3MJ9L

Crystal structure of jaml in complex with the stimulatory antibody hl4e10
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
209
structure length
209
Chain Sequence
YTLTQPPLVSVALGQKATITCSGDKLSDVYVHWYQQKAGQAPVLVIYEDNRRPSGIPDHFSGSNSGNMATLTISKAQAGDEADYYCQSWDGTNSAWVFGSGTKVTVLGQPNAAPSVTLFPPSSEELKTNQATLVCMINGFYPADVAVTWEADGTPITQGVKTTQPSKSDSKYMATSYLTMTADAWKSRNTFICKVTHGGNTVEKSLSPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into gamma delta T cell costimulation by an anti-JAML antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Junctional adhesion molecule-like
total genus 42
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2010-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj9L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj9L01
1PG7W 4FFVD 4WI4A 5E2UL 3KPQB 3WJLC 1CE6A 3JWNC 3LQZB 1A6PA 2VISB 3W82A 3MRJA 4JFFE 3MLZL 3MRMA 3PWPD 3ILPB 4JKMA 4ELMF 3O4OC 1WBXB 1H8NA 4GBXB 2XKNB 3VFNA 5CGTA 4NUGL 4GRLC 3QQ3B 4JPWH 1F4XL 2VXQL 1KTDB 5I1AB 5EUKA 5CKAA 1EFXA 3UYPA 3BGFB 3ZKMD 4UILL 2X1XR 3GMOA 4GO6B 3TVMD 4F58H 2A1WL 4WFED 2W38A 2GFBB 4F15B 2Z31D 2AI0H 2VXUL 4J1UB 5DS8A 3OF6A 3RWHA 3KLHC 4UAOC 1M71A 1X6NA 4LF3B 5D1ZC 1CLOH 3GJFA 1S7QB 5AZEL 3ZE1E 5IW3A 3LB6C 4ORZC 3L5XL 1UZ6E 1K8DA 4QKXB 5IOPA 5BRZA 4IRZL 4ZSOA 4LLAA 4AIZA 2O5YL 5FYKH 1F4WH 3B4NA 5IMLA 3E6HB 1MWAH 3IB4A 1U8IA 3V6BR 3ARBB 1NFKA 4U7KA 4UOW1 2VQTA 1QZ1A 1WQVT 4NKIH 2KH2B 1A6WH 5HYSB 3KWWA 2D9QB 4JM4L 3QDMD 4OIBA 1JWSB 1FV1A 4XP4L 1BREA 5I1DB 2Y6SD 4MJ5B 1MFDH 5IM7B 3U30B 1LDPL 4L1DA 2BXYA 4HPYH 4MNGE 1MIEL 5CMAB 1MCOL 3FO9B 4P2OD 3HFMH 4I3RH 4LLMB 1NGPL 5DK0B 1JGUH 4NGHL 2CIKA 4I2XB 2WQ8A 5ID0B 2DYPD 1S7UB 3QFDB 4FP8H 4LLWA 1F2XK 4RX4A 4PJIA 1RURH 2X4SA 1NC2D 2HA1A 5GRVL 3T08A 3VE0B 4HUNB 2HP4A 4HS6A 4PJFA 4BQ8A 5CILH 4ZPTB 5JXAL 3QI9A 5IFHH 4PRAB 4YXHL 1B88A 2HVKA 2IQ9L 1XGRB 1RK1A 4NOBA 1YMHB 1TFHA 1GJIA 2IG2L 3I3DA 4HWEL 1RIUL 5D8JH 4TNWK 4HEME 4H0GA 3X12A 3KS0J 5FA3B 3D39D 3IFNH 1JYWA 3U0WL 2PO6A 3X11B 4EKXA 1QKZH 5K9OB 3MOAL 4I48B 3GHEL 3FQUA 1WEJH 3P2TA 1I8LA 2D4DA 4QRQA 3CZFB 1HHHA 1NH6A 3S4SG 3QUYD 1L9MA 3SCMD 4NO2B 5F3BB 3O6KH 3UZVB 1UA6L 2VXVH 3H3KA 4NKMA 5I1JH 1EHNA 4OUUB 2WSKA 3DUHA 3CGTA 3P3YA 3X14A 4O5LH 4WHYH 3PL6D 2VLJE 3FQTA 3JXAA 1IKFH 1IKNC 4PLKD 3ZYZA 3BOVA 4X6BB 1CF8H 2NX5A 1UEYA 4X6FB 2VDQL 4F7PB 1T1XB 3BP5B 4OZFB 3HCVA 3BZDA 4ZFZB 4DFIA 1NAMA 4P2OA 1MAJA 4F2MB 4MJID 3O3EB 1C12A 3B2VL 2CLRA 3T77B 3CSYB 4V2BA 1T0NA 4UV4L 1G7JB 4I77L 3PWJA 3HE6B 5EO0A 3VD3A 1FL6A 1DVFC 1RZKH 4PJ7F 3FN0H 5E94B 4S2SB 2XFXB 2DIAA 2VLRD 3QCTL 4HWEH 4J4PD 5C0IB 4H20H 3AXLA 5E95B 2VC2L 3ZDZE 4NQCD 5JXED 4ZUTB 3RAJL 3K74B 4JO4H 4NQTA 4RGND 5KVDH 5MHSE 3MV7D 5FYLE 5TH2A 5ITFA 43CAB 1G7JA 1ZTXL 4NKOA 1RZGB 1D6VH 4L3EA 4YAQA 4MS8D 2I9TB 2PXYB 4XPTL 1LO5A 1CF8L 1CDYA 1H0DA 4K7PH 1LD9A 5TDNA 4WUUB 4X6CA 1FNAA 1AKJA 1HK6A 5J13B 3CIQA 4HIXH 2CKBL 4G9DA 2QKIB 4Q9RL 4NUGH 5EZLB 1J05B 2Y25A 2NW2B 4ODHL 1GYAA 5GGUA 4HDIB 5HXMA 3F7VA 4G42B 2B2XH 1F4AA 1GVIA 4XCYA 5I1HL 3ZHKA 3KR3H 1TCMA 4LEXL 3T4AB 3FN0L 3I6GA 4O2FB 5IW1B 4YIQA 1Q0YH 2F8VA 4OI7A 3HC0A 3BZFB 2FR4A 4F9PC 4HH8A 3K4AA 2VL5B 2D4FA 4FQXC 3RPKA 3B2VH 4RQQA 4Z5RB 1PKOA 4LSSH 1XCTA 3BESR 4WO4B 5BJTA 1MFEL 2QEJA 5ESVA 4U05A 1S9YB 1W0VB 4HUMB 1LE5A 2YKLL 2CK0H 1DUZA 1T22B 1GAFH 1YY8A 4WY7H 3FJTA 4M7ZC 2P5WB 1BD2B 2R8SH 3CDFA 4NOFA 5KVMC 3VXUB 4R7DB 1DQLH 4XMPL 4C4KT 3B3IA 4QOKA 1KCSH 4WNQB 1CFBA 3G5VB 3Q48A 4N0CD 1A6TA 4KPHL 4Q9CA 3F62A 3KG5A 3NIGF 4YE4L 1CFVL 4GXVL 1E4XI 3OKNB 3L5WA 1A1OA 2R69L 5I76B 1FSKB 2V2WA 3MV7A 4JRXB 4YHYC 3EDEA 1YEHL 4I0PC 2IAMD 1MHPL 1ZHKB 2IAND 2WINA 1X5JA 3WN5C 3ARGD 5ETUB 1FBIH 5DK2B 3RUGA 4ZD3L 4QT5A 4C56B 4JRYD 4E42B 2FJGB 1JTTA 1FDLH 3MRQB 2Z93B 4X7FC 3QCVL 3FCTB 3OKEA 1RJYA 5C0BE 4HS3A 4U6XA 1N0XL 4ELME 3SGEH 1AIFA 2JB6B 4MCYA 3PWPA 5KVDL 4XCYB 5E08H 5GS1A 1DDHB 3D85B 5LQBL 5L2JA 5E00B 2IQ9H 4NCDA 3M17B 4KHXL 2VXTH 4TPRL 4MZ2A 2DQGH 4HUKB 1OSZB 3CK0L 2QQLL 2OLDA 1U41A 4Y4HD 2X89A 2Q3AA 5IQ7H 4HGMA 4R4ND 4KRPC 2RFXB 1CR9H 1WISA 4XBEL 4L8CA 2F8XC 1RHFA 4GT7A 2FO4B 3ZTJG 3NIFE 5LAXA 3RTQA 2HFTA 1W0VA 2NY6D 4G43A 2XN9D 4RFEA 4RFNC 5EO1A 1I9EA 5EZIH 3TV3H 3E0GA 1YPZF 3D3VB 4JFYA 4F8QA 1T21B 2IQAA 3QB7C 4U1LA 2X4OB 4ZPVB 3BP7A 1OGAD 4HPYL 4POUB 4Z0BL 5AAWA 3DGCR 1AGCA 1BZ7B 4IRJA 4MDJA 3VXRD 1FFQA 3SHSA 3WLBA 2M1KA 4PJGF 4K7PY 5JHDA 1ZVHA 4YZFF 1IKFL 1XF5B 4L4TD 1A9EB 1KG0B 1YJDH 3QDGD 1A7RH 5IMOA 4ODWA 3C08H 4K3JH 1N6VA 1NFDA 1JZ2A 3TVMB 3BP7B 3D2UB 4F7EA 4J23A 4P23C 2VKXA 1W8OA 1ZT7B 3O4LB 5DS8B 6CGTA 1BD2D 4FQIL 4GLRI 4OCSL 2HT4C 5L8LB 2GSIB 3A6BH 4WWKB 4OFDA 5HHMD 1OM3L 1MCJA 2P24A 4IS6B 1T1WB 4G5ZH 4HK0B 4L5FH 4PP1C 5F7MC 4NO0A 1DL7L 2I07B 1OTTD 5E8PA 4RWHA 4LLQA 5E00A 1ZANL 1CI5A 2N4IA 5JW5A 4ZTOH 4YWGH 4LRNH 4LCWE 4PB9L 4JFDD 3G9VA 5DC9B 2Z9TA 3BQUB 4PS4H 1JPGB 3O4LD 1RUMH 1YY9C 3MXWH 1Q1JL 3G6AA 3OGOE 2ICEA 4TSBL 2J8HA 3I2CL 1WCBA 3V52H 1KPVA 3MREB 4KZEL 3CPLA 3EJZC 3Q5YA 5IBLD 1JRHH 3RJDA 4X7EC 2A6DA 2VSDA 3QEHA 2VLLA 2X4SB 1G7LA 2FLRT 2ZOLB 2BOBB 2OBGA 4XP9L 1FGVH 5I74B 3SDYL 2VDPH 2UYLA 4AZ8A 3Q1SL 3ROLA 5E6IA 4FFYL 5KG9B 2WP3O 3ZHDA 2HJKA 1NBZB 5GSVA 2GSGB 4LEOA 3GSWA 4CN1A 5L2KD 3MJGX 4UOW0 1F58H 1RUAH 1XGYH 1J5OL 1RUML 3W5MA 2R0WL 1RUPL 3WFDH 5DJCB 5IVXB 5MP6H 1LVEA 5FK9A 1BVLA 3D39E 1Z2KA 4OGXH 3C2AH 3V4PH 4H8WL 2HJFB 4I8DA 3I50L 3HAEG 1JF6A 2VLKD 2CO7B 3TPUB 1I1AA 1GZPB 3RVUC 1QYGL 5HPOA 1YPZE 4HK3J 3UJTL 1FAIH 1T7ZA 5GS0D 3L3IA 2CQVA 4I2XE 3MCG1 5C0FA 1OY3B 3GFUA 4X5WA 3E6FA 1MPAH 5MEQB 3U7YH 3EKCA 5L2KB 1A1MA 1BVLB 2WBKA 1IBGL 4JFXA 3F5WB 1LK2A 2YSSB 3TT3H 1KPRA 3LD8C 1HI6A 4G6FB 4MXVF 5AYQA 1QSEB 1C1EL 1T0MA 4YQXL 3T1WA 5B21A 3TYGH 5C0RL 3WFEL 2WZPD 3SDDB 1UKQA 3B2UC 1VADB 4GH7B 1RK1B 1NBYA 1ZS8B 2NY5C 3UZEA 1CQKA 3LS4L 4NRYA 5EIIA 4GKSB 3G04A 4Z7NE 5HHPB 4WCYL 5C0AB 3RNKA 3UBXB 3TA3B 1SM3H 4Q9BA 2AS5M 1Z9LA 3BHBB 4GAGH 3L5HA 1KULA 3HE6A 5DJ0A 2R1XA 1A47A 2WW8A 5FHAL 1S5HA 4RFNB 4M5ZL 4P46A 4JGMA 4WWKC 1R3HB 3O41A 4QRUB 1U2HA 3UTQA 35C8L 4D8PA 2HTLD 1MAKA 3CLEH 4I3SH 1JHKL 5TDOA 3ZYIA 5EBLB 2AGJL 3E2HC 2AV1B 3MCLH 5F8QC 2X9XA 4JPVH 1KEML 2X4PA 1MRCL 2V2TB 4MNQE 3L3IB 2BOCA 2BHYA 1KB5A 2C1PA 2JLLA 4D9RE 4YK4B 3E6FB 4Z7OE 4HWZA 1CFSB 3ARSA 2ED8A 3ZTNL 3E6HA 2Y06H 4LDEB 4XVTH 5GRUH 1GC1C 3ZSTA 4P2OB 5HI4D 1AO7D 1X9QA 3H9SD 3VWKB 5AWNH 2DLFH 2Q3ZA 3NOIA 3U36A 4FQXD 1EMTH 2V7HA 2ICWB 3W2DH 5BW7A 3EFDH 1OP5H 3TIDA 1JZ5A 1YNTB 4RISH 3CAFA 1OB1B 5C0CB 4PJIE 4XNYH 1NAKL 3PP3H 4EDWL 1URLA 2D7PA 5CMAA 1I9RH 4M4RA 5IBTL 2O93L 4UIKH 2F58H 4FQ2H 5ESQA 1AI1L 1MHEA 3G04B 3TT1H 4RQQB 2Q8AL 2A6IA 2EEBA 1SM3L 4JQVA 2XV6B 5CBAB 2D7OA 3HMXA 2GYSA 5I6XB 2YPKB 1ZT1B 5EN2B 5MEPB 3TO2A 4LF3A 3WXVH 1NFIB 3QIWB 5IB3B 3C6LB 2HFEA 2QHRL 5DEZA 3B83A 4ZODA 1RUQL 3NCCB 4LSVH 4QNPF 3HR5A 4TOYH 1BOGA 3B6SA 4OCNC 2MHAA 2W0KA 3P77A 4D94A 4YGVA 4ZS7H 5J8OA 4L4VD 4Z7QE 5CBAA 5I9QC 3VFWB 4LKXA 2BNRD 2NXYD 1TETL 4JDTL 1NEZG 4MA1B 1HYSD 1GGBL 4PJHA 1UACH 2XTJB 1WTLA 4LOUC 2CLVA 2W9DL 3H3BC 1SJEB 3LIZH 1SBBA 4C56D 2HLAA 3C60B 4WTZG 4EDXA 5D7SL 4GSDH 5KN5B 5EORH 1DE4B 2DQCH 3EYSH 4JY6B 3U48A 1NAML 2R0WH 3EJYC 3D9AH 4AG4H 1H3TA 4YFEA 1D5BB 5L2JB 1OARH 1FL5B 1T1YB 2QADC 5EU3A 2DM7A 1F8TH 2P43B 4GQ9H 2AABH 4JN2B 4AH2A 2YD3A 1Q9KA 1T1ZB 4M6NH 5HHOB 1JTPA 1YYLL 5BRZE 4NQCB 2YPLE 4Z7UB 3OKOB 3TZVA 3B3IB 2HVJB 3QDMA 2J7LA 2APWA 3KYKH 3QXUA 1DQQA 3BWUC 3U4AA 1L7TL 3JWOH 4J3WA 3CXDL 2VWEC 5F1NB 3I6LD 5GRYA 2HYMA 4MJ4A 4ODSL 2YBRA 4Q2ZA 1AGFA 1JGEB 2VZOA 4CU7A 5EO1B 1KENH 1F90H 2XA8H 3DX6A 4KJQC 2ZJSL 4A6YH 4P46C 3CH8A 1KIQB 3GBNH 4QF1B 1HHIA 5EWIH 3VG9B 4NKIL 1A7OL 4XCEB 2L7UA 4CL7A 4LCIL 4NZTH 4ZS6D 2X4RB 1JFQL 5F71A 2BSED 2EEAA 2H32B 3S4SA 5I18L 5LKNA 4PG9B 3OKDB 5I66B 3FFDA 5B8CB 2D7TH 4MD5A 4L4VA 5EU5A 5IBUB 5KS9B 1QFUH 3WV0A 1UM6H 1AJ7L 5LGJA 4V1DA 3AS1A 4FMFA 4F7MA 3DRQA 1IEBB 5CWSB 3VXRA 4TNWF 3REVB 4MMXC 1EHAA 1ZA6A 1ITBB 3MLUH 2DBLL 4MA8H 3NFSL 3VRIA 5JQ6H 3FHQA 5SWQB 2Z8SA 2AEPH 4G6JH 1PYWB 1KCLA 3BO8A 3TP4A 1YEDB 1FFOB 5D1QB 4ACPA 1NUFA 1WK0A 1G0XA 4KAQL 2L0DA 4P4KC 3UDWA 3DURB 4BKLB 3DECA 5DT1L 3EOAA 2N1KA 4K3JL 1RD6A 3MO1B 4JFYB 1U8HA 4KVCH 4HKZB 4M7LT 1HXMB 5CJBA 4D9QD 4PY7A 4G6KH 4LPXA 4BFEA 5IROC 5F6IC 2EKSA 3BQUA 4IOIB 3C6LC 3W0WE 2DWEA 3QEGL 3QFJB 5DRZA 3UO1H 1IM9B 1EAJA 4KDTC 4M5YH 2JJWA 2UWEB 3FKUS 4PJIF 5E8DH 1EGJH 5DYOA 2ATKA 1JHTA 3DI2B 2D7TL 4JY5H 4YQXH 4L8BA 4NCC2 3BPLB 3DTXA 2J6EL 1S9XA 3QXAB 3PHSA 1TZIA 2XZQH 4M1CC 1BWMA 5GGQL 3ARFA 3PWNA 2NY7L 4PJBE 1G6RL 3W11D 2VTFA 4QOKB 5D1ZD 5I8KL 4DUVA 3QQ4A 5C09D 2MCPL 4FHBD 2B1HH 4JFOA 5EZOH 4I9WE 1Q1JH 1RSFA 4PJGB 1U8OB 4I3SL 3VFPB 3GUTB 4OLYH 4RGNC 3NFPA 1IM9D 4OUOA 3CXDH 4R7NB 3UYRH 3IU4H 4HF5L 1UH3A 2V9RA 1A7NH 3IF1A 3QIBD 4GAYB 4RNRB 5DI8B 1IEAB 1VACB 4OM1L 4YBQD 2DBJA 4Y5YC 3OR7A 4ETQB 4PJ8D 4XWOC 1A6UH 3D85D 1LWRA 5L9DL 2DM4A 4YXKL 4YX2H 3SO3B 1UJ3B 3BDYL 1ZLVH 1B0RB 3VGFA 1IL1A 1HE7A 1KIPA 1IC5L 3DARA 5K33A 1KELL 5I8EA 5CIPH 2DJSA 1AGEB 4OLUL 1OP5K 4TVSa 1KJVB 2KZ1B 4KKBC 2ZUVA 2IAMC 5H8DA 1ZVSB 2C3VB 4NC0B 3BISA 2HT4D 5DK3A 4L8SA 3N85L 1MJ7H 4LIQE 3T0WA 5FV2A 1AD0B 4FN0A 2OSLB 5E8DL 4NM4H 4HZLB 3KPNB 1UKTA 4GMTL 4M62H 4PR5A 3PL6C 4ZO8A 4U1GB 1CFNA 3VJ6B 2F54B 3AB0C 4BA8A 4UT7H 1WZLA 3GSWB 3BZ4B 1FRGH 3O6FC 1KJMA 2YD1A 4LCWB 2O5ZL 5TPWH 1P7QD 1QD0A 2DTSA 2IF7A 4Q7DA 2ZP0T 3EO1A 2DKMA 2R4SH 3PGCB 4DN4H 1U8MB 5SWZE 5BV7C 3I02A 1RZKC 4OD3H 1I1RA 1S7VB 4LBEA 4LDLB 1MY7A 3NGBB 4G6AD 4QXTB 4X7CC 5J0BA 1FNGB 1IEHA 2HLFC 4BK4A 3QDGE 5GZOD 1YY9D 2FZ3B 5CGYD 2PXYC 1E27B 1G7MB 1FVDB 1KJMB 4LCWA 5IMKB 3KPSE 3DYMA 3OXSA 2BCKB 5HJ3A 4O58H 1U93B 4M6OH 1FVEB 4XPBH 3LV3A 1FORH 3FN9A 1HN1A 2W91A 3QUZA 5E08L 1F3JA 3CFBB 4ONHB 5L0QC 4CNIA 5D6DA 5BVPH 1HSAA 3UXFA 4OF8A 1U8QB 5BS0B 3N85H 2XXCB 3BKCL 1GOFA 4WI5A 4Q97A 3CZFA 3P0YL 1JGDB 1IGMH 2PYFB 5L7XH 2H45A 1U3JA 4GRLD 2G9HB 4FTVE 4OZGE 4XP5L 2BVTA 5C1MB 1DN0B 1YMMD 4YHOL 5IMKA 2GITA 4BFBD 3VXQA 5LVEA 1N7ML 4EI5D 2BSRA 1J11A 3Q2CA 1WAAF 1QEWA 1GGCH 1A7BA 1NUGA 1X7QA 4R8WH 4ODSH 1KIRB 3L3OA 4U33A 3FO1B 1NJ9B 1P7KB 2EIZA 4PR5B 1Z3GL 3ARVA 1H3PH 2P48B 2HVKB 5DMIH 2VDRH 3RY6A 5E2TL 5CCKH 4OTXH 4XMPH 5DDHB 1FNSL 1P7HL 1ONQA 3O3EA 2P8MB 4XBPA 1HDMB 3LQZA 4QEGA 1LEKA 2A6DB 1N5YL 1OD9A 1EVUA 4J6RH 1ADQH 1S7SB 1AFVL 4ODXA 3OKLB 3ECBB 3SDYH 5C2BH 3G6DL 3Q6GL 4GXUN 4M8VA 4Y4HB 3OJVC 4XNUH 4RWYH 3U1SH 4UDUB 2I07A 1WT5A 4HUVA 1K8IA 1KEGL 2EH8H 3BP6B 1B6UA 3LKSB 1U58A 4NQDD 4JPIA 1T2XA 3O8XB 4NRZA 4O5LL 1CD1B 4XP6H 1BJMA 5DHYA 2WBWB 3HNTL 2JELL 4IOSD 3LMJH 4Y19B 2UVFA 1RIVL 2EE6A 1BAFH 5C86A 2CXGA 2GW5A 3MZTA 4UQ2A 4CJ0A 1UYWL 4GRLA 4X4ZA 4MJIA 4PRIA 4KJYB 4HIJB 4O00A 1U91B 5DFWH 3VXPA 4AEIL 4BSWA 3ARBA 1OLLA 3RWIA 3U7YL 4EI5C 2R8SL 4XBEH 1KPRB 4QTIL 1TJGH 4K23H 1HHGB 3NMEA 2JCCA 1MFCH 4XNMA 2KQNA 5EU6D 4P5TC 5MI0C 2ZCKL 3IDGB 4MNHB 1I1CA 3OG4B 1IZJA 3OJDA 2XTLA 4Q74A 1JV5B 2XICA 3OGCA 5E24E 5INCB 2MQ0A 1RZJL 1JF1B 3V4UH 4LLVA 1TJHH 5IT2H 3RL1A 1AXSA 1YC8A 2PKDA 5CEZL 4Z77B 4XGZB 3HLAB 2W9EL 3RWEB 4JHWH 5C0EB 1HHGA 4LNVA 2IGFH 1DBAL 4ONFH 3HG1A 1TZGL 2PW1A 1Q9WA 3K7UA 3KYOA 3OF6D 1IC5H 3JUYA 4WI8A 5TDPB 3UPRA 1EJOH 4DQOH 1A2YB 1HHIB 5DSCA 4KUZL 5FO9B 5DJ8A 1KCUL 1BZ9A 5C6TL 1RMFL 2BFVH 5FAAA 4R90L 1CT8B 5SX4I 3FFCA 1HXYA 3H6JA 5CD3A 3MRCA 1YN7B 3VDBA 5FECA 4DN3H 3OWEA 4GG6A 3U6RB 1G9NH 5IQ7L 3BI9X 1S7RB 3X13B 1GHFH 3VCLA 5EUOE 2RCSH 4HAFA 4OGAC 5CFHA 5HYQB 2JIXD 5GS1C 2X4TB 1V3MA 1U8KA 5C0JA 1D5IH 3MJ8B 2X4QB 2NXYC 4Y16A 4S1RH 1I4FB 2X1OA 4G3YL 1ZLWK 3O2DL 1SJXA 2DQIL 4CVXA 5KSAC 5C0AA 2VABA 1AGFB 3GGWA 3PIQB 5BZWA 5GISH 4WW2B 1JGLH 3LPFA 1B0GA 3VFOA 2HKFH 1DZBA 1VB9A 5SX5H 4F15C 2BVYA 1VCAA 1OAQL 5F88A 2VNCA 2PXYA 3OJDB 1WBZB 4PY7B 1FJ1B 3WO4B 5ERWA 3BH9A 4EOWH 4TRPL 1G1CA 4KHTL 3HI1B 3WE6B 4I13B 4KK6D 1SEQL 3QFJD 3VU2A 4DEPB 2ZCLH 3NIDE 1CGXA 4WV1A 2MPAH 2J8UF 1NGWB 1P1ZB 3CSYA 4LRIC 4UIMB 2ATPB 3D1MC 5HHXL 3HZKB 4OJFL 1QRNE 4LSVL 4HDIA 5D5ME 2V2WB 4JRXA 2A0LC 2G5BB 2IANA 5T3ZD 4U1SB 2FWOB 3MBEA 4S2SA 3MCKB 2CXKA 1A7PL 2X05A 1X5HA 1L0QA 2MTPA 5EIQA 2BRRH 3P30H 5FO9A 4Y5XB 4N9OB 3OZ9H 2ERJB 1R3JA 4KVNL 3AGVA 4XT1C 3VRIB 1X5GA 1UM5H 4ZO7A 4D0DB 3DUSA 2PYEB 5J11B 5ISZD 3B5TA 4P2RB 3VDCA 4YHIB 5E7BA 3V7AE 4DCQB 1RY7B 3FT2B 1J7VR 3HRZA 4OBSA 1EBPA 3IFLL 3WKML 5HGHB 2EIBA 1WV7T 5IVXF 5HHQB 5E0QA 1LEIB 3WNLA 1ZT4A 1U3HC 4PJHB 4ESKA 5ICXB 1ZVYA 2OTWA 43C9B 5SWSA 1OGAE 2X6MA 1RZJC 2Q7YB 3AU1A 3QJHA 2D03H 1DLFH 1J05A 2R2EA 3CNKA 3DYPA 3MLWL 1FYTD 4XPGL 1O5DT 4ZYKA 4GRWE 4X6DE 2HMID 2Q6WB 3EDJA 4MXVE 3RVXD 4LHUA 1CTOA 4FFZH 1R6VA 4P5TA 2DYPB 2IALB 2R0LH 3BPCA 1H5BB 3WS3B 2ZG2A 1KB5L 4FZEL 1VA9A 4K2UL 4CDGC 2WWMD 3QIWA 2OR7A 5IB3A 3MV11 3K81A 4W6WB 4AH2B 4WHTA 2WP3T 3QDAA 3V6OC 3HC0B 1C8PA 3TBTB 5IMMB 1ZLUH 5FUCE 5HGBB 1Z9MA 4KDWA 2F19L 4PJHF 1G0DA 3AS3A 1ERNA 4P59L 5E5RB 3TA3C 4MJIE 1EDQA 4EUPG 3D9AL 3RVVD 2SEBA 5IFJB 4KKLC 4OZGF 1FNEA 2G5BA 2DQDL 3VWJA 4YWGL 4ZTOL 5K59F 3T1FA 4Y2DC 2GK0A 5FYKD 3FFCD 4UBDC 5JOFA 5CJXA 3HB3D 5TE4L 1KC5H 1QQDA 3H42L 3U46B 3MRRA 4OIIH 1ZK9A 4WU7B 1DL7H 3HTLX 1Y0LA 2PYEA 1PKQB 3ESUF 1UWEL 2YKLH 4Z7VF 5D7JB 5D8JL 3H8NA 2R56H 2IAMB 4YO0A 3QPXH 3EGSB 2I24N 1G9NC 1MF2H 2I60H 7FABH 2XWJB 4ZTPL 2O5ZH 2HJLA 3TWCL 2XNAB 4QHMA 2XTJE 3WFBH 1ZHBA 1MWAA 2H8PA 5JORB 4WW2C 1MHCB 3C08L 1DANU 2DKSA 1INEL 3VFUB 4XPAL 1G9NL 4HMEA 1WZ1H 2JKXA 3LB6D 5FDYA 4RZCA 4X9BA 3S34L 4G6KL 5IKCB 4HUXA 4U3CA 5IBTH 1M7DA 4CDHA 4GG8A 3VXUE 1REIA 3OX8A 4CMHC 3S3PA 5SWZB 2NXYB 1G6RB 4QF1A 3TN0B 3MFFA 5J57B 2F19H 3THML 3P4OA 3E3QE 1CFTA 4ONFL 3ROLB 2JB5H 3I85A 2CDEA 1P2CB 1F4HA 5ABDE 5C3TA 1NBYB 2DMKA 1RUKH 4LPYA 4XWGH 5B4MC 2YA0A 1S9XB 4JO4L 4QNPE 2Z35B 4IRSB 2RR3A 4YPGB 3BHBA 2E27L 1Z0NA 1I7UA 5DVMA 1JF5A 4U1IB 4MAYD 4XMKH 3WLWC 1S7QA 3BMWA 3AY4C 4K71B 3R0MA 3QCVH 2EXWD 1CDGA 1RZKL 3HAEA 4U7MA 4R0LA 3T4YA 5GJSH 2EE9A 2FECI 3SOBL 4RGMB 5D1XD 1A6ZB 1BQHB 3HNSH 5J6HA 4OI8A 1UXSB 2YUZA 4OQ1A 3VXMB 4DVRH 2Z35A 4XPHL 2WANA 1ZWIA 1YEHH 2ESVE 5I71C 5HHMB 2H41A 5F9DC 4BUGA 1UGNA 5KZCB 4WV1C 4Y1AD 4C4KO 4JM4H 5HY9A 1INDL 1VGEH 3L9RA 2BRRL 5IV2A 1C16B 2Y07H 5GGTL 4HKJA 2YPVH 3EBAA 2PO6D 1MJJA 2A6KB 5LAXB 4PJEB 1M7DB 2JE8A 5FYKL 1F6AA 3TBWA 1JGVH 5F6HI 1MCLA 3WMSA 4WCYH 3SE9L 5SWZA 4YPJA 2OR8A 2F53A 3BE1H 3KPOB 3A6BL 4P23A 3MLPA 4R96A 2QTEA 3VXMD 5JZ7D 3STLA 1F4YL 1P7QB 2RJMA 3GDBA 5EA0L 5JHDB 2W65A 3A0OA 2XWBB 3MUJA 5IFAL 4F37F 2VITB 1CFNB 4J6RL 5DUMH 5JPNB 1RZFH 4G80B 1A0QL 3FQNB 1Z9SA 1DVFD 5IUSA 3TFKC 2GKIA 1Q0YL 4M8QA 3ARGA 3BQUD 2GI7A 2G2RB 3JWDL 2ESVD 2F53B 4ORGA 3BT2L 1ACYL 5EPMA 4JFHE 4C83B 2ZOLA 5ENWA 3NIGE 3T0VA 1U8MA 4KRPD 2EZ0D 4MYWB 1Q9WB 1SY6A 3KYOB 2QQNL 1QLFA 2NY4C 5CS7A 5HHNA 6FABL 2GCYA 4KRMB 5I0DA 1N6UA 1IQWL 3ARFD 8FABB 3KPSD 4MDIA 3QPQD 3HI5L 3GSNA 4OKVA 1DBKL 4PJ5E 1GXEA 2YD7A 4N0UA 1KENL 3IVKA 5GHWL 4XP5H 3HZMB 3HFML 4HQQH 1KSRA 2QR0A 1W72L 5IV2B 3BSZH 1LNUA 3MODL 3P4MB 4QRPE 4UIKL 5T1LB 2EDYA 2ICWJ 2CSPA 4HLZG 2J1KA 4KU1A 1KNOA 1I9RL 2DS4A 4OCYL 3DHJA 4HH9B 3UTQB 4NQEA 2W9EH 1CE6B 2QSCL 3DX8B 5L6YH 1QSED 1HIML 1MFBL 2FX7H 1K6QL 4UV4H 5FM5O 2AV1A 3MLSL 4DGVH 2Y06L 4GBXA 1IMHC 4K3DH 3MRHA 4LL9A 2VLJA 2XFXA 1D5ZB 3WIFA 5MERA 1MIML 5DD0H 3ZKXC 2Z92A 1A6VH 3W11C 3MR9A 4WHDA 1N7MH 4JM2D 1DQJA 2CDGA 3OR6A 1VPOH 4HFUL 3OAZK 4ERSH 4OLZH 4X7DC 5GS0C 3ZDYE 3ARDA 5DJ0B 5B39B 3OKLA 4LARL 5AZ2H 5DZLA 5I75C 4JY5L 1DSFL 4ZDHA 3TLRA 3NFNA 1QBBA 2C9AA 2KL6A 5L2KE 4MDIB 4M5YL 1KGCE 4R6UA 5H37G 3CZJA 4JFDA 5I74C 3LPGA 4EN3A 3MNWB 4YFDB 3R06A 5A1AA 3MLVL 5KN5A 5F97E 5GIRA 3GM8A 4JFPB 4OD1H 5T5FL 3HI6H 5CP7B 3JTSA 1RUPH 3TBSA 3WFDL 5TE4H 1JGLL 4F7MB 25C8L 1KIRA 3TH3T 2K3TA 4XNUL 3FAXA 4IMLB 2YWYA 4J3XA 5D72H 5C0BB 5F7LB 4C55A 3DRTB 3V7AG 3DV4A 3R06B 4ODHH 1PJ9A 1GSMA 4WV1B 4KTEH 4Y4HC 5HHOE 3OKMB 5EZIL 3TV3L 1EO7A 4PBXA 3NZ8A 3HC3L 43CAA 1TIUA 1X44A 3EOTH 5CEZD 2APVA 1OGTB 4NDMA 5KVFH 4NM4L 4MCZB 5DO2D 1N8ZB 3AB0B 2N7AA 4B0MM 3MRHB 1UVQA 2GJJA 5DFVD 3LCYA 3RVTC 1U6AH 3BFOA 2CLVB 5D5MF 2R23B 3EIFA 2RAMA 2OMBA 4HBCL 1DQJB 4I1NB 1D9KC 2WWKO 4KQ4H 2CIIB 5FA4A 5F89B 3HLAA 3UP1A 5E99H 3NGBC 2X7LA 3MRLB 4S1DC 1CDUA 1Y18A 3QIWD 3SKOB 5HGHA 1BPVA 2IGFL 2EC8A 4I0PD 2WINB 5JHLL 1HH6A 4XCCL 3P0YH 3GMPB 4GRWB 3GBLA 4HMDA 3WKMH 5IW1A 5C0AE 3RTQC 4Z9KB 3UTSD 5HHOA 5TJWK 3X3FH 3DSNA 1MEXL 2NR6D 3BEWB 2R39A 5IROA 2ZUXA 5HHVH 3RWCA 5IWLA 2H2SD 1UCBL 3CFCL 4RIRA 1MCFA 4KJQD 1K4DB 1IGTB 2UWEF 1CDHA 3C6SB 1MCHA 1UH2A 4POYA 2FIKA 4MXWL 4GMSL 1H5BA 4LSDA 3WS3A 3VW3H 1JGVL 2NW3A 1RZIA 4F58L 3SKMB 3I2CH 2EIEA 4Y16B 1MCRA 2UZXB 5C0RH 5IR1B 5GRJH 5EBWB 3N1MC 1AGEA 4BQBA 1GPOH 5C8JB 1KT2A 3U4BL 1MF2L 1P6FA 2I60L 1EO8L 3TC9A 4YDKH 7FABL 4KHTH 5BZWB 3QDJA 4NWUL 4MX7A 1MI5B 1OD7A 3GM0A 1UWXK 1JZ4A 5L8KB 1VESA 3JSSA 4Y19D 1AGCB 3UTSE 1BIIB 3MNZB 1O0VA 2DDQH 5D9SB 5A2LH 3WE6A 1GH7A 5KW9H 2FR4B 1W2KT 1AQKL 1A0QH 1YEIL 2CH8A 3TO4D 5DT1H 4ZUTA 2D7NA 3O2DH 2QQLH 3U1SL 1HHJB 4ZAKB 1HINL 3EOYG 5C0ND 4JDVB 3KPRD 3IRPX 1QO3A 4GAJL 4N5ED 3S37H 2F5AH 2FWOA 2JCCE 3VWKC 4PJ8A 4QCIB 5HI3C 3W9DA 1S7TA 4JLRA 3IETB 1BIIA 3MNZA 1N0XH 5F6IB 5EC1A 5L9DH 1XR8A 3NCMA 4KI5E 5KVEH 4RMTA 1KIPB 2VC2H 4NQUA 4AY0A 3DXAB 4RIRB 3HG1E 5T5NF 2C4FU 5EU7E 4PRNA 5HVFB 2FHCA 2HT3C 5EU7C 1JFQH 3QPQC 4ZFGH 1EMTL 5CZVH 4I0PB 4UTAH 5DJAA 3E3QC 2DLFL 2Y36H 2DRUA 4KI5C 3WFCH 2AV7A 3MXWL 4XHQA 4JFQA 4HS3B 4U6XB 4PV9A 4HLZH 1CZ8H 1M7IB 1BP3B 3V2AR 1K4CB 1TJHL 3K1DA 1NSNL 3VXQB 1CXEA 4HV8A 3WIHH 4U6HA 1ZANH 4OZHB 3ZSSA 3VI4E 5JW4R 4B53A 3TFKD 2BSRB 5BVPL 3PE9A 4AM0B 4YDJB 4JO3L 1OP3H 5HI4C 3KPOA 4M7LH 4AMKH 1FO0H 4P2QA 4CJ1A 3FOMA 5FGBA 4WUUA 3IT8D 1RFDL 5GZND 1F8TL 4KK5D 4Z8FL 3I02B 2AV7B 1P69B 2ZSWB 2XTJC 2DWDB 4TULH 1I7RA 1N64L 4XCFH 3CDYA 4PJXB 4WFGD 2LU4A 3BIAX 4WFHD 4NSKA 4FQIH 4GS7C 4OCSH 3VXOB 5HYSG 1FL3B 3O6KL 1E27A 1G7MA 4OZHA 1EFXB 2PW2A 1K2DB 5I2IA 4BFGA 3ZYJA 2ESVB 2F53D 1XF3B 2GY5A 1KJVA 5DEFA 3VXSA 4U1NB 3SGDH 3QIUA 3MLZH 4JO1L 2HJFA 3QEUA 4FG6D 2RIKA 3OB0H 3NFSH 3HUJB 5JQ6L 3N1PC 3ZTJH 4OAWA 3MUZ1 3K4ZA 4TVPE 3VI3F 2NY2D 2FJGA 5DRWA 1S3KH 2XZCH 1Y6MR 3BW9B 4U1MB 1HZHL 3LEVH 2CRIA 3MOAH 4JG0L 3ZL4L 4NO3B 2OJZL 4ZS7L 3C60D 3IF1B 3U0WH 3BH8A 4OBRA 1EAPA 3F5WA 4N0UE 4ZTPH 3QH3B 1QEWB 4PGBA 4RA0C 4WWKA 3IDYC 3MTRA 3SE8H 2APBA 3U9PL 1UJ3A 3SGDI 1JL8A 4WFGE 4X6EB 2HLFD 2H1PH 1YYML 1LNUB 1A6TB 2E8YA 3KPPB 4HJJH 2SEBB 3DTXB 2CR6A 4R2GB 4LP5A 3V5HB 1LEKB 3D69A 3EYQD 3HZYA 4G6ML 5GZOC 4C83A 3BUYA 3ULUF 3LV3B 4YDLB 5A43C 1A5FH 1A6WL 4NQXB 1MLCA 4PLKC 4HQQL 1HQRA 1X3DA 1IAKA 4HHAB 4NSKB 1FYTB 1CL7L 1NCCH 4OB5L 5DTFB 1T83C 4AG4L 4ZNEA 4Y4FB 1FHGA 5E99L 3X12B 1KN4L 3GNML 5MEQA 3O3DA 4FOMA 2CKNA 2NY1D 1DBBH 3W0WB 1FFNB 3SCMA 2K9UA 2XNAA 3NABH 4X7TA 1KCVH 1LP9B 3BAEH 4DZ8A 3BKML 1DSFH 1OSZA 4WI9A 4HCRL 1J86A 5D7KD 1EEQA 2HRLA 3MYZA 1SEQH 4RZCB 5EOQH 4U49A 3PL6A 5D70H 1XGTA 3S97C 5IKCA 3ALWA 4OFKA 1T80A 5I75B 2D0HA 2HKFL 35C8H 3KHQA 3O3UN 2OR9L 1QNZL 1MQKL 3VXRE 5INDB 4F57H 3JTSB 2P46B 3TH4T 3T0EC 1AD0A 1RK0B 4M61A 2CLZB 4WJ5B 3TBVB 4LVOC 1JNNL 3GJFB 4PJ5B 3GMLB 4E41B 4G5ZL 3CJJA 1J0ZA 4LVNC 2GJZB 5E4IA 3PJSB 1H15A 2XI9A 3C09C 4WW2F 5EH1A 3BD3A 2D0GA 3D2UA 1WWCA 3FTGB 4HWBH 3MGAA 1QG3A 3ZE1F 3MNVB 4FQLL 2NY0C 2YUVA 3AMKA 4MLIA 3L3OB 4H5SA 4ZXBA 5F88B 4ELKB 5MEOB 1HQRB 1T0PB 4A6YA 2ZSVA 1BLNB 3MSPA 2WUCH 3CFDB 5I18H 3LRHA 4PRDA 5I1EL 3PJSA 3S3JA 3ORJA 2F15A 1BHGA 2PETA 1I3VA 5GGVH 3EO0B 3RGVA 1RU9H 1KXVC 2PTVA 1A1NB 2AK1H 1RVFH 3I84A 4HT1L 3HNVL 5GS2H 1ED3B 1TXKA 2VDRL 1OW0A 3QUKB 3Q5TA 4IBLT 3U9UB 1MCCA 3ABZA 4FABL 1HYRC 1SBSH 4F7PA 3C8DA 1C5DB 5J3HC 1D5IL 3PV6A 4AIZB 3ZDXF 4X5XA 1NEZA 2Z4QA 1CN4A 4DOHE 3ES6B 3SDXA 5DJ6B 5CINH 1WF5A 2HFFB 5T3XD 3QDME 1U8JA 2VR4A 3H3PH 4YC2B 1JPTH 1NCNA 3LQAL 5D1XA 1YN6B 5TQ2H 3T2NH 3KJ4C 4JJHA 1FGVL 3D5OF 3SKMA 1S5IH 1RJZB 1EXUB 1UZ8A 3WXWL 1FDLL 4NQCA 5JXEA 1FVCA 1F3DJ 3Q3GA 1F45A 4GAGL 5GS2D 3SE3C 1IFHH 4W81A 1RIVH 1CU4L 5H37H 5HI3D 4HWBL 5FUOL 3L7EA 1A3RH 1F6LL 4JE4B 1NGQH 1P4LA 3P9LA 4PRBA 3S5LG 4P5MA 2NCMA 4LVEA 4MNQD 4U1GC 3N9GL 2JK5B 2BNUA 1GZPA 3V95A 2FX8L 3DMMA 3P73B 4LSUH 5MERB 1U95A 3WFEH 1LD9B 4LRNL 4PB0H 4RDQG 1UM4H 1JNNH 1JI2A 3NCEB 2UY7A 5CJXC 1JHLH 3T2NL 1A3QA 1NAMB 1TTFA 2Q76A 5IQ9B 3STZA 4OD2B 1J1OH 1Q9LB 3IS1X 3ETBF 3MLYH 1TVDA 1K4DA 3ME0A 4GMSH 4JVPA 3P73A 1RHHA 3QZWG 5F9JB 2GJ6B 2VYRE 1IQDB 4Y4FC 1XIWA 4RGMC 1MIMH 1T4KA 3T4AA 4P4KD 4Z7NF 2EDNA 1U8LA 2WAHA 1FGNL 3EO9H 3I9GL 5I73C 4E42A 3F12A 4JM2C 2AEQH 3TIEB 3RVWC 3ZKNC 4C57C 1LEGB 4PJCA 1NAKH 1XGYL 5DGRA 5E6YA 1J5OH 2LU7A 1QFWL 2FD6L 3U6RA 1KN4H 3PQYE 2DYPA 1BF8A 1JGEA 4X80H 3L1OL 1F13A 3W2DL 4DVBB 1OAYL 2Y36L 2HN7A 5T1DL 4GW1A 3F7RA 3DBXB 1LO5B 3UC0L 1OTSC 1MCIA 4V1DE 3DO7A 1G7PB 3BZEB 4FQQA 3HA0A 4JJ5B 1NCTA 1U3ZA 4XP9H 4EBQL 2VDOL 5CEZH 1B2WH 1V05A 2HTLC 2P7TA 1ZGLB 2XQYK 1NMBH 1JRHL 2XY2A 3QZWA 4G8GA 3V6ZA 3WO3B 1BJ1H 1QO3B 2ZPKL 3HRZB 3HI5H 1DFBH 1MNUH 3TO2B 1KPUB 3UPRB 1IGFL 1PLGH 3QWRA 2V5TA 1E28B 2YXFA 5IEKA 4NO2A 4TPRH 4HEPG 4YC2C 4XAWH 2EDQA 5DZOA 4FQXB 5HYEA 1P53A 3AREB 4POZD 5DFVC 3DXAE 2EXWC 4FXKA 5KSBF 3FRPG 4WO4C 1T7VA 3BZFA 4Z76A 3MRQA 2VDKH 3V6ZB 4BSVA 1U8PA 1W8NA 3SJVA 4NFBA 2LABA 2XA3A 5JTWA 6FABH 3UTSB 5F70A 5T1KB 1KIQA 4TYUA 5FFLA 5E5UB 2JJTC 2YWZA 2FEEI 3LS5H 1AGDA 1U8HB 2JELH 5DJAB 3O6ML 1ACYH 3DHMA 5IJVA 2YD2A 1AQDB 2J5LB 3BP5A 1ND0A 4U1HB 3KJ4B 1R3IH 3VFTB 5ISZB 5DRWB 1ZSDA 5BVJB 4BSVB 5CSBA 3WYRA 4M1DL 2PTTB 5IIEA 4G8EB 3RVVC 3MV8E 2BDNH 3H9HA 4KK9D 2A6IB 1KEGH 4F3FA 4YHYB 4U0RB 1Z5LA 3BAEL 3BIBX 5B8CC 1X4ZA 5EOTB 2VIRB 3BH8B 2P45B 5CUSL 1ZA6B 3U7WL 3FZUD 4TRPH 2IH3B 4WI2A 5IJVB 1C7TA 1AH1A 1BBDL 1FIEA 1OF2A 4LCWD 2F5BH 4QXUL 2BY1A 2G75A 1ZSDB 5F7UA 5KSAA 3I75A 4UU9A 2ORBL 1U8NB 5EU6B 4OFYD 3WJLA 2DLEA 2ITDB 4Q6YA 4F3FB 3TO4B 5ITFB 4O9HL 3CVHA 3FCTA 3HZKA 3OKEB 3DMMC 3IKCA 4DVRL 3DI3B 4G8FB 3RIFK 1CD8A 3KXFD 3I3BA 2GT9A 4RNRA 1D7FA 4XAWL 1P4IH 1A4JB 1DR9A 3RBGA 1J0YA 1I7UB 5IF0B 2AK1L 2W65B 3N1GC 4LCIH 4NO0D 2EYRB 5CBEB 4ZNCD 4G80A 4KMLB 1IKNA 2AJSH 1W72A 2RFXA 5CEXA 4G8FA 3QYCA 3OG6B 4OV5A 2OJEA 1IFHL 4H25B 4EI6B 4HC1A 3GSOB 1U92B 1Z9OA 5H94B 2IBGA 3INUH 2Z0BA 5EU3B 1KIUA 4JG0H 3ZL4H 3B9VA 5D4QA 3MFFB 4WU7A 3D25A 4AEFA 3UPAA 5HHME 2DLTA 5CLWA 1I3UA 1HH9A 4GAFB 3DX9A 2GITB 1Z5LB 2DM2A 4PS4L 3LZFL 3L5IA 1G7IA 4A2LA 2ENSA 2D31B 2QL1A 4P5KA 5KSBE 1NFDB 2AEQL 4G6MH 5D96B 5D72L 1PVHA 4I5BB 4FABH 5ITBH 3ZO0A 3L3DB 1X7QB 1CIDA 2PYEE 1FG9C 1IGYB 3IDJA 3ZE2E 2BOBA 5D9SA 3GMRB 3W81A 3RVUD 4NQED 1FYTE 4MQXC 1QPPA 4I4WB 3TNNA 5LBSL 1K5NA 2C3WA 5AEAA 2HAZA 3MLYL 4QTIH 3FB5A 4LEOB 2FX9H 2P8LB 4AT6B 1JHTB 3LQAC 3IDIB 1G6RH 1LK3H 4HH9A 4NQVA 5ANMA 2COQA 1CTNA 2R56L 4MQXD 4L3AA 4AQ1B 1TZIB 1OTUC 2Z91A 3W39B 2P8PA 5E8NA 1CE1H 1D9KD 3V9FA 4ONHA 4UUJA 4JAMA 4OIIL 1XGQB 4PY8J 1L4IA 1DBJH 2D3VA 1CZ8L 1YQVL 5GGSY 1JGDA 1GIGL 2VXQH 4WHCA 1JK8B 3CFKA 2ZKHL 3VXOA 1TZHB 3F7PC 3UROR 1P9MC 3GSNB 5BO1H 1VEMA 3B9KC 3B8YA 3B9AA 3BYTA 4KGLA 2FCBA 4DFHA 3D48R 4JFXB 2J8OA 3B9KD 3DJ9A 5HHVL 4KUZH 4MAYB 3MRJB 3VDAA 4LASH 4PJ7A 5CEYB 3P40A 3FQXA 3LKNA 4R4FL 32C2A 1QNZH 1PDKA 2VITA 1C5DA 2QADB 4ZUUB 2DLHA 3CDGB 2O5YH 4NKDA 5CINL 3DMMD 2QHLA 3QISA 4U1JA 1F3JB 2IQAB 3CFBA 1YYMH 2BJML 4UOJA 4LK4A 2NZ9D 3R4DA 3WLBB 5GS0L 3MNVA 4JHAL 4D9LH 5D1XB 4DUWA 4HBCH 4APQA 1JPST 3H9SB 3QCTH 2OSLA 5HTSA 5GGRY 2CDEB 4KKCC 5L88H 3MRKA 1WCBB 5GHWH 1RZ7L 3I6KB 5J1TC 4GKOA 5C6PB 3C2SA 4X9IA 4XPGH 2HMIC 3MXVH 4M4PA 4Y1AB 5C08B 4OZFH 4CBPA 3GBNL 2NY4D 2QADD 3WHE0 1NGPH 1MHHA 4RAUA 2APFA 1BGXH 1CYGA 1JBJA 3VXNB 3G5XB 5I0ZA 4FZ8H 5B39A 1KCRL 1T03L 4S1SH 1ED3A 4P3CH 3SDDC 5GZNC 1T0MB 3OZ9L 2FEDD 2W60B 4R0LB 1DCLA 5J12C 5JQHC 4H26A 1TQBB 4Q6IA 4TNVF 1KB5B 2BVPA 1XEDA 4NT6B 1D6EB 3U2SB 5JDSA 4P4RB 3MROA 3MV9D 1S9WA 2BVOB 2X89D 3PWLB 2R0ZL 4PJBF 5DJXB 2AEPL 5IT2L 3MRCB 4J3VA 2P5EE 4MA8L 2YD8A 1KN2H 1J0HA 1HWGB 5CEZE 2B8OT 3FT4B 2GJ6A 1OAZH 4N0YH 1ACZA 3HKFA 1KTLA 3VXSD 5BS0E 4ONOA 3KPNA 5I8OL 2DI9A 5C0BA 5C0GA 1SJEA 2AI0L 2VXUH 4FXLA 3S88L 1EXUA 1T3FB 3OQ3B 2GY7B 4K94H 1KCRH 4WO4D 5DQDH 2VXSL 5IK3B 4PJ9D 3BN3B 4QTHA 3KYNA 1MSPA 3WIIH 3HE7C 3NTCH 4PGEB 5GRZA 5DXWA 1E6OH 1TENA 3QIUC 5INDA 4ZO6A 4PYHA 2YK1L 4Y88A 3MOQA 2OM5A 5SWZD 2HH0L 2H2PD 2VQ1A 4MJ5A 2J2ZA 3ZTNH 5I8CB 3OJ2C 3ULSA 3QJFA 5ACZB 3C6LA 1ZLSH 4U0QB 1J9CT 1NANH 4QGTA 2A73A 3HR5B 4XNZB 1RJLB 5FV1L 3ALXA 3ARGB 1J0KA 3RUGE 2FGWH 3P77B 4NC1C 2R2HB 5CJQL 5GPRA 4HKBB 1A3LL 2B7DT 5ALCH 3CFIC 4Y4KD 4RBPH 4X7TB 4K3GA 5FB8B 1WBYB 4MX7B 2KPNA 1IGFH 3RWGB 2R29L 2D9CA 4GQ9L 4HSQA 1BQLH 1I3RA 3H2WA 3OGCB 3BKCH 1J1PL 5FKAB 3CLFL 3DNKA 2DJUA 5EOCH 1PSKH 4LLUA 4JM2B 3U2SA 1PX3A 3JV6A 5CHNA 2FO1A 1LO0H 4H20L 4PJDF 3PHOB 3BJ91 1C12B 3I3EA 4KUCD 4K71C 3T0BA 4QRPB 2YD5A 4Z7QF 2R4RH 4M9OA 1IT9L 2MCPH 2X70B 5EBMA 3RVXC 3ILPA 3LVEA 5I8KH 1N59B 5LCVH 2GTZB 3GJEB 5CJOH 5T1LA 1KLGB 3OKYA 5C0IA 5JR1L 5JMRA 4JJ5A 2XN9B 1CFVH 2X1WL 1U9KA 2VZ3A 3QUXB 4NYLB 3OAZH 1TJGL 4TUJB 4X6CE 4WO4A 5FECB 3BKYH 2GIYA 5GXBB 2OTUA 5DJDA 5FHBH 2E8ZA 4OLZL 5GGRA 1EERB 4NZRL 5DLML 3RJQB 2B1AL 2I9TA 3LHPH 1WUNT 1QSFE 5EO9B 3KLAB 4ZOEA 4KRNA 3KGRA 2B4CL 2EDRA 4G8IA 3HR6A 3GMPA 1N2RA 4LCCC 3QUXA 2YPLD 3EDKA 3O6FA 3TJEH 4HK3N 1YMMB 4P2CG 2OZ4H 2YUWA 5F9OL 3GGWB 3PIQA 3RWJA 3JZ7A 1FZOB 5KS9A 3HC4H 5F44A 2PW1B 3SDXF 5KSBA 5L6YL 1WAAA 5D2LE 4AM0A 2HFEB 4PLJD 4XP6L 1MVFA 3KLAA 3PWNB 5SWSB 3K0WA 3VGEA 5KTEH 1V3LA 1CU4H 1N0LA 2DWDA 4L4VE 4Z7UA 1U91A 5TPWL 4MSWA 1D5MA 4HX1B 5E9DB 2YA2A 1FN4A 3HN3A 1I9IL 5MENE 5ID0A 3ULVE 5C09B 4LVNB 4PGJA 2WBJA 4GG6B 2WLYA 1QFOA 4U1SA 1KXTB 5J12B 1FNSH 3KPMA 4KWUA 4LSTL 4Z7WB 2NX5B 1OB1A 5C0CA 5C9KA 2XZZA 3GK8L 2EC9U 4OF0A 5B38G 3MJ8A 3RGVD 4G9DB 2HLAB 3C60A 4EDXB 3CK0H 3VD4A 3SGJA 3QDHA 1R3LB 4HX1A 4FQPA 4R90H 1FYHB 3QCUL 1GRWA 1H3XA 2OL3A 4PFEA 4RAVA 3RGVC 2GHWB 2Y23A 3FFDB 2BJMH 5D2NE 4H8WH 1KLUA 3UO1L 1EAPB 5KVEL 3GSNH 4IOFC 1INQA 4X80L 2OP4H 3KLHD 1FJ1A 2ZOKB 3MLXH 4XXDA 2E9BA 4NRXA 4U6YB 5F7EL 1RZFL 1BOGB 3B6SB 3NAAL 3RI5K 2QQKH 3WDJA 2OL3B 2OZ4L 4QGYA 1I8KB 2W9LA 3BYYA 1S78C 5DHXB 4YLQT 3LN4A 3W9EB 1KLUB 3VFWA 5I1LB 4P57B 3LKRA 5DO2C 5EZOL 1J8HB 5DEFB 1YNKH 4NNYB 3RA7H 3D85A 4IDLA 4U6VH 1RIHH 1A3LH 1JPSH 1PFCA 4HJ0C 1QP1A 5ALCL 1SEBA 5CZXC 2ADIB 2CKBB 2VZSA 1OT2A 2EH7H 4PUBH 4OLXH 2YUXA 1FN4B 4JFQB 3VXTB 4HUWB 3QIBC 3NA9L 3GIZH 4PRIE 3DX9B 4FZ8L 4U7SA 1OWRM 1TQCB 3IFOB 2M2DA 1BAFL 3SDCA 4AEHL 2Z31B 3ULUC 4ODVL 1FL6B 5FGRA 2F8OA 1OHQA 5CKGA 1AC6A 1G7HB 2J8UE 4TTDD 1QQDB 4L3CA 4CW1B 3IU3B 3BH9B 4D0BA 1A6AB 4JGJA 3SDDD 25C8H 1Y0LB 4JQVC 3WD5H 2EDOA 4M7JH 4JB9L 1MAML 3MX0A 3V5DA 1M05B 1OPGL 4YHZH 2DQEH 2VL4A 1NC4A 4JZJC 5GSRA 1FO0A 5IJKA 3FO2A 3M07A 3BKMH 1XIWC 2WNGA 1HKFA 2C3HA 1D5XA 1DQDH 1DEEB 1A6AA 3BEVA 3FB7B 3O4LA 4HKXB 3GMQB 2VKWA 3MLUL 3EDFA 5KAQG 4MQSB 1S7VA 3OB8A 3AREA 3QUMA 3O3AB 3FOLA 2XXMB 4EUPH 1XCQB 3T04D 3ARXA 4KRPB 1R5IA 1U8PB 1ROWA 3SJVB 2P42B 4NN7C 4G43B 3QXWA 5AWNL 3PGDA 1AHWA 3ZKMC 2BVUA 5C08A 2BFVL 2YZ8A 1ES0B 2IPUG 5D7SH 3DUUB 4U1LB 4ZPVA 4QCIA 4FFVC 5DMKB 1ZHKA 2DAVA 4JFEA 3BEVB 3FB7A 2VN7A 1GGCL 2MCG1 4L8SB 2AKRB 2R2BA 1T20A 5F6HJ 4KKAC 4ELKA 1TETH 4JDTH 2BVQB 3PHQB 3WO4C 5C0CD 4HCRA 3KPRE 1WICA 5L88L 3QUYB 1A9BB 1OW0C 4ONGL 1E4XL 3O0RH 4DGYH 2H9GA 2CPCA 2VSCA 4RFOL 5KSUB 4W68A 5DA0B 4ZFOB 3ZT6A 4FQHA 1ZT7A 4H1LA 1DP0A 1LK2B 1A1NA 2NY7H 2P5WA 1MREH 3VGBA 5DMGD 1MHCA 1W72H 2EDWA 3HE7D 2Y1VA 3H9YA 1LMKA 3QXTA 3SDDA 4OSUL 2WIIA 4YBLB 4ZUWA 3PWVA 1DBKH 5FYLH 3OKNA 4ISVB 4P9MH 4HIIA 3T65B 4ZFOA 3WL9A 2Q20A 4GSDL 3FFCE 4Y16C 2YN3A 3OAYH 5IVXA 1E6JL 3VMOA 2ED7A 5B38A 4S1SL 1F97A 2ZCLL 4PJFB 3DGGA 4H5SB 5I1KH 1CFQA 3FOLB 1C1EH 5J9PA 1NEUA 4XPHH 5CIPA 3V5KB 2W60A 4L9DA 3O6MH 3T0XA 5T1KD 1QLEH 2VLRB 4MVBD 4YHNA 2IPTL 5GISL 4MD4A 4D8PB 2E7BA 4JRXE 4XPTH 2P5EB 3HE6C 2XRAL 1YQ2A 5HGDB 3QEHB 4K07A 2VLLB 1MJ7L 4RMSA 3HE6D 2CK0L 3C60C 2IC2A 4OFPA 4K8RL 5F21B 3V4VH 2BNUB 1CVSC 2HT3D 2CRZA 4ZAKD 4JPVL 1IL1B 4PGCB 4WFHE 4JANB 4ONGH 4NUJA 3JVGC 4KMTL 3S35H 4HG4K 1T3FA 3ARBD 1BFTA 4E5XA 3VFVB 4LMQE 1OAXH 2VRAA 1CBVL 1AD9B 4NZTL 3ULUE 1UQSA 5FKPA 5IB4B 4MMZC 1UT9A 1BD2E 2CMRL 1KYOJ 5DRXA 2DQDH 2NLJB 5ICYB 5KS9E 3HRPA 1KJ3H 4MDJB 4PD4K 4QXGL 5CZVL 3ZDZF 4YR6A 1XIWB 3CLFH 2H3NA 2E7HA 1CXHA 4CUCA 3RPIA 5TF1L 5IW6B 2R69H 4KROB 1BLNA 5TE7H 1FVCB 1WC7A 5BO1L 3O41B 4PJ8C 3MV01 2BXZA 3TIEA 3BZ4A 4PG2C 1I8IA 5FM4A 1PQZB 3DWTA 4XTRC 5D7IB 3O8XC 2HRPH 5H35B 2Q8BL 1NGXB 1OAUH 1NQBA 5GGVY 3MRIA 1NDMB 1CD1A 3KJ6L 4WI7A 1UB6B 4XBGB 1FNGA 5D7LA 2VXVL 3QUKA 3CFKB 4F7TA 4QHUA 1ZS8A 4Y2DB 4Y4FA 4S1QH 5D7IA 4L9LC 5HJ3B 2OI9B 3GBML 4N68A 1IZKA 1P4IL 1L7IL 2MKLC 4B41A 1MVUB 4O2EB 2X41A 3BXNA 3FO0L 5EZJB 4PIRF 5B3JE 2X4UB 2VUYA 3PQYD 3FB8A 1NCAH 2DJ4A 2FJHB 5D7JC 5T3ZE 3BPOB 1WIPA 1WWWX 4A6YB 3LKNB 1DN0A 3MUGA 2IBBA 2XG4A 4X5WB 5F72S 3QDJD 4ZUUA 4EQ2A 2BHZA 1ODAA 3ARTA 2EEDA 4YHKH 3CPLB 1T66C 1MVUA 1F58L 1RUAL 2P5ED 3CU1A 3FAWA 1A7RL 4JG1H 4O2EA 4I3GA 4KY1L 1MNUL 3C9NB 2CK2A 4H0IA 4NZRH 1FH5H 1XH3A 3VFRA 3AROA 2FIKB 1B0GB 3VFOB 5FO7A 1T7WA 2BOCB 3O9WA 4LDOB 4RWYL 4UQ2B 5TDPA 3I6KA 1FZJA 5DK0A 2NY0D 2Z4QB 2BSSA 5D1ZB 5EFIB 3SBWC 4G7YH 3VWKA 3X3FL 1YUHA 2KZWA 2MJWA 1JWUA 3MMEA 3D0VB 2YRZA 5EOTA 3FO0H 1KJ2A 3PXJA 3TF7C 2Q7NA 4NN6C 1KJ2L 2B5IC 4G3YH 5D1QC 1R3KA 4X98A 5MI0B 4X7SH 1NKRA 1MJUH 3GMMB 3CVHL 8FABA 2E27H 4WNQA 1IVLA 4KROD 1M4KA 3QCUH 3V7MA 4OLYL 1I8KA 1JWUB 3V0VA 1RVFL 2PO6B 4JDVA 5B22A 3MV7B 5F1IA 1ULVA 4LSPL 2W92A 1FFPA 1RURL 2CRYA 5D7IF 4E41E 3RZWA 4JRYA 4NNYA 3BP4B 3GJFH 1R5VB 4ZFOL 5IM7A 4CMMB 2Y5TB 4XPFH 5DJ8B 2VDPL 1SEBB 2Q7YA 4X4XA 3GO1H 1PG7L 5E8OA 5DJYB 2YC1A 4HIHA 4LVHC 5C9JB 1EGJL 1F3RB 5BVJA 1DN2A 1PKQA 5IG7A 1HEZA 1QR1A 2XQBL 1MFAL 4LSUL 4Y8AA 4Z7VB 4DTGL 4IRSC 4LCYB 1EHXA 2VQ1B 2YK1H 2ED9A 4TSBH 4XNMB 3P4LA 5IVNA 1DQLL 1TJIL 1IAIL 5C2UB 4XXDB 1CGTA 3TBTA 5IMMA 2J4WL 2AJYH 2AXGA 2NY4B 4X0KA 4NPYA 1OQXA 4F2MA 4ZXBD 5E70A 1M6OA 2GJ6D 4GG6E 5I30H 2V9TA 3N1QC 4ELMB 2JTDA 4L4JA 1KUMA 2NYYC 1RIUH 5FA3A 5JO5A 4AEHH 1XZ0A 3MPCA 3WNNA 3IXTA 1CGSH 2RQ8A 3VXUD 4KROC 4HC1H 4P57A 1QSFD 2QV2A 2DF3A 2P47B 3JVGA 5AUMB 1JYVA 3MZGB 5D1QD 1KC5L 1SMOA 4L29A 1VEOA 3F7YB 4KHXH 4CRPA 1AXTH 3QNXB 3VRLE 4TVPH 5JW4N 3QUML 2NY0B 3O6FB 1CLYL 3GSXA 4LFHG 4OGXL 2VLJD 1S78D 1HOCB 2X7LB 2EO1A 1FP5A 3DXAA 1FZOA 4N1EA 3B8SA 1K2DA 1L0YA 5GJTH 5I2IB 4DJMA 1E4KC 1U92A 4BQCA 1XMWA 4PRNB 3WHXA 3QIUB 3VD5A 1E28A 3QR2A 1K6QH 1PD6A 4PRHA 3VG0H 2X4TA 5C0JB 5JOPD 3ARED 4YHPA 3VG9C 1AR1C 2ZNWA 4I18B 3HCVB 3NPSB 4ZFZA 1HHJA 4N0RA 3I75B 4UU9B 5D2NA 2E7LC 1IM9A 2BY0A 2VN4A 1ZTXH 1QFPA 3ILQC 1OSPH 4GW4B 2AK4B 1MLBA 1A7NL 5CWSA 2EDTA 2NXZB 4JLRB 2YPKA 5ICXA 1CR9L 3MLWH 1NDGA 4Z7UF 4XVSL 3I6GB 3IRZA 4HXBL 3D18A 4I18A 1AR2A 1HCFX 3HI1A 1C5CH 1TDQA 1CICA 4K23L 3CLEL 3SJVE 4NPYB 5E2TH 1GGUA 1E0OB 4Z7WF 5IIEB 1EEYA 4JKWA 1NGWA 4NWTL 5HDQH 3TCXA 3UTPD 1MLBB 1KT2B 4M5ZH 3VH8B 3WFHB 4K94C 4JEGB 3FHAA 4APQD 2X1PA 2J8UB 4QY8B 1INQB 2WBJD 2PO6C 2YD4A 2OJZH 1BD2A 3MGTB 3NACL 3BVNA 3RY6C 4NRXB 4U6YA 4P48A 2FX8H 5CAYB 3VG0L 2AJXH 4R97B 3LS4H 2OZ4A 5HVHC 4YHOH 2ADJB 2JCCF 1P5VA 1F6FB 5K9KB 1FFRA 1D5MB 5GSVB 2VXSH 5JNYB 4OGYH 3MJ9L 5CJ8A 1T89A 3T0EA 3OXSB 3V4UL 4YHLH 1DLHB 2I25N 1M7XA 5JUEH 1FSKC 3VMPA 4OT1L 3IXAA 3MUHL 1F4YH 2LTQB 1G0YR 1MUJA 1LP9A 1N6QH 1VERA 3ZKXB 3WXVL 2P49B 3MRPB 1BOYA 4L1HA 4NIKB 4WEBL 1PYWA 3RNQA 2Y72A 5A2KH 1SY6L 3IFNL 4R7NA 5B4MD 5GGTH 5EU4B 4LHUD 4IIQB 1MFEH 2LE9A 2MWCA 4KKAD 5L8JB 5E2WH 4PB0L 1CS6A 2OR9H 1T03H 1JNHA 4D0BB 3VFUA 4YR6B 3KPRB 5IHUL 1CFQB 4L8DA 2A74A 5J1SC 1UJ3C 2HJKB 5D70L 1VADA 1WVZA 3HMWL 1PKQE 1M05A 3MXVL 4DN3L 2X42A 5I15L 2C3GA 1FIGL 3KYNB 5GGQH 1JPFB 5KVGL 1CK0H 1NCDL 1B90A 3G5ZB 3PP4L 4ORGB 2Z8WC 3W0WA 3INUL 5FCSH 1S5IL 4LPTA 4HJGA 4XI5C 3WNMA 1LDPH 4PJDE 1AFVH 1QLFB 3TNNB 3T2PA 4CN6A 2AJSL 2EDJA 1JWMA 4DWHA 3GUTA 4QHUB 1FLTX 3U82B 5CCKL 4JO1H 3GSUA 5DMKA 3VRLF 3RRQA 4XCNB 5BW7C 3JV5A 2HWZH 5EZJA 1S8DB 3VGHA 4Y5VB 1FGNH 3S35X 1KLFA 2YEZB 4N8PA 4OIAA 4P5TD 4YDLC 3P9MA 5DHVB 2BVQA 3O11B 4V2CB 3RUGF 4HHAA 3LIZL 2YZ1A 2AXJA 5F7YC 1GC1L 1SY6H 2XKNA 5F3HB 2X44D 3SGEI 3S3SA 4WEUD 4LPUA 3DO3A 4XB7A 5KSUA 2D31A 1E6OL 4ZAKC 5H2BA 3WSQH 3D3VD 3WIIL 1QUNA 3MLTA 4HFUH 4DZ8B 2H6PB 1U8JB 5EPMB 4NN7B 2E7MA 5GRWA 3UJJL 5F7NC 1C16A 1UCTA 1PBYA 5FO7B 1HNGA 4XRCB 3LMJL 2VDLL 2P4AB 5DC0A 4P46B 3WUWA 1R3IL 4PGZA 4PRPE 4DW2L 5B3NA 4ISVA 5CLTA 1ZA3A 2JJTA 2PW2B 4MXWH 4OF3A 4FQCH 4MWFB 3VXME 4Z77A 1MRDH 2ZJSH 4R96B 2V2XA 5FUZH 4ZOAA 3X11A 1RK0A 3FMGL 3WDHA 3DETC 1SVCP 3TM6A 4UUJB 2WWMC 4EN3C 4NQEE 4Y16D 3LKPB 3VFNB 1MLCB 2AQ3A 4WWKD 4DN4L 4Z6AT 4OZIF 2K7PA 1VFUA 4TSCL 5E4EB 4ZDHB 5MP6L 2L7JA 4NO0B 5CZKA 5DD6B 4M8QB 5ECJE 2E9JA 1HDMA 1FNLA 1VHPA 1EPFA 5E2VL 1KACB 1T2QH 1FVEA 4HXBH 4AL8H 3AAZA 3DX8A 3U36B 4WUUE 4UTBH 5D71H 3ECBA 1ZHNA 4QRRD 3WIHL 2FGWL 4KZDL 1I85A 1XH3B 3VFRB 1UC6A 2AVGA 2ENYA 3B2UD 2NZ9C 3M8OH 2ICEB 4X6FA 4GQPH 2Z31C 3G08A 1KJ2H 4Y2OA 4PJEA 4GW5B 2XRAH 4ZFFB 4MB5A 2JB5L 1I1AC 4JPIB 4GJTB 4KJWD 1R5WA 4IJ3B 3WEXB 5FDWA 3KPMB 1TVBB 4KJWC 4H8WC 1T1YA 5LXGL 2H3NB 5ACLA 3ZMRA 4PREB 3T2OA 5C71A 3V0WL 4TSCH 5FGCB 5IFAH 4NHUB 2F74A 1NBVL 3X3GL 2AXGB 4X0KB 5I1AA 2GJZA 1L0XA 5IR1A 3F6IA 3F7QA 3U4EA 5IEHB 4XWOD 4M6ML 3GSRA 4KDVA 2IADB 4Y7MA 4KC3B 5HGDA 3DIFB 3FFCB 1P6AB 4U6TA 3MRBB 3DX6B 4AIOA 5KJRL 4YAQB 2WMPA 3S36L 1H0DB 4WEMB 4DKEL 4N1HB 4X99B 5ICZB 2NY1C 4P46D 2CDGB 4NKQB 4HKBA 4S10A 1LDSA 4M1CD 4ALAL 4X4YA 5C07A 2AXFA 3AUVA 4I48A 2ILLA 1HI6B 4RMWA 2JK5A 3K80A 1PY4A 4NZUL 1WGOA 4JFFA 5JA9A 5T1KA 3WS6A 1EO5A 4M62L 3RQ3A 1A2YA 5LGKA 5GRUL 2GAZA 5JA8B 1A6VL 4DTGH 5F7HA 5ADPH 3QDJE 5IFHL 4E0RA 2CKBA 3QJHB 3QRGH 4GW5A 2HTKD 1WC7B 4X5XB 2VDKL 3NCBB 2IG2H 3LRSB 1L7TH 4QTHB 4G8EA 4XVJL 4QXWA 5FYLL 1HIMH 3MCLL 1XF4A 1YMMA 1T5XB 1HILB 4NKOB 5I16A 2UY6A 3CH1B 3VXSE 1G9MH 4U3XA 4KTEL 1IC7H 5AUMA 3QHTC 1YEFH 3LDBC 1I9JL 4FFYH 4JKPL 4FXGA 2HFGH 1EBAA 4LASL 4WU5A 1QOKA 2ZUTA 5I66A 1NCWL 1UEMA 3BXNB 4Z95L 4PRBB 5JPMA 1A1OB 1G6VK 5I76A 1IILE 3PABB 3FB8B 2ZUWA 4FQCL 3RKPA 2W0LA 5A16A 1TZGH 2GK0B 4XB8A 4H0HB 4BZ2L 1Q9OB 4OLVL 1MHPH 2FSEA 4TSAL 2FD6H 5GJTL 5C08D 3G6JF 2OL3L 3U30C 5IHZB 1T83A 1CICC 2QQNH 1QRNB 2M26A 3QZWB 2UWEE 1MJ8H 4UAOB 4YE4H 3NA9H 1UWGH 1U8OA 3VA2C 4OD2A 2NNAB 5ALBH 3VFSB 3PGDB 2GQHA 1G7QB 4OV6F 4XNZC 3MV9B 1XF3A 3TCLB 3EYQC 3QPXL 1QLEL 5HD8C 3WIHA 2F53E 3EOTL 3C8HA 5JIIA 1X5AA 4XX1G 1F4XH 1XGPA 3MYJA 1V7MH 2PXYD 5HHXH 1RJZA 3SDAA 3IGAA 3TVMC 1ZEAL 2F5AL 2YRPA 2ERJC 1H8SA 4JY6A 2R0KL 1UYWH 1BJ1J 3OKKB 4LVOB 4UDTB 3CXHK 4YHLL 5FIEA 1QSFB 5E6ID 3UJIL 3C2AL 4Y4KC 5IB5A 4P5MB 4LSRL 1F5WA 3EJJX 1EJ6A 4U4BA 4XCCH 4MJ2A 2V17H 2W9DH 4I0CC 1JNHB 3N9GH 4BJLA 3SKJH 2D2OA 2DQUH 4G8IB 4HXAH 1VGKB 1FO0L 3EDDA 3MRRB 3H9HB 5M7QA 4JO3H 5D7LE 5EBWA 3LS5L 4XAKE 5HDLA 3RTQD 4QHLB 1R5IB 2XQYG 3O81A 4KQ4L 4QRTA 2BNRE 1RZGA 4KKCD 4OLWL 1A4KB 3ALPA 3QIUD 4Y19E 3GSOA 1WSST 1U36A 4R7DA 4JFEB 4NN5C 4KQ3H 4XCEA 1YC7A 4I0PA 4X6CB 3H3PL 4XVUD 1F11B 1HQ4A 3GIVB 1T04A 2OXHA 4OI9A 3MV8D 3QHZL 5A2JH 2O5XH 4Y1AE 3R8BB 1CL7H 3SGJC 1QRNA 3UTZA 5TE7L 5ADOH 4QHLA 1AGBA 4HLJA 2FB4L 4UINL 3V5DB 3IJSA 1FVDA 5T1LD 3QUYA 3BPOC 3HPLB 3MLSH 4LCUB 4DGVL 4K7FA 4NC1E 3IJYB 1BM3L 5E2WL 3IFLH 5CGYC 1FL5A 4LAJH 1NCBH 2CJUL 5I17B 4XI5D 5JOEA 4PGBB 2FH8A 4K9EL 4RISL 3MLXL 5SWQA 4P2QB 4RRPG 4PJ7B 5CEYA 1I1YB 3PNWA 3GMQA 3BZEA 1FZMA 4PD4J 4L5FL 1Q38A 4L4TB 2FEDC 5D2NB 1KYOK 2D0FA 2VZTA 4L8DB 4Z5RA 2IBZY 5CSZB 4ZUWB 4YO0B 3S37L 1S9KC 4URTB 3T65A 3S7GA 2ZCKH 2IANE 3MO1A 3WNPA 2LAAA 5ADOL 1G7HA 1EEZB 1MWAB 2NR6C 5E9DE 3OV6A 5KW9L 3VI4F 5IEKB 4KPHH 4M61B 4WJ5A 1MH5B 4JAMB 4AEIH 4ZUVA 2PN5A 2ITCA 2E9IA 4OLWH 2QSTA 4MD5B 2J8UA 4IEFB 1V7NL 5HI5C 1BVZA 1ETZA 5A3IC 3B9EA 1A14H 4LGSB 2IPKA 5FF6B 2ZG3A 3UTSA 1IEBA 1CCZA 2V6HA 2QSQA 4ODUA 5DR5L 5EUOB 1JHLL 3SE4C 3SE3A 3SEPA 3FL7A 2AXHA 4TOYL 2DL2A 4PRHB 3T0EE 4EUPB 1WAAE 4Y5VA 3LH2H 5CP3H 4XH2B 1AQDA 3I50H 3SKJL 1JYNA 1AO7A 2RB8A 3ARZA 5F9AC 5DQ9B 4GKNB 5FO8B 1L6XA 2X9YA 1AGBB 1U3HD 1Y6KR 3H0TA 5KSVB 5JDSB 5C7XH 4O2CA 1ES0A 4P9HH 4R2GC 3MOBH 1VFBB 3G5YB 3U0PB 1BFVH 4PP2A 1EHLH 3FRUB 4QHMB 1ORSB 2XQBH 2B4CH 4WHTB 3C5ZC 1RUKL 3L3KA 4F7CB 2H32H 1YEEL 2PTUA 5CD5D 5HYIA 2XWBA 4LAQL 3G6JA 4X6DB 4P2OC 3V6FB 2C7UA 2H9GB 4EEEA 3VH8A 3O2VH 2ATKB 3QO1B 2DD8L 2NX5D 2EYTA 1IQWH 3ARWA 4HFWA 2GTWA 3IAGC 2FBJH 5T33H 3FQXB 1YEKL 1MH5A 3HNSL 1U6AL 2Y7QB 4KZDH 1I85C 4Y4KB 2VLJB 2ZSVB 3R8QA 4PJGA 3VFPA 5IHBA 2CGRH 4LQFL 4YDVA 4DAGL 4HUVB 1YEEH 5KSAD 1VSCA 3WNKA 5DJ2A 4GXUM 4RSVA 1X5FA 3QIBB 4OFYA 4YPGA 3RX8A 4JHBA 5C0EA 1VACA 3QIWC 4D0CA 1ZHBB 2DQTL 4OKDA 3V6OA 5F7DB 5F93C 4HWBA 5TQ0L 1RV6X 2BC4B 1CDCA 1IAKB 2HG5B 5F1OB 4NHCH 3OPZH 4ZUSB 2VE6A 1SJHA 1X5YA 1SHMA 4NN5B 3H42H 3HC4L 4NQDB 4N8VA 4PJBB 2E6PA 4RMUA 3CCHA 5FK9B 5EIIB 1IRAY 4IHOB 2YA1A 5IQ9A 3MLVH 1NGQL 2DQUL 1VFOA 2PYED 3S96B 5M94B 3GJFK 2YD6A 1INDH 2VUOA 4R4NC 3KYMB 1ZXQA 5D7KE 4Y5XC 5DR5H 4UT9H 3QUXD 4OZ4B 1E6JH 2AP2A 2X70A 5EBMB 3EFFA 5I1IH 5CZXD 1ZV5A 2A0LD 5I8CA 4IMLA 5GRJL 1XR9B 4G7VH 3RHWF 1T1XA 4TVPL 1MJJB 5AZ2L 4E0RB 2BVEA 4KXZI 5DJYA 1F6AB 4MA1C 4XPAH 5ILTL 1I4FA 4HW6A 5TQ2L 3TBWB 5L2KA 2BSSB 5D1ZA 5HDQL 4TQEH 5DUPL 1TCRA 1N64H 4XCFL 1QA9A 2CLRB 3T77A 5DRXB 4LP4A 4JFFD 1C5CL 5IGXH 5I1CH 5HYJA 1KB9J 4KTDH 2I5YH 4M7LL 3RWGA 1NJ9A 2EIZB 3S36H 4JHAH 4D9LL 2X4PB 3GI9H 1RQ5A 4OGZA 4FA8A 1TZHA 5DJZA 3RIAK 4J3TA 3LAFA 3KPSA 1CXKA 3GSQB 4G9FB 5JW4Q 1BQHG 5T3ZL 1DBBL 1PEZA 3DOSA 5IBUG 2MQCA 1DJSA 2W59A 1HSAB 4NFCA 1H3WM 1J12A 5JIHA 4JFFB 4DEPC 1RHHB 4XBGA 4PJDB 5FOBB 3TIDB 2FL5A 2PYFA 1UXWB 5E8EA 4H88H 4PGCA 5JDJA 4F9LC 3KDMA 3OXRA 5E6IC 4LKCB 2YC1B 1WJ3A 4HIHB 4WGVB 3Q6FB 4PJFE 3CC5B 2CMRH 4U1JB 3OB0K 3O3BA 2WWKT 1IGTA 4LPWA 4WIQA 1QSEA 4XP1L 4PJDA 5FOBA 2VLKB 5C07E 1IM3B 1FQ9C 4PJ5A 3FQRA 4KXZH 4PB9H 5JMOC 1R3KB 5EUOF 1DQMH 3KVQA 1QLRB 4OD3L 1NMCC 4EN3B 1HINH 3BDXA 5KTEL 2VLME 1J0IA 4P2RE 3GMOB 15C8H 4MJ6B 4DUXA 5I1CL 1QR4A 4K9EC 4LFHD 2H2PC 1CICD 4KI5F 2V17L 4EXKA 3QDJB 3QJFB 1NL0H 4W6YB 5ACZA 5IVXE 4PJCE 3SQOL 1JNJA 4PRAA 2OQJA 3QEQB 3ARBC 1ZLUK 4CMMA 4MAYC 2DOCA 5I1EH 1HH6B 4P23D 4LVHB 2XN9A 1UM5L 4Y2DA 3BRFA 1YPZB 3GSRB 3MRFA 4ZAKA 5ESAA 5TDOB 1AE6H 3QUXC 1CLYH 4KRLB 2R0ZH 4N0FA 4D3CL 4LCYA 3VWJB 1NFIA 3C6SA 2ICCA 1MCQA 4Z7OF 1NKOA 5LG1A 1TPXC 2V2TA 4X98B 4U6VL 5E1AA 4QWWD 5EC2A 4WENB 2J12B 2Y9RT 4X99A 4K2UH 5D5MA 4O2FA 2J88H 1ZGLM 5CJ5A 5FYJH 2VLMD 1QBLH 3JV6B 4P2RD 4MJIB 4U2YA 1UA6H 5TQ0H 2VDMH 3CX2A 2A38A 1P5UA 1FLRL 2DIBA 3ULVH 3TBSB 1WEJL 2L4OA 4GRWH 1YNTA 3RX5A 3ZHLA 4HS6B 1H9VA 2HJLB 4HKZA 4C58B 1KPUA 2XYCA 4X6CF 5I1GH 1TVHA 4QOKD 4KTYA 4OZFA 1LO0L 1RJLA 4KFZC 3EZ8A 5AZEH 4PV9B 2A83B 3MODH 5E5MA 3LZFH 2FO4A 1OAKH 4WFFD 5HD8D 5TE6L 1GHFL 3NIDF 1MCNA 3NABL 4CADA 4NDMB 2ORBH 2Q8BH 1EX0A 3QXVA 1EEZA 5DD3H 3VXRB 3GEWB 4QRRB 2AJ3A 3FOMB 2NMSA 3O45A 3B43A 3BX7C 3FQWA 4Z78A 5CUSH 3AS2A 5DK2A 3TYFB 2X5PA 1RMFH 5HHOD 1AE6L 3W0WD 3ZT7A 3FB5B 3G9AB 2EDLA 4W6XB 4XZUA 4N0FB 1C7SA 4UT9L 4GLRH 2O61B 1Q72L 1CL7I 5F9WB 1GGBH 2ZWLT 4K7FB 1FCGA 3BMVA 4EOWL 2DQFA 1A64A 4MHHG 4MQ7A 1MWAL 2FDBP 1B4JH 3VD7A 2GTZA 1PZUB 2OI9C 1INEH 3NZHH 1XGQA 1U8LB 4X6DF 4Z7VE 4TULL 2I27N 4GKNA 4HC1L 3GI9L 2BNQE 4Z8FH 4M9PA 5IG7B 4AJ0A 5F1KC 3GI8L 5E8PB 1J10A 4L4VB 5EU5B 3LKRB 2FECL 5J11C 2DQTH 4K8RH 1OAZL 1JNLL 4N0YL 4NO5B 1BIHA 2MMXA 1ADQL 5T3XH 3IETA 3GMNB 3SN6N 5EBGA 2R15A 5ANME 1WBZA 4EXPX 1PLGL 1ND0B 4U1HA 1EFXD 4OTXL 3SKNB 1FH5L 3QAZB 3SGKC 1R3LA 3CFEB 1VPOL 4FP8L 5KANI 4HKJB 1FFOA 1P1ZA 3HUJF 3QXDA 5BZDA 1YZZA 1IAIM 4YHKL 2P8LA 3EJZD 3DURA 3F65A 4PTTB 1MFAH 4PV8A 2KKQA 1MCOH 1UCBH 1DANT 3CFCH 3V0AC 1Y18B 4QYOA 1D9KA 3SKOA 3T0EB 2DQHH 1A7QL 5JW4M 4M1GH 3MCKA 4L3CB 4CW1A 5EUOA 1CD9B 1DVFA 3OR7B 2WQRA 5TDNB 2QQKL 2FATH 1HSBB 4NM8H 2X4RA 2Y7QA 5DA4A 1SYVA 4LAQH 2BMKA 4JHWL 4MB3A 3QQ3A 2NPLX 3HAEB 3WFHA 3RNQB 2NNAA 5F96H 3BW9A 4U1MA 3W9EA 2DTMH 2R0LL 2B5IB 1QVOA 3HZVA 1FNEB 4MD4B 2WBJB 4QY8A 2I9LA 4D9QE 5HHQA 1DUYB 1MHHB 2GFBA 4OZHF 3GKZA 3G5YA 3REVA 4J4PC 2FJFB 2R1WB 3T3ME 2WM0A 4CNIB 3MACL 1YECH 1JJUA 2QJDA 5C7XL 1E4XH 4JRYE 2E7CA 2AJVH 2VAAB 4XP1H 3QG6B 3A67H 4PTUB 5EULV 5KANG 1E4KA 2H26A 2NY6B 4U31A 4GW4A 2KBGA 5KVFL 4RAVB 1J18A 3IFOA 1HNFA 5IMLB 3MV9E 1EIBA 1IARB 3BUTA 2HTKC 3HUJE 3KPQA 4ETQA 4NNPL 2UZIH 3W39A 1U2CA 4LGRB 4PJAA 5JOPE 2NLJA 5ICYA 2G5RA 2ZOKA 4G8GD 3VRJA 1I8LC 1I1YA 1JWSA 3PNWB 2ZG1A 5I1DA 2VZ1A 1QHPA 3TBYB 1BBDH 3H9SA 3V79C 4PTUA 1OAYH 1BFOB 1A7PH 2XG5A 2FBOJ 1NGYA 4DW2H 1HH9B 3KNBB 5KOMC 2VQUA 4IOFD 4KY1H 3WUWB 1F4WL 1OAXL 2VDLH 4YDVB 1TITA 2AJZB 1XF2A 4KMTH 4JO2L 3WFBL 5A2FA 3QI9C 1EV2E 4X8XA 1DEEA 4JR9H 1XGUB 3MLRH 4EVNB 5JOFB 3VE0A 4UV7L 1ZLVK 1WIOA 1T04B 3LY6A 1P2CA 1E4WL 2BC4A 1MAMH 4JZOA 4NHUA 5CEXB 4ZUSA 3ARDD 4EZMA 1D6EA 1KTRL 1MCPH 4TQEL 3ZE0F 3LH2L 4P0DA 3ARPA 4EI6A 5C92A 3QDGA 4NKDB 2P8PB 2Z31A 4KDTA 3K8MA 4U1NA 4OM1H 1U8IB 1H3PL 3T0ED 1BM3H 1VDGA 2J4WH 2X1QA 3ZT5A 5DHYB 5F8RC 1LE9B 1UXWA 4CMHB 5FKAA 3RKDC 2I26N 4K8RD 1MRFL 2C1PB 3T09A 5AYUH 4LIQL 4R26L 3T0AA 4OCXH 4YH6A 4M7KL 5DDHA 5CP3A 4I2XA 5DJ6A 1JGUL 1CD0A 1U8QA 5BS0A 4QRPA 1LO3L 4CU6A 3JWOL 3KPLB 5ELIA 4KV5F 4HKXA 4MD0A 1S7SA 4LMQI 3P4OB 2HFGL 5E4EC 1CXIA 2Q1EA 5EOCL 3OHXB 3WNOA 5BCAA 3O9WB 5IESL 1ZGLP 2XT1B 3FT3B 1J1PH 1X5IA