA 2E7CA 2FB4H 3DRTA 3PWUB 4ZO9A 3VXOA 1ZEAH 3JUZA 3BWAB 3PL6D 3BAEL 3MLVL 1RZGA 1EDQA 3BSZL 3PGCA 3S96B 3NIDF 1G9NL 4GS7C 2F9BT 2VABB 3QEUA 5K59E 5EO1B 5I17A 1R0AL 2BFVL 5F9OL 5IUSA 1YN7A 2N1KA 2WWMD 4BM7A 4PLJD 2G5BA 3ULUE 2JCCA 2M2DA 1AI1L 3BN9D 3MA7A 5EBWB 4YFLI 2CPCA 4LAJH 1ODAA 4APQB 4LGSB 1WK0A 4XI5D 5GGVH 4MD0B 4M8QA 3UJIL 5I15L 2EIZB 2PF6A 2MMXA 1UEYA 3T1FA 1NDGB 2XWJA 3NH7H 2A6DA 2BNRD 3C8KB 1MI5D 5T1MB 1I8LC 2WLYA 3QPXH 1AQDA 5IG7A 3MCKA 4PBVC 4F7MB 4J4PC 1JF1B 2WUCL 3MRNA 4EKXA 2FH6A 2WBWB 3DHMA 4XZUA 5LCVL 3QPQC 4HUWA 1XR8A 3EFFA 3BZFB 4X99B 2FIKA 4P46D 3Q0HA 4Z78A 4JLRB 2YA2A 5J8OA 3EO0A 1T1WB 1DFBL 5EU6B 4TUKH 2R2CA 4YXHL 5A43C 4EJ1C 3TBYA 1Q94B 4PB9H 5GRUL 2G9HA 4EI5C 5GS2D 4R7NA 1A2YA 4LCWB 4PJCA 4CW1A 4YXLH 1WFNA 3OF6A 3PWVB 4WUUD 5DQ9B 5FXCH 1N6QH 3BDXA 2WIIA 2DOCA 3VFUA 1N7MH 4BFIA 1TPXC 2J6EA 2P1YA 4H1LH 4R4BA 3VWKD 4G6KH 4WI6A 3MV11 4J3UA 4JO3L 1VERA 5IVXA 4OM1H 5GHWL 5I8OL 2BVOB 5D2LE 4YR6B 2DMCA 2MFNA 3KWWB 1FJ1B 5DGRA 5IVZA 1P2CA 5DJDB 1I1AA 4XX1G 3MV7A 1QPXA 4P49A 4HV8B 4N0YH 1IGTA 4PJAB 2APBA 4PPTA 5HXMA 1CDBA 3PDOB 1SBSL 4LCYA 4OD1H 3AM8A 5FYKE 3ET9F 2AK4D 3QULA 3MGAA 3OQ3B 3OKEB 5TDNA 3MRGB 2Q76B 1RSFA 1F4XL 3TF7C 4BSJA 1AD0A 5JXAL 3MMEA 4ODUA 1U58A 4HJJH 5LXGL 4W6YB 4NC0B 1ZT4A 4G6MH 4QOKB 1MQKH 2W9EH 3O6LH 1EK3A 4ZO8A 5TGBA 4OF0A 3CXDL 2X89D 5KVEL 4R6UA 3EZJB 5IGXH 4PP1C 4JKPL 3S3PA 4PUBH 1GPOL 2ADIB 5HVFB 3M1BA 1IQWH 4U31A 1T1ZA 3UTSB 3LY6A 3MX0A 5KG9B 5C0ND 4NN6B 3QH3A 2HKFL 3U6RB 3VG9C 1DQDL 1A6AB 2DN7A 1A5FL 3LDBB 5J12B 5J57B 1R6VA 5EBMB 1FYTD 1RZJH 1OGTB 2O26U 3AU1A 1S5HB 4MVBC 3MA9H 1UKSA 3TBVB 4HFWB 3U48A 2G2RA 3ZLQC 5HPMB 3FN3A 1ZKAA 1WBZA 3WFDL 5CD5C 5HDBF 1J0HA 3GI9L 3FO2A 3ISWA 3VI3E 3MLRL 1A7PH 2IFFL 5E00B 3AAZB 1KIUA 1YMMA 3QFJD 1OTSD 1MCOL 4MA7H 1Y18B 1GHFL 1BX2B 3CFJA 5ICYB 2FRGP 3FL7A 4GKOA 1NBVH 2AV1A 4P4KB 1FO0H 3WFEH 2V2XA 1RURL 3C5ZB 4NNPH 5ILTH 2X10A 3NGBC 4DTGH 3MNZA 4YHOL 3UJTL 4CNIA 2AXHA 2XFXB 4F33B 4XPAL 5DQDH 3G9VA 1IEBB 2C7UB 2CKBH 2CRZA 3QXVA 4QRUB 4LCCA 2F15A 5MI0C 4XC3L 1I8MB 2CMRH 2R9HC 1RVFH 2XXCB 2QSCL 2HFGH 2WZPD 4CUCA 4RFOL 3LSOB 3ULVH 5C0CB 5EC2A 2JK5B 3BUYB 1EIBA 1QHOA 3TO4C 1CXIA 2AJZA 2J5LC 4JB9L 2GJJA 4ZD3L 4PGJA 5BCAA 5F7UA 1DP0A 2COQA 1JFQL 4R0LC 1D9KD 2OR9L 4KK8D 1NLDH 1CDCA 5K9QI 3MRCA 4S0TD 1IZKA 3KPPB 4R97B 1QBLL 4R96B 1EHNA 1I3GH 1KJVA 3CX5K 3S35L 5CSZA 5D5MA 2J8UA 4BKLA 2NPLX 4Y89A 5E9DE 1RUPH 4JQIH 5B22A 1EEYB 3D0LB 3VXUB 3NAAL 3CLFL 2W9DL 2ICEB 3QUMA 3R0NA 3QAZB 1U8KB 3FHQA 5D7IE 2R29L 2NY4B 5DVLA 3B83A 2L4OA 4I0PD 1AR1D 2X1WL 3QUYA 2BJML 4QHLA 5IR1B 4G9DB 1DQLH 1Q9WB 3CK0H 4PS4L 4PYHA 5F70A 1UWXK 4EN3C 5T5FH 4LBEB 3VXTA 1HYSD 4YEEA 5L6YH 2R2HA 4RDQF 2FYYB 4Z7NF 1JMXA 3DUUB 1UM6L 4KUCF 5FHBL 1ZGLM 2JIXD 1KEML 3PHQA 1AE6L 1X44A 1IAOB 3DBXB 3U0PA 3WXWL 3IKKA 3VA2C 5H2BB 1OARH 2YRLA 4H0GA 5HDLA 4HUXA 4WJ5A 1I3RA 1RIUL 2ZWLT 4HIHB 3CAFA 4YHLH 4PG9A 4ALAH 3WFHA 2DKMA 3O9WA 5CILH 3RU8H 5E6YA 4DKDC 3C08L 4YHPB 5KANG 1LD9B 1BZ9B 4JKWA 3I85A 3NACH 5DA0B 3DV6A 5I8KL 3LZFL 3RY5A 3QDGE 5D71L 1WJ3A 4J7RA 3P0YL 1P84K 4FQQA 2RFXA 4XVUD 4LKCB 4TNWK 3T4AB 1C5DA 1GGUA 5KBNC 4LF3A 4CBPA 3BT2L 1H3VA 3RZCD 2BSSA 1R5VB 1U3JA 4UT6H 3UTQA 4LLYA 3VCLB 5HDOA 5AYUL 2QV2A 3KDMB 2GCYB 5CEZH 1OB1B 5E08L 3QNZA 1IC1A 4KK9D 4PRPA 1E28B 5CJQH 3SKOB 3SQBA 5C6PB 5C6TL 5SWSE 1KOAA 3IDMB 4ODVH 4G8FA 3VA6A 5C6WH 4KI5E 4AH2B 4H20H 4P48A 2A2QT 4I13B 8FABA 2P24B 1BECA 2AJ3A 2HJLB 4S1RL 2AK1H 3FB7B 1IL1B 1R24A 3GIZL 4NN5B 3PNWA 3WN5C 3O2WL 1YPZF 2LVCA 2EXWC 3MNVA 5GGQL 4ERSL 1QSED 4S11A 1X7QA 2MNUA 4DKAA 2YD6A 1TNNA 5GJSH 1J7VR 3HNVH 5J1SC 3VXQB 5I8CB 3S34L 4ISVA 3B2UC 1U3HC 3UTZA 4NQXA 5IROC 2WBJB 3MODL 4HUUA 3QHFL 4KKCC 1DQJB 1IGIL 3OR6B 4JHZA 1FORH 1CU4H 3P9WB 3SDXE 4Q6YA 4X7FC 1P4LB 5HHQB 3V6OA 1U8LA 2XKNB 3DX6B 4WI3A 2P42B 1KC5H 3A6BL 5EOTB 4XP9H 5JW4Q 4PRBB 4BZ2L 4K8RC 5DURB 3V8CA 5DUML 2X4PB 3KR3L 3RKDC 2MJWA 2NY2D 5C07A 4WW1B 1MSPA 3ECBB 1C16A 4JRYB 2LTQC 2OTWB 1U8PA 3MLZL 1KCRL 4Y19A 4QT5B 4NKOA 5IJKA 4Y4FB 1AGBA 4LVOB 1MCIA 4LPXA 2H6PA 4WHYG 2C1PB 4NYLA 4PGCB 1G7QB 4PJ7F 2I27N 5ID0B 3FB6B 5AWNL 3UMTA 1EXUB 4D3CH 3DGGA 3S5LG 3TN0D 4C56B 3ABZA 4PFEA 4JKKA 1WICA 1AO7E 4Z7UB 3K81A 2K9UA 5TE7H 1BIIB 1FVDB 5KN5A 1HI6A 1MUJA 4N8VA 4QY8B 2JELL 4H1LG 4OZGF 1CICC 2EDYA 2PYFB 1KACB 2WW8A 1UB5B 3TT3L 1FL3B 3Q48A 1FNFA 2BSRA 4R2GD 1LP9E 1JI2A 4KK5D 2G75A 2F53A 4ZTPL 1I1CA 3B4NA 3ZDYE 1MCSA 2F53E 4M5ZH 3D1MC 3RI5K 3TYFA 3MLUL 3RWEA 2OJEA 2ZSVB 4AEEA 4LEOA 1WGOA 2CO7B 1ZLUK 1IBGH 1JWMB 2LAGB 1BVKB 3FRUA 3QG7L 1RUKL 3DXAE 4XP5H 5GS3A 3NA4A 2E9BA 2PXYA 5GS0D 2EE2A 5DUBB 4WI7A 1GOGA 4RDQG 5CAYB 4GRLB 2EYTB 2VISA 4M7JL 4PP2A 1QRNB 5JHDD 2XRAH 1QO3A 2H2PC 4QRSA 4AENB 3ZHLA 4RRPG 4X6CB 1K3IA 5HYFA 4JPIB 1K4DB 1WT5C 1K2DA 5AD0A 5C8JB 2VN7A 1XIWD 2HTKD 3AREC 2GTWB 5FGBA 2AJYH 2EE6A 4JVUA 2XWBB 1NGYA 1YEDA 2YPLD 5KSAC 5HYJA 5MHSE 4HFUH 4PJ9D 4GRWF 1UM5L 3NABH 2IBBA 1P9MC 1GGIH 5H37H 3VDCA 1PDKA 2B8OT 2VXQL 2IAMA 3LD8C 1GAFH 2NTFA 3K8LA 1EV2E 5EFIA 3V0WL 5L0QB 5HGGS 3V4PH 3I3BA 4P2OA 1Q9OB 3FT3A 4G8GA 4G8GE 4JFEE 4DW2L 1RFDH 1U92A 1S7UA 3QQ9D 4YHIB 2PCPB 2YN5A 1NMCB 3KYOA 5JW3H 3JWDC 1CDHA 1N59A 4JHWH 4XWOC 1S9VB 3L3JA 4HUMB 4QHNB 1KG0B 2DRUA 3HG1D 2BK8A 3FQRA 1N3NA 2BY0A 4Y4HB 1XGQB 2A83B 4L5FH 4M7KH 3SKNA 4KQ4L 5HGDA 4GXVL 5CFHA 1UENA 4XCNA 4WI2A 2BVYA 3MV9A 5MENE 1J8HD 3IFPB 4MA1B 3PIQA 4OF3A 3SOBH 3BZ4B 4HBQA 3D0VA 3C5JB 4OB5L 1QOKA 5DJCB 1JWSA 5KSUA 5JW4N 5B21A 3HC3H 4UBDC 2VXSL 2R2EA 3ZHKA 1I1YA 1J1XL 1WTLA 4ELME 1P7QD 5EZLB 4IRJA 3EHBD 1QPPA 4EOWH 3MFFB 3D87B 4LSDA 4QCIB 5TF0A 1UJ3A 3QCUL 3WD5L 4PJGF 4PREB 3GSRB 4YC2B 1U8JA 4LEXL 5KS9A 2GY5A 1LEKB 5KANI 1FZOA 5GRVK 1KGCD 2NR6C 5DRWA 5EU4B 4PRHD 1H3PL 5FGSA 4HHAB 2J6EL 5LWYL 4QTHA 4X6DF 4OLYL 3T2NH 3OHXA 3BQUD 4TUJA 4UV4L 1NCAL 5CLWA 1BBDH 3OKDB 1NFIA 4CRPA 5D1XB 4WWID 1DTUA 4PJHB 1FGVH 5C0GB 1NAKL 4MXQD 3UX9B 3MRDA 3ARUA 1VDGA 4D8PB 4G6AC 5IFHL 3OKYA 4JFDD 3H42L 1KENH 3ZMRA 2NX5A 3HI1B 3NN8A 3RVWD 2ZPKL 4WCYL 3OJVC 1WITA 5IMLA 5J11B 4OKDA 4V1DD 1WTGT 4O02H 2DIBA 2HMID 1DEEB 5E56A 3WNOA 1EEUA 3TV3L 2XQYG 1GGBL 2GJZB 1H0DB 3X14A 3A0OA 4I77H 4P2RB 4DWHA 4KKLD 1JF5A 2OSLA 1YNTB 1FNSH 4MJ2A 4AM0B 5FYJE 3VE0B 1S8DA 2GUOA 3L3HA 3EYSH 3VGHA 5GGUB 1KPUB 3AMKA 3E0GA 1FFPA 5DRXA 1DQTA 2DQUL 3N9GL 3FQXA 4PRIB 4WO4B 5BVJA 3PUCA 5BQ7A 1LO2L 5SX4H 1DUZB 1HXYA 2A6KA 1EO8L 5GS2H 4OAWB 4NT6A 2R23A 4XCCL 1F4YL 3HTLX 3MRJB 4MJIE 1G7MA 4I4WA 3SKMA 1SEQL 4PTTB 4I48A 3V79C 2QHLA 5IQ9A 2QQKL 5BXFA 3ILQC 1BJ8A 1FPTH 1MLBA 4LLMB 1E4XI 1G7JA 1AHWA 4K94H 4UDTB 4WV1B 2FR4A 3PQYE 1MPAH 1LNUA 4FMFA 5IB5B 3QEQA 4HS6B 3H3PH 3T0ED 3WLBA 1UM4H 3EYFA 4W4NA 3SGEH 4JO4H 1U9KA 2A1WH 1QVOA 4LHJB 1AJ7H 4QYOB 4HK3J 3NIFF 4R3SA 2IMMA 3MCLL 5LQBH 4WI9A 4D0DA 3QDMD 1UACL 2Q3AA 2PW2B 2ITDA 3EYOB 3LKRB 2DWEB 1YEJL 5J6HA 3KXFD 2MHAA 1VACB 4K7FA 1ZXQA 1ZVSA 2BOBB 4PJEA 1J11A 1BLNA 2YK1H 1PAMA 1WUNT 4U3CA 4PJFF 1U8IA 3VGBA 3RVUD 1AP2A 1M4KA 2E6QA 4FXGB 2IPKA 4GG6F 4NN6C 1Z3GH 5HI3C 5MEOB 3I2CH 2JJUA 1D6VH 2V6HA 5HI5D 3C6LD 4NQDD 1IQDA 1OTUC 2R1XB 1BQLL 4JM2D 3RAJL 5TPWH 4ZAKD 5M7QA 3QQ3B 1N5AA 5F7EL 2F54A 1IKFH 2F54E 3E2HB 4CVZB 4F2MB 4OLZH 4OUOA 1EMTL 1WAAA 1CLYL 4KKAD 3HMWL 2DQTH 4NHCH 3DMMC 4HWEH 2Q8AL 2NY3C 3MRLA 4JO1H 4F9LC 2C1OB 4DZBA 4PY8I 2QQNL 1T80A 3L7EB 4XGZA 5IHZB 5ID1B 3RTQA 3TIDA 5B39B 3E8UH 2EYSB 2GK0B 1FZKB 3O3AB 3OZ9H 4LPUA 2FLBT 4PB0H 3G6JA 4HG4J 1T03L 2LFGA 4XAKE 2D0FA 1ACYL 2GTZB 1QKZH 2DLIA 2IWGA 3P73B 4GMTL 1SVZA 1T21A 4PD4J 3QUML 3MACL 3KLAB 5E1AA 5T1KA 4MXWH 3IJHA 4LRIA 4ZXBC 2VAAB 3C8DA 5DEFA 2Y4SA 1G9ML 3K2MC 1NBZA 1OM3H 4M7ZB 3DTXB 1S9WA 5EBLB 3NIGF 1CTNA 2VXVH 1FCGA 1K85A 3C9NA 3KPLB 1PX4A 2ICES 3U4AA 3F7YA 3HUJE 2XTJC 4AL8L 1YC7A 4HPOL 4K9EC 2XWTB 1P7KB 3SKJH 5GGSB 3MBEA 2EO9A 4PJ8D 3QUXB 1TCRA 2HVKB 3PGFL 2ENYA 4JRXB 1JI1A 2PTTA 5LBSL 1AD9B 3FQWA 4L4TE 3PJSB 1B6UA 5FDWA 5TDOA 1FVCA 1T7WA 1Y6NR 4RFNB 3B9EA 1TITA 1IFHL 4OCSH 3QAZC 4L3EB 3KPMA 4LLVA 1FLRL 2B0SL 4OD3L 1GL4B 5F7HA 3V2AR 3VFTA 2BCKB 3LEYL 3VFRA 2R8SH 3W0WA 3S4SG 4TVPH 2Y7QA 1REIA 2E9WA 3S6CA 4JFZH 2HJKA 1D5BB 1HQRB 3LEVL 3BKCH 3FQTA 3JV6B 5C0AD 5HVWA 1A6TA 1HHHA 4WU5A 4YJZL 4CDHA 2A0LD 5D7LB 3PG2A 5JPNB 1DVFC 1WZLA 5HGHB 4M6MH 1EJOH 4Y1AA 2DWDB 4X6FA 1RJZB 1X4XA 1DBKH 2OL3B 2O5YH 2VDPL 2AJVL 3WNKA 3O4OC 2OYPA 4G6JL 3P30H 4IEFB 1S7WA 4WEMB 5KSBA 1HSAA 5D1QC 5KSBE 1G6RH 3RZWA 4K2UL 4ZQKB 1LK2B 3EJYD 3PGDB 2DQJL 1AGDB 4I3RH 3HZKB 1QBBA 5LAXA 5E5UB 4XB7A 3SDDA 2Z35A 3VRJB 1RULL 4YNYB 4OSUL 1E27A 3K4AA 2R4SL 2C3VB 3PDGA 1ORQB 3O6KH 4GQ9L 3K46A 1DE4B 4D9QE 3LN4B 3GKZA 4YDIH 5FA3B 5IMMA 1RJLA 5TQ0H 2AXFA 5T1LD 1RK1A 1LDPH 2R1WA 1CK0H 4EDWH 4PJAF 4X4ME 2DI7A 3MLWL 3N0PB 5KVFH 2GJ6D 3GRWA 2IANA 4NO0B 2X1XR 5KOMC 5DYOA 4XVSH 4Z5RB 3BZEA 2XN9A 2VO5A 1CLCA 2PYEA 3BPNB 3TBSA 4E41E 5L2JA 3DPBA 4TOYH 2GY7B 4HULB 4NN5C 2Y5EA 2Q7YB 1MFEL 1DANT 2YUVA 3O81A 4NQCA 1KJ2H 4YBLB 2VDRH 5FOBB 3FFCA 1CGUA 4HKZA 4YDVB 1S7RB 3GSXB 1EFXA 2ZG3A 4X0KA 4NC1E 4K8RD 5DD0H 5DK2A 1W0VB 5DO2C 3TWCL 1H5BC 1RZIB 4PBXA 5FB8B 4Y4KD 4N1EA 5TJWK 3VXRB 1IAIH 1S78C 5HBBA 5LGHL 2V9RA 1IZJA 4TQEL 5J7CC 4OIIH 4Z76A 5T3XD 5E8EA 4GKZB 2DQFA 4XMLL 3D69B 3FO9A 3QXDA 4QXGH 5KSVA 4MXVF 5D72L 5IMOA 4WDIB 3N1QC 5DF0A 5C0JA 3FFDA 1QRKA 1UZ8B 4NUGH 2PO6A 3BUTA 3UTTE 5K9OA 4FZ8H 1PY4A 3WLWC 4LVOC 3GHEH 4ZSOB 3ARFA 3QB7C 3DVNB 1E4WH 5JW5B 2VLME 4YFEA 5DS8A 4C59B 1B2WL 5CWSB 4XMKL 2HN7A 2R69L 2NY5C 1Y0LB 3BE1H 4P5TA 3NCCB 1T2QH 1YEHL 4FFZL 4OCWL 3BP4B 2ERJB 4KC3B 4NQEA 1ZT1B 4ZUUB 3V5HA 5IFJA 3HHRB 4Y2DB 3ZKXC 4LCIL 1UJTA 1QQDB 4ZS6C 1AKJB 5I71C 1KJMB 3S5LA 1J12A 3O3UN 1GSMA 4IDJL 3L5JA 2VDKL 1NEUA 2AEQL 1XGRB 4Q6IC 3S36H 2GK2A 5KJRH 3BYTA 3JVGC 1FIEA 3DYMA 1YNLL 1MIEH 4H1LA 4N5UA 5GRYA 3JV0A 1T0MB 1FVEB 1YEGL 4WFHE 3OKOA 4X98A 4X7DC 1A6VH 3KLDA 2EDKA 3CC5B 4KDWA 4K3EH 4GRLC 2X40A 3HR6A 5ICZA 3MOBL 4JZOA 6FABL 3EDJA 7FABH 4J1UA 5IESL 5KVMC 2H26A 4FFVD 3P0VL 1JGEB 3FMGL 5F88A 2Z31A 3CX5J 3G5YB 4P2CG 2B4CC 4KV5E 1CD0A 2QSTA 4ZTOH 1IKNA 4P9ML 1ADQA 4QXTA 1HSBA 1I8LA 3QDJA 2R15A 3HNSH 1IT9L 4BZ1L 4XPGH 4CN1A 3C2SA 1GVIA 3S97C 3SGKC 5CKAA 2VR9A 5HYSB 35C8H 2DL2A 1NCCH 2H8PA 4RRPA 3TH2T 2CJUH 5EZJB 3WL9B 1OSPL 4K7PH 3OKMB 1CFQA 1R3HB 5D7KD 1D5ZB 3VFWB 5L0QC 1NCWL 1RQ5A 5DMJB 2NXZB 1AXIB 5EOQH 4MNQB 4OZIF 1CR9H 4KAQH 2VOTA 1A7QL 1MOEA 5F6HJ 4B41A 5I19H 1ZLVK 1AGFB 4WHDA 3MROB 4F57H 3VG0H 3K2UL 3DRTB 3VXOB 2UWEA 2UWEE 2QQQA 4XHQA 1OAZL 1QTYT 4KROB 3PABA 1BAFL 1RZGB 4QHUA 1LDSA 1RZKH 1TTUA 3QWOA 2FHBA 2W59A 3PGCB 5JOPD 1RUAH 3QEUB 1NC2A 3WIFA 1ZANH 5I17B 2EZ0C 1YN7B 3GZKA 3CSGA 3T65A 2G5BB 2BDNH 2JCCB 3G04A 3MA7B 2P5EE 3QXAA 4M61A 1OAQL 1P84J 4DQOH 1MJJA 4M8QB 3DURA 1TJGH 4APQD 1R5WA 1BGXL 3T1FB 2XWJB 3R1GL 2A6DB 1X5GA 2D31A 2D7NA 4HUVA 3MUJA 3TH4T 1FO0A 1AQDB 5IG7B 2X5PA 3MCKB 3GKWH 3MRNB 4XZUB 1HCFX 1YPZA 4OCYL 2PN5A 3WIHA 2XNAA 4HUWB 1XR8B 3EFFB 4NGHH 4OFKA 5IJVA 2FIKB 4OTXL 4YDKH 3VGFA 1OL0A 3RIFF 2CKBA 3QIUA 1EHLH 2P5WA 3DYOA 3EO0B 4YC2C 1X6LA 2AXJA 4CMMA 1QSFE 5HVHB 3TBYB 3LKPA 1JRHH 4XWGH 5EU6D 2G9HB 2HT2C 3TGXA 4R7NB 3U4BH 1MELA 1A2YB 2Y25A 4PJCB 1NAMH 4MQSB 1FE8H 4CW1B 4TPRH 1OTTC 2R0ZL 3F6LA 4L8BA 5D1XC 1L0QA 2WIIB 1CBVH 1XF3A 4R90L 4P2QA 5IHUL 4BFIB 4R4BB 3N06B 2J2ZA 1N5YH 3OR7A 2EH8L 4PJXA 4BH7A 5IVXB 2VERN 3BKJH 4RBPK 3SEPA 3Q1SH 5JXED 1FRGH 5J11C 1NCUA 5IVZB 1P2CB 1FDLL 4IRSC 5B38G 1I1AB 3MV7B 4LFHD 1Z9OA 4V2BA 1IGTB 2E6PA 1OHQA 4LCYB 4CVXA 2KBGA 3MOAL 1BD2A 4PJ7A 4N8CH 3QULB 1JWUA 2IPUG 4P3CL 4PJBA 3QFDA 5AZ2H 3TBWA 3FONA 5TDNB 1SM3H 5A2LH 3VRIA 4NZUH 1NMBL 3TZVC 5IFAL 3OAUH 3QO0B 3MMEB 4ODUB 1BFOA 3PWJA 3B3IA 4KKBD 1U58B 2J7LA 2H2SC 1WIUA 1ZT4B 1YUHA 3GBNH 1F2XK 1T5XA 1B0GA 1V3LA 2OK0L 4XMPH 4QOKD 5TGBB 5F7NC 1NUDA 4YE4L 1D6EA 5BRZA 3M1BB 4OGYH 5BRZE 1T1ZB 3UCRA 1A7BA 2IFGA 3TO4A 3D48R 1T4KA 1U95A 3F5WA 2I24N 3QH3B 4LSRL 4NZTH 4R0LA 3RWJA 3UTSD 1HH9A 4GH7B 4XH2A 5EH1A 1C5BL 4Z8FL 1AQKH 5EWIL 3AS3A 3AU1B 3AFLA 3T2OA 5C09E 1MFBL 2GSIA 2P43B 3L9RA 4AEHH 4U6VH 1JF6A 1CFBA 1CLZL 2G2RB 2ZKHL 5EUOE 1WBZB 3GHBH 1SVCP 3RFZC 3QQ4A 3ZTJG 1JTTA 3FO2B 3P3YA 3LQAC 2AJXL 3EYQC 1TLKA 2XY2A 3NBNA 1YMMB 3TM6A 2NW3A 5CEZE 4UTBL 3I9GL 4YXKH 3VRLF 1CN4A 5DGQA 1DN2A 3WS6C 3X11A 5I75C 3CFJB 3RVXC 4EN3A 1EFQA 4MNHA 2AV1B 5I74B 3QIWC 5JUEL 2V2XB 2J4WH 3UJJH 4P4KD 4QRRA 3IU4H 5DWUH 3MNZB 4QRRE 5E6ID 3PDDA 4RGNE 4CNIB 3C5ZD 1TJIL 1YY9D 4Z7VA 4HIXH 4YLQT 5EIIA 1E6OH 4JPWH 5FM5O 5A40E 2IF7A 4LCCB 2I5YH 1PSKL 1B0RA 4LPVA 4GSDH 4XVTH 2BSTA 4CN4A 5D9SA 3WSQL 2AV7A 3ZE2E 1VGKA 1F4HA 5EC2B 4KMLB 3LHPH 4I18C 3UP1A 1HIMH 1LWRA 2AJZB 4JFXA 5E2VL 2VLKA 3RWDA 4JG1H 3LRHA 4ODSH 2BNQE 4DOHE 3MRCB 1YEIH 3SE3A 2DTML 1YQVH 1A7RL 3T3PE 1CQYA 1MHHA 5F9WB 1FFNA 3QCVH 3BD5A 1KJVB 4WIQA 5F7DA 2PR4L 5CSZB 5CGYD 2D7TH 5D5MB 2J8UB 2HLAA 4BKLB 4M7ZC 2VWEE 2A9MH 3I6GA 4JDTH 3QUMB 4JFHE 4KJQC 3VXUD 4U1NA 2DQIH 2KH2B 4XAWL 3RWIA 2B1HH 5EO9A 5D70L 2B7DT 2WLZA 4HH9A 4J3WA 5C2UB 3C87A 5K9JH 5DMYA 1J1PH 3S37L 3QUYB 2NY4D 1UZ6E 1NCBH 1JYNA 4GQPH 2ADJA 4QHLB 5FGRA 4HDIA 2DBLH 3VXTB 1AFVH 4XBPA 2EXYD 1UB6A 2R2HB 4HGMA