3MJGX

The structure of a platelet derived growth factor receptor complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
280
structure length
274
Chain Sequence
LVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFSGIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGNEVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDHQDEKAINITVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Platelet-derived growth factor subunit B
publication title Structures of a platelet-derived growth factor/propeptide complex and a platelet-derived growth factor/receptor complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/transferase
total genus 50
structure length 274
sequence length 280
chains with identical sequence Y
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00047 ig Immunoglobulin domain
X PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mjgX03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mjgX02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mjgX01
4KGLA 4E41B 3ALWA 4AENB 4F9PC 3C8HA 1T0MA 4LPVA 4YGAB 1HDMB 3U4AA 4X7TB 4ZSOA 3RJDA 3O11A 5IEKB 3S37L 3AMKA 4LHJB 3ZT6A 3DURA 3JV5A 4FQXA 4OCYL 4N0FA 3W82A 3MNZB 1JNHA 1JHTA 2BRRL 2DAVA 3V0VA 2BVQA 3MV8E 1NMCC 5E6IA 1D6EB 1NBYA 4X98B 4DGIH 5HI5D 2NQCA 3OKNA 2NZ9D 4PRIA 4MX7B 3ARYA 4PB9L 3T0ED 1NANH 4I9WD 2D9CA 2BMKA 1YNKL 4NFBA 3FAWA 3MBEA 2AV1A 2XZCL 2VLLA 4DKDC 2UY7A 2XG5A 4HIHB 3QYCA 5DR5H 3DHJA 1GSMA 1U8PB 3EDKA 3SJVA 2A9NL 2QQKH 3O3AB 1QSEB 2JJSA 2MQ3A 1FBIH 4QRSB 2L0DA 4HCRH 1OTUD 3VFTA 2BNQE 1KFAL 2QADB 2V2WA 1J12A 1CDHA 2AVGA 3QEGL 2EYRB 2EKSB 3LZFL 2H41A 4GRLC 4IDJL 3KPOB 1F00I 3CC5B 4XCYA 1A7QL 4F7MB 4ODSL 2NY0C 4LPTA 1FNGB 1TCRB 3OAZH 4LCYB 4MXVE 3SE8H 1UG9A 2P5ED 1RQ5A 1KN4L 2W60A 3Q48A 5F7MC 1KCUL 1CXLA 5F7YC 1MCQA 4ERSH 3IJYA 4I0PC 4EI5D 2VJXA 4RGMC 4UU9A 1MHEB 3AFLA 4MXQC 2F8XC 4JM4H 5A2FA 3MRKB 3VCLA 3MSPA 2OQJB 1NC2B 3WO4B 3EOBB 2AP2A 4Q6IA 4JO2H 5B39G 4NJ9H 3P77A 1KIPA 1YEGH 3OKDA 3ECBA 2F58H 5I6XC 4Z7UE 3V4PL 5C2BH 3CZJA 3RVTD 1JPSH 1F8TH 2YWYA 2E3VA 1VESA 5DYOA 3VRJA 4R96A 1FGVL 4K2UL 4Y8DC 4ALAH 4HCRA 2FZ3A 4WUUB 4EDWL 5GIRB 3RWFA 1G7IA 3MJ8B 3NBNA 4O00A 5DHVB 4A2LA 3U7YH 5DT1L 1PG7W 4PJXE 4FQ1H 2EH7L 1DBKL 3UZEA 2IBZY 3HG1B 4C56E 2J1KA 4HUXA 4I3RH 3CDCA 5LGHH 1FCGA 1N4XH 4M6AA 3RRQA 4CN4A 4KMTH 2WAHA 1KACB 2YUWA 2V2XB 2XA8H 2QLVB 4X8JB 4XBEL 1VGKA 1WBXB 5C9JB 2XQYG 4R90H 2GY7B 3KPSA 4R0LA 1CG9B 1HHGB 3LY6A 4I0CC 1OSPH 3RUGF 3W0WD 1K5NB 2P8PA 1T1XB 1KENH 4Z7VB 4IMLA 4PJCA 5IBTH 4L8BA 1LQSR 3O3EA 4LCWB 4H8WH 3QPXL 5DRXB 2DTSA 4G7VH 4LNRA 2AEPH 1UXWA 2Z92A 4OF0A 4J23A 1QP1A 3IF1A 3LRGA 4JFQA 5I30L 3MJGX 4YDKL 4X6EB 5SX4I 1J0JA 5E9DB 4JLRA 3ZHLA 5C6PB 2Q20A 4NN6B 3DVGB 5H37G 3ARBD 4EOWL 1BBDH 2XKNB 3MRDA 3VD5A 3U0PB 4DVRL 4KKBD 1DUYA 4UTBH 4UNVA 1J88A 3RVUC 4OZGF 1YNTA 3QULA 1K3IA 4KZDL 4YNYB 5TGBA 2IADB 4M7KL 3MCKB 4PJDF 1SQ2N 4TSAL 3G04A 5KBNC 4XNUH 3OKMB 2HTLC 1J0HA 3AXLB 3O4LE 5T3XE 5D2LF 3REVA 2SEBB 4JKPL 1RZ8A 4RQQB 2JJTC 1K8DB 1G7MA 2BOBB 4QCIA 5FO7A 4N0UB 2XXCB 5F7WC 1ZHNB 2HFFB 2X09A 1OP9A 3O3BA 3I6KB 2F5AH 3O8XB 4K3HA 3ZTJG 4D0DA 1ROWA 3MMEA 3PWPB 4KJYB 2VLKB 1JN6A 1AGEB 2A73A 3WNOA 3DJ9A 3OR7A 2WBJC 4TTGA 4Z0XA 1VERA 4BK4A 1HHHA 1MHPH 2VQTA 2W65A 4OCWL 4E9LA 2CK0L 3EOTH 4XXDA 4WV1A 1PY4A 4M4RA 2BNQA 1CL7H 2WIMA 2VN7A 3GSQA 3FQXA 5BRZB 35C8H 1Q9WB 3L95B 5FYJD 5D7IB 1JP5A 5LGJB 2B0SH 3S4SA 1JI2A 5EN2A 2BDNL 3U7WL 5I17A 4HPYL 4DK3A 2P8LB 1DSFH 1U92B 1ZVHA 3U36A 1TJHL 2IG2L 4JKMA 5F96H 4WIQA 5D7LB 3BFOA 4XAWL 1UQSA 5FV1L 3KPNB 5SWZE 3LSOA 5IMMA 5DD5L 4IHOA 2FL5A 5CMAB 3PQYB 3KAAA 1T2XA 1BAFH 3F62A 1D5BA 4NZUH 4KUCD 1RVFH 4JY6A 1C12A 4OZIB 3J7HA 4PJEB 5AYUL 4TSCH 3T4AB 1MELA 3GI9L 3TIDB 2BK8A 1ERNA 1JPFB 1BFOB 2HRPH 4ZS7L 3UYOD 2WNGA 5C08D 3KYOA 4Z7UA 3CDGB 2QADC 3CXHK 3MOQA 3UTTD 5GHWH 2XN9B 2R2HB 4JY4A 3RWIA 5HDBE 1A6PA 2JE8A 1FYHB 1I75A 2V5RA 3NFNB 1U8KB 2Z0BA 2AJXL 4HBQA 5DMIL 3TJHD 2R0WH 4QKXB 2CIIA 3DRTA 2ZOKB 2YD7A 4BKLB 1Q94B 5I1CL 2CKBL 4NYLA 1UFUA 4X6DE 2HJFA 2HYMA 2R4SH 4NUGL 4HMDA 2XXMB 5BMFL 5DQDL 1J05A 2DBLH 3ZHDA 1RURH 3MACL 4PJXA 5GGRB 2Z31A 5C0BD 4UT9L 4C56A 1IAOB 3IS0X 1CF8H 1W72L 4Y19B 1WLHA 3WO4C 5AD0B 1EEYA 1V5JA 4MD0A 4KI5F 4B5EA 2PYEE 4X7SL 5T3XH 4U1JB 2VXSL 1DLHA 1XT5A 4N0CD 2A77L 5GJTL 3L3GA 1XIWD 1P84K 4LCIH 1S5HB 5DJ8A 2BXZA 2FLBT 2VDOL 3ARPA 3VXNA 4K71B 3GB7B 3S9DB 5IW3A 1QBBA 1LO3L 4HXBL 4WU5B 5I8OH 2ZCKH 1FZJB 4XTRD 4BM7A 5EU7C 1JHKH 1L7IL 4JHWH 3A67L 2NY5L 1CD0A 2RCSL 4IRZH 5IR1A 4ZTOL 1ZHLA 1KBGH 5FFLA 3L3OA 2FB4H 4DW2L 1MIEH 3OAYH 3QSKB 3RU8L 2OMNA 4UDTA 2NXZC 3VA6A 5JORA 1P69B 1ZLSH 1ED3A 2OJEB 4NSKA 3S5LA 4ZUWA 3BHBB 1I8IB 2ICES 3GMRA 2EDNA 3RGVB 3C9NB 3MRIB 4QYOA 3SDYL 2DKSA 43C9B 2DLHA 3EYVB 4XCEB 1HHJA 4F8TA 1J10A 1PG7X 4L3EE 4N1CA 2VKXA 4RGND 5DC0A 1GHFL 1RZJH 1XGTA 4K23H 4N9OB 4CUCA 3QQ4A 1BVKB 1DBAH 1T03L 3O4LA 5DVOA 1FNHA 3GSRA 4NHCH 3RY6C 4OLZL 3RKDC 4Y5YC 5IQ9B 2VR9A 5I19H 5IROA 3LKOA 4O2EA 2ZUVA 2Q76B 5AG8A 1G0XA 4LRNL 3GO1H 3KPLB 4JRWA 3WKNA 4S1DD 2NW3B 3OL2A 4OTXH 1QFWM 1IM9A 2YN3A 4LSUH 4NN6C 5SX4H 4L4TD 4OFYD 2R69L 1AO7D 4OLUH 3GMLA 3SKNA 4HIEA 5HVHB 4G8IB 4R7NB 2YKLH 4HIIB 2X4PB 3P30H 2CRYA 1NKRA 1QUNA 1FNSH 3ULUL 5F89B 4I4WB 1OQOA 4YEFA 4NPYA 4PY7A 3VFUB 3V4UL 3PGDB 3O2DL 5CZXC 3TCLA 1A8JH 2XZAH 1A3RH 2GSGB 1T7XA 4HJGB 2HVJA 4AM0B 1XF1A 1A6TA 4ZO7A 1I3GH 1MCPL 5C6TH 3VG0H 1MFEH 4E5XA 1NLBL 1W0WA 3MV9D 3DNKA 3LKNA 4EKXA 4NQDB 4XMPH 1FO0B 3PHQB 1N7ML 4XVSL 4IRSB 3V6ZA 1QOKA 4JAMB 4D0BB 5EORL 4OT1L 4PJBA 3UTQB 1UEYA 3O8XC 1UKQA 4HGMA 4XHJD 2AEQH 5ID0A 1J87A 3LN4B 3RL2B 3WFDH 4XCCL 1W0VA 3D85B 1XH3A 3RDTD 1FPTL 3QXDB 4JN2B 3TLRA 5D1XD 3AAZA 3TO4A 1TMCB 3KLHD 5FM4A 1MHCB 4AEHL 4OF7A 3MLRH 4Z7UF 2IQAA 5GSVB 3UJIL 5GS0H 4U6XB 4AIOA 5DSCB 5C0AD 1CLCA 4P23C 1DLFL 5E8EA 1HCFX 1MEXH 4JB9L 3MRGA 5IJKC 2YC1B 4H5SB 1EUTA 3FHQA 1RUQL 1DFBH 4MCYB 1KTRL 5F7EH 3Q6GL 4X6DA 4QTIH 5IEHA 5I1KH 3RZCB 5I1GH 3NZHH 1I1AD 4LKCA 4DZ8A 1IAIL 3S4SG 2PYEA 5I1JL 1Z9OA 1IVLA 32C2B 1CDBA 3SDDA 1CDJA 4PJGB 5HYQB 4ONFL 3L3KA 4DGVL 1YMME 2FR4B 3HC3H 4HFWB 3B3IA 1MNUH 4X5LA 2DQHH 4RBPK 2P44B 5IB5A 4R3SB 4MVBC 2ESVB 2IF7A 1WCBB 3GBNH 1AP2A 1HQRA 3DLQR 3JTTA 2R2BB 4ONGH 1ZA6B 4XPAH 3HUJE 1TZHB 4KJPC 5DF0A 3DETC 4KU1A 4OZFH 1T89A 3MV01 2AJUL 2XT1B 3DSNA 2AJYH 4DFHA 4M8QA 3RWJB 4WNQA 1NLDH 3EYUL 4KKCD 3SEPA 5DRWA 1S7SB 4Y4HD 1ZTXL 4L3CB 4S10A 2CLVB 5TF0A 1U8HA 5DXWA 3TT1L 3I6GB 1M6OA 2YOCA 1ZVSB 3KLDA 3VFVA 2Y6SD 3ARUA 3IETB 1P2CB 2AW2A 2CUMA 5IBLD 2NX5D 5EIIB 3U4EB 1W0YT 1NAML 1XMWA 2VB5A 4WFFE 4ELKA 2RFXB 3QDJD 1RJZA 5ADPL 4L3EA 2GJ6D 3LQZA 5EZLA 3CU1A 4ISVA 4LSSH 3BW9A 4NM4H 4NGHH 1T66C 4K71C 3N1GC 5KSBF 1EHAA 1H8SA 4GKOA 5K9KA 5CP3A 3OB8A 1U3HD 3WE6A 1FE8H 4CMMB 1UJ3B 5F9OH 3D87B 1I8MA 2FYYA 5TH2B 4JM2D 4RWYH 2LQRA 3CSGA 3BIAX 4JFYB 4HMEA 2YBRB 3HAEH 3MNVA 5I16A 1P6FA 1RJCA 1JGLH 3FTGA 3QH3A 1T1ZA 4R8WL 4L8CA 3ARFD 1FCCA 1EEZB 4GAYA 2R0LL 4UIMB 4PGCA 1YEIL 2EIZA 1EHNA 4OZFA 2RJMA 5F71A 3QI9A 4NKQB 5J12B 4Y2DA 7CGTA 4X5WB 3RGVC 4XP4H 3UO1H 1HH6A 2YD8A 1IGFH 2VQ1B 3O3UN 1A7PL 4X6FA 5E2JA 3FO1A 4P2OA 2LVEA 2NY2B 2C26A 2QKIB 4DZBB 3OKLA 4V1DB 2QJDA 2E9JA 1J5OH 3TPUA 2DQFA 1LWRA 4J6RH 4A6YL 1OAYL 5AUMA 1MAJA 1RIHH 2BSSA 2ZCHH 1YEKL 4PJ5B 5E08L 4PRPB 4U1SB 4KTDL 2XQBH 5CSGA 1P9MC 3WD5L 4PR5A 4OLEA 2PO6B 3QUML 3D2UD 3L9RB 1FVCB 1IAKB 3SKJL 1IKNC 1KT2A 4JZOA 5EB9A 3OX8A 1X9QA 4NO5A 4PGDA 4AZ8A 1DTUA 2E7HA 3D3VD 2DLFL 4S2SA 5HPMA 1DUZB 4UTAL 3CJJA 3DV6A 2DQUL 4WEBH 1G0YR 5BCAA 3QZWA 4G6KL 4XBPB 2A6DB 3LQAL 3FOLA 3QFDA 1T5WB 2NR6C 2YD2A 3HAEA 1MY5A 3FQWB 5GGUB 4K7PX 5HHOB 4D3CH 3QWOA 3EZ8A 3IKKA 1K4DB 4WGWB 4KPHL 4M43H 2EC9T 2ZSWB 5I8EB 5E6ID 3JWDL 3DX8A 4AIZB 1FV1A 4FXLA 4C54A 3IFNH 1KEMH 1F90L 4X6DF 2C4FU 1R3JB 5BZDB 1WZMA 2K9UA 1WTLA 1N8ZA 4WDIB 2VH5H 5EU3B 4IRSC 3MBED 1G7HB 1AGDB 2ZOLA 4NC0B 2H1PL 1ORQB 4CVWA 1IM3B 5ETUA 1VFAB 3A6CH 2J88H 3O6KL 1PKQB 4M1CC 3ESVF 3O9WD 3SJVD 5F97E 3TT3H 2CO7B 1V05A 4IS6A 4KK8D 3OKOA 2I9TA 2VDQL 4KKLD 1KJ2B 1H15A 4U0RC 2IFFH 2DS4A 2JJWA 5INDA 3X11A 5C92A 1HYSD 3H9SE 3CD4A 1S7QB 4OCXL 3WIIH 3CLEL 3TWCL 3WKMH 5E00B 5KN5A 5KVGL 5E1AA 5EUOF 4NO3A 4J2XA 1YMMA 3GMPA 2AXJA 5I8CA 1I7ZA 1AR2A 2ITDB 4OBRA 4U1MB 2R1XA 2JB5H 3HUJA 4TPRL 1PQZB 4JFZH 2Q7NA 4O2CB 5CWSB 1RUPL 4OV5A 4TNWF 3T3MF 1IGJB 3S35X 1NBZB 3C6LC 5CKAA 1SEBA 5JMOC 1RHHB 2WK2A 3RPKA 3RZCC 5B38A 3OSKA 4CU7A 4GG6B 1V3MA 3FFCB 3U79A 1J0KA 4IMKC 3MV7E 4CNIA 4HHAB 4QT5B 1YEDB 4DGIL 4FQCH 4P9HC 5IB1B 3TN0B 3FO2B 1I8LA 1UZ6F 3TBSA 1TPXC 4JFDB 2BVTA 3C5ZB 2PW1A 2WW8A 1LEIB 5DR5L 1VEMA 1D3CA 3IDUA 1QEWB 1OPGH 2QQKL 3UPAA 1G7PA 1KTDB 1NGWA 3L5IA 1WICA 1FBIL 4QHNA 4OIBA 4MJIA 4HCRL 5J6HB 4FMFA 1QQDB 2D31A 5DRZB 1JWUB 1MI5A 5CZVH 1ETZB 5ALCH 5C0GB 4LBEB 1JMZA 2XTJB 3EYSH 3FN9A 4ORZC 5CJ5A 3QXAB 3HPJA 2CDEA 2EE9A 3C08H 5KW9H 2NNAB 1NAKH 3BP5A 4HS8H 5C7XH 3NCFB 1OWWA 5HI3D 2P5WB 3DI2B 4MZ3A 5F1IA 5ICZA 4APQA 1TETH 3VW3H 1MFDH 3SE8L 3BJ91 1T2QH 1JZ6A 4UZGA 4QHUA 2FH8A 2ADIA 3RI5K 4ERSL 3VI4F 1PVHA 4MJ6A 4G42A 3EJJX 4BQBA 3CPLB 3HI6H 2GITA 1KIRB 3ILPA 4GMSH 3L3DB 4LSDA 4HLJA 5DTFB 3DSFL 3FAXA 1UJ3C 2KL6A 1T4KA 3QDHA 4NJ9L 1FGNH 2HJKA 4JPKH 5IHUH 5IQ7H 2F58L 4JO3H 4IIQB 3PIQA 5I9QB 4YXKH 5C2BL 1EHLH 3DO7A 2Q8AH 5IVXB 3TVMC 1F8TL 5K93A 4R97B 2G60H 4XVUD 5KVDH 1FZOA 5HHPA 1CGXA 4GKNA 5JLZB 5DI8A 2HMIC 4ALAL 5J12C 3GSWA 4O5LH 4Y8AA 1S7UA 3MRQA 3P0VH 1XFPA 2DTMH 4Q58C 2UWEB 1QNZH 1GGBH 5IFHH 4IMKA 3U7YL 2HLAA 1UXSB 4FQ1L 2PR4H 1CU4H 3L7FB 5KVEH 1S7WA 4I3RL 5FOBB 1L4IA 2NCMA 5E95B 1DR9A 3EDJA 1AKJA 5LGHL 4ZUSB 1N4XL 5C0DB 1EH9A 2G9HA 4BELD 4KMTL 4PPTA 3P4LA 3LD8C 4P5TB 4RRPG 2XA8L 5F7HA 5T1DH 3BRDA 1HYRC 3HZYA 4NC2B 1NC4D 4OZFG 5HDOA 3HE6C 4R90L 2B39A 1J7VR 4MDJA 4NO0A 2WV3A 4LFHG 1OSPL 2R1YA 1C5BH 2AJVH 4OD3H 3WBDA 4OFVA 2DMBA 1KENL 4JCLA 1ONQB 5FYKE 2WSKA 4NQXB 2EDEA 5IBTL 1YJDC 4H8WL 3BN9C 5D5ME 4K7FA 4XCNA 3HE7C 2AEPL 4X7FC 3IU3A 3ZL4H 2CRZA 4HGKC 2MSPA 5EOCJ 1Y18A 3H9SA 2IH1A 2AABH 2EE2A 1FJ1B 5DJYB 4AQ1B 2D0HA 2N7AA 4LLQA 2CSPA 1KCVH 1BBDL 2BX5A 3UPRA 2WUBH 5FGRA 2D2OA 4U1LB 4YK4C 5C0JA 4XZUA 4PRNA 4UTBL 1NUNB 1KXQE 4FXGB 4QRTB 1ZSDB 3SKMB 2AI0H 3HI5H 3INUH 4LLYB 3HZKA 4IBLT 1C7TA 3PV6B 1DQJA 5I1IH 4XNUL 3OR6A 1G7LB 1RHFA 1P5VA 3PDGA 3W39A 1KIUA 1HNFA 2BY0A 4Q9RH 1BQSA 2PCPB 4LAQH 4ZPTA 1NCNA 4PP2A 2YXMA 1GC1H 3TVMA 8CGTA 3JWNC 2YSSB 4OCRH 3RVUD 1CFSB 3B9EA 4LLAA 1WIOA 2MTPA 2VYRE 5JQ6H 4OFKA 1EAJA 3UX9B 1EGJH 4R4BB 5JDSB 1D5MA 1MLCA 2F5AL 3F7QA 2MHAA 3AY4A 2BVPB 5EPMA 5L9DH 1CFNA 3CUPB 5K9JL 1NCTA 3KJ6H 3AC0A 1U8JA 4CMHB 3DV4A 1G7QB 1WFTA 3VRIA 3P0GB 4HK3N 2R9HC 3NTCH 4DCQA 1MHPL 2ZUYA 3ZKQD 3C6SB 4DEPB 1EFXB 1I1FA 2Z31D 3EOTL 5D93C 3T0AA 3M8OH 1VCAA 3SGKA 4C56D 1CL7L 5EZJA 3O81A 3B6SB 3CX5K 4JG0H 35C8L 3IJSB 3HE6A 1E27B 1II4E 2B0SL 5KZCD 5EUKB 4GS7B 2H3NB 1J86A 1F2QA 4G80A 1FL5A 3HMXH 2N1KA 5I0DA 1LMKA 1DSFL 3WFEH 3PWNA 2WBJD 2ZNXA 5F96L 5D1QA 3BT2H 4MAYB 5L0QB 2FJHB 4I0KA 2X70B 1I85A 5C0ND 5BZWA 2R29H 3WUWG 1BAFL 4KV5E 4NZUL 2F74A 2QHRH 5EIQA 5F7KC 1RVFL 1I4FB 1S8DB 2HT2D 1CFVH 1EJOH 1K9TA 3MTRA 1FN4B 3U30B 3ILQD 4JEGB 4U0QB 4TSCL 5B38G 2L7UA 4NWUH 1EGJA 5HI4D 5L6YL 4MA1B 2HRPL 3QFJE 1JGDA 3HHRB 4QRPB 1U8QA 1DVFA 3MA9L 4F8QA 3JVGA 5GHWL 4K3GA 5IW1B 2P8MB 4PV8A 4AYFA 4PRHB 4NNXA 2YA0A 4ZFOB 3OAUH 4RX4D 3S3JA 5CEZE 1F42A 3P3YA 3QQ9C 3FT3A 2HN7A 5D70H 1KLUA 2R0WL 1KTLA 3QWQB 4PLNC 4UT7H 2BY1A 4X9HA 1K8IA 2R4SL 4JFFE 4JPVH 2DBLL 1RURL 3O4LD 5T3XD 1H5BA 3QXTA 1CDGA 2FJFB 2FGWH 5A16B 1FG2A 5L2JA 3TYFB 4NDMB 5DGQA 4NN5B 3WIFA 2AK4D 4G8GE 1NKOA 4GW5A 4XP6H 5T3XL 1L9NA 1IM9D 3LMJH 2VE6A 1JPTH 3LEXB 2C4XA 5C0CB 1LEGA 4LCIL 4P0DA 4PB0H 4WEMB 2GYSA 5D6CB 1CXEA 5FHBH 3BGMB 5I76B 5FA4B 5I8OL 3DMMB 1IGML 2ZCKL 3F12B 4M7LH 5D5MA 1JHKL 1G0DA 2PTTA 5DFVD 4JHWL 1RULH 1T20A 4ORGB 3BUYA 4IRZL 1CZ8H 2VLME 2VOTA 3S37X 2ITCB 3PE9A 2FB4L 5T1LA 3ZDXE 3IRZA 1MIEL 4J8RA 4AMKH 5TDPB 3GK8H 1U8NB 4N8VA 4BQ9A 1B2WH 4KVCH 3W9EA 1KNOA 5KJRH 1IQDA 2MCG1 1Q1JH 1JTTA 5JOFB 5GS1B 4IDLA 1V7NH 3VXMA 2O26U 3IDYC 1FZMA 4EDXB 3C60B 1A6ZB 4PG9B 4OI7A 3PGCA 3QNYA 4G9DB 1RZJL 4K23L 4JFOA 3RTQA 2NXZD 1DBAL 1M05B 2X4QA 3SDAB 2QSTA 3JUZA 4NHCL 5FK9B 3GRWH 3EYQD 1IC5H 1WF5A 3KWWA 5IV2B 5I19L 4KWUA 2HA1A 3NFPB 5ICYB 1L7TH 3GSUA 2NY4C 1HXMB 4LU5H 2DN7A 4OTXL 1JUFA 1EERB 4ODWB 3RZWA 1T1YA 2H32H 4LSUL 4UILH 1BOGB 4OGAC 1I9IL 1X4YA 4U3CA 5E4EB 3TBWA 4E41E 2BNRD 3KDMA 1I8KB 2A1WH 4OLUL 5HBBA 2YKLL 2YK1H 3P30L 4JHZA 1V3LA 3IKCB 1QO3B 5E8NA 1FNSL 4YHNB 4K07A 3R06B 1CWVA 1J18A 3WFCH 5F7UA 5EBLB 5CBEB 5FB8B 1XCTB 3AU1A 2XZAL 1LNUB 1A3RL 1UENA 3KYKH 2FGZA 2C3WA 3SOBH 1JYXA 4LAJH 1I3GL 1G6RH 4IOFD 1J1XH 3T09A 4YFLI 5BJTB 5C6TL 3VG0L 1MFEL 1OM3H 4DJMA 2XKSA 4YDVB 1RK0B 3AM8C 3SDDD 4L5FH 2A74A 2WIIB 5KSAB 1WTGT 3P9MB 1S7RA 1QVOA 2WQ8A 3QA3A 4XMPL 1FNEA 5CGYD 2XOTA 3BESR 4EBQH 1CE1H 3BZFB 3OXSB 3TNNB 1QSEE 4JFHE 2DL9A 5TFSH 3CFCH 1AHWC 4WFGE 4Y1AB 4CRPA 2AEQL 5FM8A 5JIPA 1MFNA 3UYPA 3GRWA 3WFDL 3RL1B 3T77B 4X6CB 1U42A 1XGQA 3P4NB 4CMHC 4YDLB 5C0EB 3EO0B 4WU7A 3KPPA 5DZOA 1YECH 2A9MH 5HGAB 3WSQH 5CD3A 3H3KA 3UDWC 2RGSA 4DEPC 5GS0L 3LDBB 2H32A 3QFJA 3PGFH 2CLRA 2VLRE 3MRCA 3OB0H 2PXYB 2C5DC 3N9GH 3NVQA 1KCRL 1BECA 4Z7NE 5IHBA 1PAMA 3HZVB 4NQCB 1RY7B 2OR8A 3O6LH 3PXHA 1MEXL 3K74B 4JREB 3MLVH 4ZXBB 3GSXA 1IL1B 4ESKA 3W11C 1Q9KB 3V0WH 3L3IA 4ZOCA 1KB5H 3NIDF 3FJTA 4XVTH 2OSLB 1T2JA 4RMQA 5DD3H 5HJ3A 1VENA 3DVNA 3NCYS 4WHDA 3EJYC 4U1KA 5F7EL 4MAYC 1AGBA 1ES0B 3MRPB 4JFFA 1KIQB 3MLTB 1TQCB 4LHQB 4QTIL 1Q9OB 2YRPA 1ZV5A 3MLPA 1G6RA 4X4ZA 4P23D 1TZGH 3QEQB 3UTSB 2JF1A 5I1KL 2EXYC 2W9LA 5I1GL 1HHKB 3HZMB 3U9PL 4EEEA 3NZHL 4EUPH 1J0YA 1INEH 4G8GA 5H94B 1S9KC 1Z9SA 4IOIA 1A6WH 5JW3H 2DBJA 2KQNA 5MI0B 1X5AA 2CIKB 3K8KA 3H3BC 3QXUA 4XPHL 1FIEA 3MCLH 1Y6KR 4YHYB 3HC3L 5DLMH 1MNUL 5D5MF 1ZHBB 5CILH 5EZIH 3VXUB 2DQHL 2P24A 5DVLA 1BZ7A 3DVFA 4Y2DD 4OFIA 3GBNL 2Y07L 1LE9B 4LFHD 5L2KD 5EFIB 1INQB 3IJHB 4ONGL 4XPAL 4WW1B 2BSRA 2CDGB 3ROLA 4AH2A 1BFTA 2XI9A 4HG4J 2AJYL 3RIAK 3QDGB 1ACYH 4KXZI 4JVWA 2IAMA 1Z9MA 1NLDL 3B9KA 3QJFB 1KB5A 4P4KA 1JZ7A 3DUSB 5GXBB 4MVBD 1LVEA 3QIBA 4Z7VE 4NN5C 3HPLB 3TEUA 4LGSB 4JPIA 1R24B 3O6FB 5BVPH 1JHLH 3VXSE 1K85A 4P49A 2JCCB 2N4IA 2FIKA 1ND0B 3UCRA 2EDRA 4R2GB 1URLA 4LSSL 4NM4L 4OZ4A 4NGHL 3BKYH 3E6FA 3LEVH 4PRBA 4TTDC 4EUPA 5FUCC 4LLWB 2FX8H 3DMMC 4KUZH 4MWFB 3WEXB 5DJXB 4DVBB 3DX6B 3V4VH 1KPUA 2YMXH 1KB9K 1FE8L 5F9OL 2NY6B 2BZDA 1A4KB 1B0RA 2W1NA 4JFPA 1SJHB 3N1FC 5GJSH 4RWYL 4U6HB 4OF5A 5HYSA 1A02N 3DGGA 3G5YB 3ES6A 1JGLL 3S3PA 4PJHF 4E41A 1T66D 4X5XA 1OF2B 5DK3A 3QUXB 4X7TA 3RVWD 2CD0A 1X5LA 2X1PA 3MRJB 4XP4L 3CVIH 1UKSA 3UO1L 1JF1B 1IGFL 1J0IA 4GRWB 5T33H 2XZZA 1L0QA 3E6HB 3GNMH 3WMSA 4G9FB 5CUSH 1D6EA 1Z5LB 1J5OL 3L7EB 1SYVB 2FBJH 1FYTA 3G5ZB 4J6RL 4MX7A 4BH7A 1KPRA 2EDTA 1RIHL 1MCKA 2ZCHL 3P4MB 4POZC 2XQBL 3SDAC 2IBBA 4N8VG 1MF2L 3PWPE 2VLKE 4M48H 5CEYB 2BY2A 1YMMD 2J8HA 1UT9A 4MNGA 1X5KA 4WUKH 4HF5H 1SM3H 2DRUA 5H2BA 2VZOA 3EBAA 4AL8L 1ZGLB 4QRSA 5GRJH 1CQKA 5E4EC 2OX5A 4JZJA 4WEBL 3K2MC 4NKMB 2I24N 4GQPH 4XNZB 5EOCH 5D7IE 3SGJA 2EYRA 4GAGH 2EKSA 4OLXH 5GGRY 2NZIA 4GQ9H 4C83A 3C2AH 3CC5A 5DHYB 4K9EC 1B4RA 3VDCA 4D3CL 2EXWC 5KS9B 4DKEH 1BX2B 2O93L 1PEZA 2VLRA 1CE6B 1FNGA 1TCRA 4K94C 1NCDH 3I75A 2IH3A 4M43L 4WO4A 3NIGF 5I71B 3BKJH 3FOMA 4QHLA 1K4CA 3PQYE 1MJJB 5IK3B 5BW7A 3D1MC 3SQOH 4D9LH 3IFNL 1KEML 2DI9A 4CN1A 1HCVA 3RNQB 2NR6D 5KSAC 3DX9A 4YHZH 5I1DA 5IHZB 4OZIE 2VH5L 4YHIB 1UACH 5K9QI 4F58H 4XH2B 1LO2H 2V9QA 5F1NB 3STZA 3A6CL 2J88L 3EIFA 1C5DB 3SPVB 2ATPA 4M5YH 1VKXA 3TT3L 4RFOH 2E8YA 2VNCA 4YDLC 5EU6E 2IFFL 4MJID 4NFCA 1UZ8A 1P7KA 1DBMH 2FO1A 1D5IH 1U8LB 1MI5D 4HUUA 2WWMC 3DXAB 2GAZA 3WIIL 3F65A 1UCBH 2ARWA 3WKML 2WANA 1YNLH 2Q6WA 4L8DA 2PXYC 2JB6B 3MRHB 4QRQB 3FB8A 4YIQA 3QXVA 4ZXBC 3R4DA 4APQD 1BD2B 2Q87A 5ERWB 4HULB 2VAAB 3REWB 1BMGA 5CJBA 3QG7H 2JB5L 3UJTH 3H0TB 4JFZL 1A3QA 1QR1B 4MQXC 1QZ1A 2V2XA 4ZO6A 5ENWA 2X4SB 1TQCC 4X9BA 5LG1A 1ADQH 3P4OA 3RWHB 3GMQA 1T80A 3Q6FB 1CG9A 2H6PA 1BVLB 4JKWA 1DDHA 1T1XA 4KK6C 3WLBB 5GRXG 1YA5A 4FQHA 1Z6JT 3W9DB 2FSEA 3VXSA 2VL5A 4UQ2A 3SGEI 4FQCL 3RFZC 1TVDA 4ZUVA 4X6EA 2P4AB 3QRGH 1A7OL 5LXGH 4E0RB 3C6LD 1T0NB 2NTFB 2E8ZA 1GCFA 3T2NH 4LSQH 1ZAGA 4LPXA 4Z95H 3BGFB 2HT3C 1SMAA 4FQJH 2AXFB 2B20A 1OPGL 2XKNA 3FB6A 3EO1B 2DLIA 4I5BA 2MCPH 4XNYH 3RWCA 3U0PA 4ZS6D 5CLTA 5JUEH 3AB0C 3UYRL 3QWRA 3O41B 4HKXA 5CZVL 5ALCL 3TV3H 1AKJD 4PYHA 3TO2A 3EYSL 4RFNB 4YGVB 4M1DH 4M6OH 2DIAA 3C08L 1ZS8B 5KW9L 2MJWA 1NAKL 4HS8L 5C7XL 2O5ZH 1GGUA 3O6FC 4OCLC 4NO0D 1TETL 5F6IB 1WIUA 2X7LB 3VW3L 1MFDL 2VERN 1T2QL 5DJ6B 1ADQA 3ARVA 5GS2D 3V7AE 3BX7C 4R2GC 2VABB 5EOTB 2DD8H 1UB6B 1ZHNA 2FX9H 25C8H 2HFFA 3HI6L 1Y0LA 3T0EB 3FFDB 3SE9H 3MUZ1 4GMSL 3H9SD 2P42B 3PWPA 2VLKA 4P5KB 1FGNL 4WY7H 4JPKL 5IHUL 5IQ7L 4JO3L 4U1HA 5IESH 3ABZA 4YXKL 3HRPA 2GUOB 2XACC 2Q8AL 1GYAA 1CGWA 1GZQA 4HK0B 2G60L 2AS5M 4FP8H 4U2ZA 5KVDL 4BSJA 1A9BB 5D7IA 5T5FH 5LGJA 1H3PL 2BHUA 4O5LL 2ICWI 3KLAB 3P0VL 3T65A 2I9LA 2MQ0A 2DTML 2A6IA 4QY8B 5JIIA 5F9WB 1QNZL 2DQCL 1GGBL 5IFHL 5EA0H 1NMBH 4NQDE 2ID5A 3Q0HA 1BLNB 2P5EB 2PR4L 1CU4L 5KVEL 3OJVC 3T2OA 3TVMD 4BZYA 3QUZC 1OAZH 4EI5B 3PQYA 1F3DJ 3RX8A 1JPGB 4WHTB 1H8OA 1EVUA 1QRNE 3L3HA 5T1DL 1CXHA 1WBZB 3LB6C 4OZIA 1NCAH 5F9JB 1IGTA 2QSVA 2VDRH 2ICEB 4PJ8A 1NGXB 2VXVH 1C5BL 2AJVL 4OD3L 4F9LC 4P48A 3CSBA 4UUJA 2WP3T 3N1PC 3U9UB 2FHBA 4KK9C 3I6LE 1UGNA 2VZ1A 2UYLB 3D9AH 4XNZC 1ZT7B 2R2HA 3OJDB 5EU6A 2BRQA 2FNBA 1NL0H 5I8KH 5IMLB 3ZL4L 3NFNA 4XRCA 4PRDB 1U8KA 4Q9CA 2AABL 1BP3B 4HEME 4DQOH 3K3QA 4HFUH 1YZZA 3HE6D 4LARH 2H9GA 2Q3AA 2ZOKA 1KF9B 1A7BA 4U2YA 3BRFA 1IAMA 3W81A 1KCVL 1TZIA 4JFXB 3RWDB 5I71C 5E4IA 2WUBL 1OW0A 2YPKB 1IGYB 5DMKA 3IXTB 5GGRA 3BN9D 3EJZD 5D1QD 1J11A 3QRFM 3MLUH 1IAOA 5D7JA 4N0RA 3Q3GB 3HE7D 4K8RH 3VD4A 5AD0A 2AI0L 1ORSA 2GKIA 3HI5L 3INUL 3MROB 2XFXB 3G5XB 2ZJSH 4U1JA 4WHYG 4CVXB 3QEUA 5I1IL 4Z7VF 4PJGE 4M9OA 1S5HA 3W0WB 2P7TA 4Q9RL 1U41A 3GB7A 4LAQL 1GC1L 4KY1H 4PV9B 4U6TA 2DKMA 1DVFD 4OCRL 2GEEA 3B43A 5JQ6L 1QSFD 3CFKA 5BO1H 1EGJL 5F72S 4NC1E 4PTUB 2P45B 4P3CH 3X13B 2Y9RT 5L9DL 5CJXC 1HXYB 1BEYH 3Q1SH 5IB3B 3KJ6L 5LAXB 1RSFA 3HRZB 4J4PC 2ADFH 4K3JH 4MD5B 5D8JH 3ARBB 3MRFB 1F4XH 4CW1A 3NTCL 2X4TB 3V5DA 3GGWB 1XGPA 2EDDA 5FGBA 5FF6A 1L9MA 3ZKSD 1P53A 1G9NC 43C9A 4WI9A 4JG0L 3A6BH 4XCEA 3PHOA 3HI1B 1FO0H 2GJZB 5DA4A 5K9OA 1OP3H 3BP7A 4JQVA 5EO1A 3WFEL 2R9HD 5D96B 4H20H 5C2UB 1AC0A 1U91B 1R3HB 2V17H 3QHZH 5D72H 5D1ZA 5F3BB 2EDLA 3HFMH 3WNPA 3V52H 2Q76A 5FYKD 1GZPA 2YZ8A 1CGUA 4YAQB 3EDDA 2R29L 3L5WA 2NW3A 4HS3A 2QHRL 1N3NB 1LD9B 4JZNA 1S7XA 1CFVL 1EJOL 2FJGB 4MNHA 2AK1H 4KZEH 4GAFB 4RNRA 5FYKL 4N5UA 4KGJA 1L0XA 1TENA 5DWUH 5T1LD 4NWUL 4MB3A 4HIIA 3SBWC 4N90E 2X4PA 4PRAA 1TNMA 1TCMA 4KAQH 4F2MA 4IJ3C 2C3GA 1XCQB 3IDMB 3BD4A 2EZ0D 4JVPA 2EKJA 5D7IF 3VFUA 5E94A 3PGDA 1YUHA 3OAUL 5GSRA 5E2VH 2DICA 3VXMD 4ZFFB 5CSZB 4Z7WB 4MD4B 2GSGA 4D8PA 4M7ZB 2HG5B 4HJGA 1F6AB 3AS0A 4PRPE 5D70L 5DMJB 4XMKL 5IM7B 1INDH 3ULSB 5BQ7A 2KZ1B 5IGXH 5F6IC 5SWSD 4UT7L 3AROA 2GCYB 1LDPH 4JPVL 5GZOD 4PUBL 3RTQD 1MCHA 3D18B 4NQDA 1FO0A 1JZ8A 5HI5C 3QJHB 5MEQB 2NZ9C 4YBLB 2FGWL 3G08A 2X4RA 4LSRH 1KXTB 3T0EC 5JOPD 3DWTA 4CJ0A 3V6FB 4OZIF 5IMKB 3MBXH 3BGAA 3DOSA 4PJEF 3RL2A 4XP6L 4RAUA 1NPUA 1YYMH 3LMJL 5MERB 1QRNA 4J4PA 1JPTL 3BQUA 4PBWD 2NY1D 1MHCA 5KVFH 5CFHA 1TTUA 5GSVA 5FHBL 1UM6H 5HHOE 1OTUC 5T5NF 4U6XA 5C08B 4HUVA 3I9GH 3UTTB 3PJSA 2XG4A 4M7LL 2XWBB 2Y4SA 2CKBB 4OM0H 2V5TA 4H26B 4KFZC 2BSED 5CIPB 2QQQA 4KK5C 3BSZH 4N8CH 4JJHA 2BC4B 3FRPG 1W72B 3DROB 1NDGB 5JR1H 4AMKL 2A83B 3GK8L 1B2WL 4KDTA 4LKXA 2DM7A 3BH8B 4KVCL 4LLVA 5INCB 5C0BB 5KJRL 5MHSE 1Q1JL 3MV11 1B6UA 4M62H 3HTLX 2DJUA 1MVUB 2FH6A 1V7NL 3VFOB 1IC4L 2BCKA 3ZYOA 4PJAB 3BZ4B 4RGOH 3KPMB 5KG9B 1EDQA 1XIWB 2XY1A 2ZZUT 2EO1A 5TF1H 2DYPA 4PJGA 4FOMA 5HYQA 4ZUTB 5HHVL 2FR4A 3IDJB 4HFWA 3GRWL 1IC5L 4Q97A 3C5SA 1IGCH 3RA7H 5I75C 3MLZH 3QFJD 1MOEA 1N59A 1L7TL 2R2BA 4WW2A 4LLUA 4GG8B 4LEOA 2EDQA 4LU5L 2X10A 4UDUA 3TBTA 2EDXA 4LVOB 5JW5A 4UILL 5HDQH 2G5BA 5CEZD 4O51B 4RMVA 3ZYIA 1AQDB 2A1WL 5IG7A 2F19H 5ITFB 4L3CA 2YK1L 1PZ5B 2CLVA 3I6GA 2YZ1A 4JFFD 1ZVSA 4J1UA 2EDWA 5CEZL 3FFCE 1MCOH 2V9TA 3IETA 3HR6A 2ICWA 2CLZB 4XBGB 1P7QA 5D6DA 3QO0A 5T1KA 2NY4D 1E4KC 3WFCL 4NQVB 4YFDB 3KYKL 3SOBL 3V5KA 1A9EA 4RGNB 5D9SA 1RU9H 1RV6X 4G8GD 1G6RL 3MJ7B 4JFDE 1WC7B 4P3DB 1J1XL 3FQNB 3EGSB 2MPAH 1OM3L 3AS1A 3VH8G 3LS4H 2D7TH 4L5FL 1MRDH 3H9HB 2JTDA 2XNAB 5DJ0A 2A6KB 3BO8B 1RK1B 5EBWB 5DD6A 4EBQL 1CE1L 1HSAB 4PBVC 5BVJB 2UVFA 5TFSL 3CFCL 2VXTH 3D0LB 3QUKB 5TH2A 1I9RH 2Q8BH 3SDCC 3BDBA 5BV7B 3U6RB 2H8PA 5FIEA 2YBRA 1WK0A 5FUZH 4XNQB 3BIKB 2XTJE 1DQLL 5IMOB 3ARBC 4L4TB 3KS0H 4XXCC 4ZAKA 2VLMD 3ZMRA 1RZKH 1AO7B 1YECL 2A9ML 3WSQL 1BIIB 5E03A 4ODHH 4MJ5B 1KG0B 4FQPA 1RZ7H 4KKBC 4L9LB 3ARDC 4OV6F 3IDXH 1F3RB 3PGFL 2RR3A 2VC2H 4X5WA 3N9GL 2V7HB 1F11B 1YN7B 4U6YB 4F15B 5C86A 3QIBD 2X9WA 1AIFB 1P5UA 3O6LL 3VU2A 1I7TB 2QKIA 1XF4B 3MLVL 4H1LH 3BH9B 5IB2B 3TM6A 3V0WL 1UA6H 4BUGA 1KB5L 4ZQKB 4XVTL 4F33A 5DD3L 5FDWB 1UVQA 4PRPA 3ZLQC 5IOPB 3OJMB 1UJTA 5D96C 5DMGD 4GKSA 3VMOA 4ELME 5L7XH 2PO6A 3MV9B 1IAKA 1UEMA 4HC1H 4HEPG 4NNPH 1KJ2H 5BXFA 5DO2C 3TESA 5LVEA 4HZLB 1TZGL 2PF6A 2YUXA 4NWTH 4UNTA 5JIKA 1NUGA 3MRLA 1CGSH 3W11D 2FRGP 5JZ7C 1INEL 4YXLH 3RDTB 5JW3L 1A6WL 1MH5A 5D1XB 2R56H 4XBPA 1T5WA 3QIWA 4MDIB 5LCVH 1TTFA 3MCLL 2WINB 5DLML 2UWEE 3SY0B 5CILL 5EZIL 3F6IA 5C0AB 3R8BB 1FHGA 4FZEH 5B39B 1JK8A 2EXYD 1Q38A 2PN5A 4ODUB 3V7AG 5DEZA 5K9QG 3NCMA 4Z8FL 4JDVB 4PJIB 2ZSWA 2YPLA 1A47A 1R3KA 3D39E 5IJVB 3BVNA 1ZT4A 4JDZB 3ZHKA 1XR9A 1FYTD 3NMEA 1ACYL 2KPNA 1MSPA 1R3JA 4WDIA 4H1LA 1HZHH 2EDYA 4W4OC 1P7HL 4YBLC 1DQQB 3LKPA 2D7PA 4L8SA 5DFWH 1CXIA 2XZQH 1VFAA 3MYZA 5B3JE 1GAFH 3QEHB 3LKQB 4XPBH 1JHLL 2FWOB 1I1AB 5A2KH 5F21B 4JCMA 4WFGD 4JQIH 3CDYA 3ROOB 3KPQA 4PJGF 1WBYB 4PGBA 1FC2D 3BKYL 5CSBA 3LEVL 1X5IA 1VADA 2FX8L 3R8QA 1OGAE 4KUZL 2ADGB 4P59H 4ZDHA 1BZ9A 4NN7C 3V4VL 2CUIA 1MIMH 1ITBB 1M7IB 2YMXL 4P99A 1IAII 1BIHA 3THMH 2ED9A 1RUKL 3KYMA 3H2WA 3U0WH 3ZYZA 2VLRD 3JV4B 5GJSL 4G5ZH 4RMSA 1ZGLP 1QACA 4AIXA 4U1MA 4WO4D 3TJHC 5E5MB 1WFUA 4HGWA 2GFBA 5E2TL 4O2CA 4GH7B 5J9PA 4LIQE 1LO0H 4Y4HB 5FGCE 4MJ4A 4TTDD 1MJUH 1NFKA 3BN3B 5EOQH 5EU4B 4DOHE 2I07B 4PY8I 3GMMB 1BBJB 1HH9A 2KKQA 2YA2A 5KAQG 1PG7H 3CVIL 1E28B 1RJYB 5E8OB 4NJAH 5EC2B 3FFCA 1A4JA 1T21A 2YD1A 1FC1A 2NX5B 5T33L 3GNML 2YD5A 4I77H 1S9YB 4HHAA 1CLOH 1YEDA 5CUSL 3OKKB 5DRNA 5SV4A 4MSWB 3SE4A 5B8CB 2FBJL 4EIGB 2ZPKH 2HLFD 3QDJB 1XIWC 3FO2A 5FGSA 3TN0A 2GJ6B 4WFEE 1CIDA 2NY5C 4Y88A 4JFDA 2J8OA 3C5ZA 5ESAA 2M26A 4M48L 1XF3B 5IFJA 4XTRC 1U3HB 2BNUB 2DJ4A 3NCBB 1YMHB 2APXA 3VXQB 5TDOB 1QEWA 1JGVH 1T22B 4DK6A 3MUGB 3VI3E 2FO4B 4WUKL 2NY3C 4HF5L 1SM3L 4JM2B 2D9QB 1LP9B 3PWVB 4LVOC 4M5ZH 5DRZA 1QA9A 3WN5A 3QNXB 4LVNB 4LBEA 5EOCL 2H45A 2QR0B 4TNVK 1U95A 1UM4H 3ARFB 3GJEB 3FHAA 4GAGL 4OLXL 2Q86B 4O2FB 2NNAA 1OB1A 3C2AL 4Y5VA 5EZOH 1NFIB 1EV2E 2NW2B 2VZ3A 3C5JB 4O58H 4QRRA 4DKEL 1X44A 4X80H 1RI8A 1I7RA 4TN9A 1HI6B 4MJ2A 4PD4K 4TULH 1NCDL 3IDIB 4KHXH 2D0FA 5DUBB 2IGFH 3FB5A 3BKJL 2P1YA 3OF6A 4HX1B 1I1RA 3BUTA 1SY6H 2RHEA 4HV8B 4RGNC 4X4XB 3SQOL 4EN3A 4D9LL 3VXSD 2E7LA 1NGQH 3I02A 4TUJB 1JGUH 3CPLA 3PL6C 5CBAB 3DIFB 1AGCB 4UOJA 1E4JA 4YHZL 5J13C 1JFQH 4ELMA 3D2UB 3M1BB 1UACL 5LQBH 5C07A 1OGTA 1MPAH 2DQEH 4F58L 1LO2L 1CTNA 5C0IA 4LHUA 4S1DC 1TFHA 4IIQA 3UC0H 3D3VB 1W8NA 4RFOL 5JHLH 3ULUC 2D7OA 4W68A 4WWKC 3QWRD 1OLLA 1DBML 4K7PY 1D5IL 1ZWIB 3TYGH 5JLZA 4QRUB 4L9LC 1UCBL 1MCJA 1YNLL 1FFPB 1Z0MA 4PJ7A 1T0MB 4ZSOB 2C7UB 2UWEA 3WV0A 4F15C 5A3ID 2MQCA 2BSTB 2VWEC 3DURB 1WSST 4XPTH 1FL3A 4N0FB 1UXSA 2WQRA 4YZFF 2WLYA 4PGJA 4LIQH 4TVPD 1YYLH 2XWJA 2CR3A 3QG7L 2BVQB 5E6IB 5FOBA 3BPOB 1CDYA 1U3YA 3UJTL 4PP1C 3D39A 3OKNB 3WJLA 4XAKD 3GUTB 1RMFH 3G5VA 4P5TA 3MFFA 5E6YA 5DEFA 3V6OC 2B4CH 1SY6A 2BMKB 1KSRA 4FFYH 3MBEB 1ADQL 2AV1B 2DLEA 5KANG 4P2QD 5C0CE 2VLLB 3K4DA 4UBDD 1KGCE 1EAPA 3X14A 4BFGA 2X89A 5T3ZD 3Q5OA 4HWUA 2ZCLH 3SJVB 4AEIH 5HYIA 2H2SD 1UB5A 2YS4A 5D1XC 5JXEA 1WISA 4UAOC 5LKNA 1DN0A 5HTSA 3KLHC 2V2WB 3H8NA 4P5MA 3QRGL 4QWWD 5LXGL 1DL7H 1FJ1A 3QXWA 3ZZ1A 3DYPA 1YEHH 3GEWB 5FKAA 2A2QT 1OGAA 4LSQL 4NUJA 3T2NL 5I18H 5FA3A 4HH8A 4Z95L 1BREA 4FQJL 4YR6A 4XNYL 2MCPL 5JUEL 4HQQH 4YWGH 2APFA 2EE3A 2W60B 4PFEA 1M71A 4FXGA 5JPMB 4LVHB 3TV3L 3EAKA 1T3FA 3CZFA 4UU9B 4M1DL 1CXFA 5HHMD 1TITA 4LLYA 4OQ1A 1LEKB 3QUYC 4LEXH 4M6OL 15C8H 4XPFH 3SQBA 3VCLB 4JO1H 3LS5H 1D6VH 4GG6F 2O5ZL 4PJ8D 5E5UB 2HT3D 3P77B 4G6JH 4KH2A 1IEAB 4NQTA 2PCPA 3ECBB 1HN1A 1U36A 3T8XB 3IU4H 2YSSA 5ALBH 2DD8L 3L6FB 5EU6D 2FX9L 25C8L 5HVGB 1WT5A 5JDSA 2OTUA 1F3JB 3SE9L 3VG9B 4H1LG 5DJZB 5L8KB 3CUPA 1FAIH 2FZ3B 3OAYK 3LAFA 3O3DB 4CN6A 3RWFB 1U8IA 4WY7L 3MRRB 1G7IB 2R4RH 4GXUN 2R1WB 4YHPB 1T7VA 4HUMB 5CAYB 1YN6A 1NMCB 5IESL 4NIKB 4GW1A 3U0TA 1CFBA 2APBA 2GQHA 4HUXB 5D7JD 4FP8L 4F7EB 1LILA 4QOKE 3IJSA 1IEBB 5T5FL 1UWXH 5EUKA 2Y6SC 1VGKB 1X4ZA 4YDIH 4R0LB 5EA0L 5IBLC 1U93B 1NMBL 5TE4H 3TNMA 2P8PB 5B8CC 4PJCB 2FJHA 3O3EB 4OB5H 1E0OB 2Y23A 4OZGE 2X70A 2Z92B 4JFQB 4X6CE 4XC3H 4PJDE 3V95A 3T4YA 1FN4A 4JLRB 4ETQB 1NCAL 4X6BB 3I3EA 1OAXH 2VDRL 3WL9A 3TZVA 3E3QC 3MC0A 5D2LE 5J8OA 2VXVL 4JM2C 1FH5H 4JRYE 5GGSA 5IVXF 4NNYA 1RZGB 2JJVA 3MRDB 2WP3O 4NQCE 1QYGH 5JNYB 3D9AL 1DUYB 3QUZD 1XZ0B 1BM3H 1NL0L 5I8KL 2P49B 3ARFC 4MAUH 4K7PH 3QULB 3R1GL 5MEPA 2UWEF 3AREC 4DQOL 4WI2A 4HFUL 4WHCA 4LARL 1CS6A 3PP4H 3G04B 4K8RD 4NM8H 4K55A 5I15H 2CKNA 1VGEH 3FONA 4P2CG 5D1ZD 3MLUL 1VPOH 3OXRB 4K8RL 4NDMA 1NCUA 3WNLA 5HYFA 3WHE0 4QCIB 5FO7B 2J5LC 5I66B 2ZJSL 3O3BB 1R5IA 1NC4B 3OG4B 1MQ8A 4KTEH 3U1SH 3WIHH 2W91A 3WHE1 1ZGLM 3LEXA 4LSVH 3LQAC 5C0CA 2G2RA 1Q0XH 5KOMC 2EO9A 3RNKA 4BA8A 3RAJH 5D6CA 3VXUE 4GSDH 1AH1A 1K2DB 3OR7B 3EYOA 4KY1L 1HHHB 4J3WA 2W65B 1U6AH 2D4FA 1F97A 2C1OA 4JN1L 1CD1A 2DM4A 4XXDB 4WV1B 5F3HA 4FQQA 2X9XA 5BO1L 4P3CL 4GMTH 2YD3A 3QDGE 3JWDC 2ITCA 1BEYL 3Q1SL 4C58B 3S4SB 4K9EH 4K3JL 2ADFL 5D8JL 5EN2B 4NQUA 5FUOH 4FQXC 5HD8C 1XF5A 4LHUG 1F4XL 5TDPA 1U8NA 2CJUH 2AKRB 5E6IC 3D69A 4QLRA 4R7DB 4M9PA 1JCKA 3LPGA 2F9BT 5JOFA 3S35H 1JNNH 3LSOB 2EYSB 5DK0B 5IMMB 4IHOB 4JFED 2Y36H 3OHXB 1CICA 2JCCE 5ISZE 3MBEC 5IW6B 3A6BL 3C60A 4Z7OF 1FO0L 4PG9A 2HP4A 4JY6B 1JRHI 1QRND 4J4PD 1TIUA 3BQUD 5DURD 2YUZA 1M05A 1IARB 4H20L 4N9GA 3WS3B 3D5OF 1TXKA 2V17L 3QHZL 4KKLC 1SVZA 5D72L 3MLSH 4JPWH 3WIHA 5D7KE 3WS6A 3HFML 3KYOB 1VFMA 2AJ3B 3V52L 4HZAA 3NFPA 5ICYA 5BS0E 1WWCA 3NCCB 3RBSA 5I74B 5CKGA 3RWIB 4KI5E 1FAKT 1HXMA 1VDGA 1W2KT 4ODWA 4X9FA 4Z78A 4LOUD 2X4NA 2AK1L 4KZEL 2Z35B 4Z0BH 3DRQA 5F6HI 2CIIB 1C08B 5DWUL 4PTTA 3M45A 2HJFB 4KRPC 4F7CA 1J05B 3H3PH 3OPZH 4LPWA 4YHNA 4KAQL 2HWZH 4PJXB 1C5CH 2Z31B 1BJMA 5DMYA 4EJ1C 4C56B 2VITA 1QFOA 1MAKA 5E2VL 4UOW0 5FB8A 1XCTA 1EEYB 3U82B 4MD0B 4M61B 4Q6IC 4QOKA 5KZCB 1INDL 3ULVE 4FMKA 5F7FA 5IGXL 4U1IA 3DHMA 4YDVA 3MLWH 2WBJB 2Z8SA 3U4BH 1LDPL 2E7BA 2WIIA 2DYPD 2W92A 5DJ8B 3VMNA 1CL7I 4N0YH 5K59E 1G9MH 1JTOA 2GJJA 2JIXA 2Y5TA 3NN8A 4OF3A 4H25B 4RDQG 3SCMA 3TNNA 4LSRL 3ZSTA 2VDKH 3MRBB 3HC0A 3BEVA 4OZGA 2I5YH 3VG9C 3AUVA 3C87A 2HAZA 4NT6A 5HGHA 4DUVA 3MBXL 3PABA 5IR1B 3RL1A 1ZHLB 1YYML 4X4YB 2CDFA 4FTVE 4PJDA 3MO1B 1MCEA 3L3OB 3GIVA 5E56A 5KVFL 5L88H 5D2LA 3B9AA 3QB7C 1ZLWK 4UDTB 1UM6L 5JORB 1T1WA 4QHKI 4JRYA 3I9GL 2WM0A 4ZOAA 3S5LB 4I18A 4KRMB 3T0VA 3HZVA 3V5HA 4PREB 1R5VA 2ZUWA 5CP7A 1P7QD 5T1KD 5DA0B 3BSZL 4N8CL 1HHJB 3JUYA 5HI3C 1HE7A 4R0LC 4HIJA 3EHBD 3BEWA 1MRCH 4NRYA 1ZLUK 1XGTB 3CH1B 5JR1L 4UV4H 4JGMA 4XP5H 3MRPA 3QQ4B 3MLTA 3O4LB 1MHHB 1Q9OA 1YC8A 3GSRB 4WFHE 4M62L 4U3HA 3LKOB 4O2EB 2LE9A 2VXUH 3HZMA 3KYAA 2AK4B 3LN9A 3LHPH 2MMXA 4KK5D 3MA7A 3D48R 3OGCA 1IM9B 2BFVH 4G6FD 1YEEH 3QR2A 4RGOL 4EVNB 2CIKA 4ZAKD 3KJ4C 3QPQD 1CD9B 5TF1L 3EDFA 1CCZA 4Z76A 1ZK9A 1ZHBA 2F54E 3VXUA 2OL3H 4YBHA 1IGCL 4N90D 4XVUC 4P4RB 3MLZL 1HQ4B 4Z77A 4NPYB 4PY7B 4ACPA 3VXOB 1B4JH 1T83A 3TCLB 3AVEA 5F93C 2HVJB 5HDQL 2ORBH 1A3LH 1A6TB 1KYOJ 2QSQA 1G6VK 3BDYH 4CADA 4E5XB 3QJFA 3KR3L 1W0WB 2P43B 3LKNB 1MREL 1AXTH 1YDPA 1AGFA 1MCOL 3RWEA 4XCFH 2IALB 3GKWH 3ULVH 4PJBB 4KC3B 1KJVA 4H8WC 4J3TA 3F6LA 3D0VA 5ID0B 1WAAE 3LVEA 5IUSA 3MOAH 2H26A 2JCCA 5ISZA 5JXAH 1W0VB 1ND0A 4PG2A 1XH3B 2NLJA 3MUHL 3FT4B 4ZNEA 2MPAL 4RAVA 2NXZB 3LS4L 2D7TL 3QNZA 3QIWD 1MRDL 4RMWA 4MWFA 2IQAB 2QHLA 4PLJD 4MB4A 3S8WA 4KROD 4WV1C 3OV6A 2EIBA 3TH2T 5E8EB 3D25B 2VXTL 5D71H 4Z9KB 1I9RL 4XGZA 2Q8BL 5BS0A 2Z8WC 1OD7A 2OL3A 4JO4H 1G1YA 5FUZL 3VFMA 3MRGB 2FX7H 2YPLD 3G5YA 3QQ3A 5HY9A 3CU7A 2BNRB 1RZKL 1BJ1H 4LRIA 1D5ZA 4EZMA 4OLYH 3QUXA 5DK2A 1WEJH 4Y5YB 3MRMA 2EICA 3IDXL 4HJ0D 2VC2L 4L1DA 2IPKB 1HILA 5IEHB 2DMKA 2C3XA 2F8VA 3O6MH 5MHSD 3SDCD 2G75B 2IANA 5CEXA 2OXGA 4GJTB 1BQHA 1UA6L 2OXHA 4XNMA 3L7EA 1SYVA 1MAMH 1V3KA 4LKCB 4PIRF 1A7RH 2HFEB 4I9WE 4HWNA 2MOVA 1JRHH 3FQRB 3SDDB 3HMWH 5ID1B 5FHAH 3L3KB 3V6BR 3ARDD 4HC1L 3B3IB 4NNPL 5CEYA 1KJ2L 4G6AC 5I74C 5IB5B 4NWTL 3MUY1 4N1EA 1AP2B 2W0FA 1DANT 4BFBD 4FQLH 4X6CF 3WNNA 4MLIA 1L6XA 1CGSL 2YD6A 4YXLL 4NZDA 2OI9B 2R56L 5DJAA 4FTVA 5KSBE 1LDSA 4F7PB 5LCVL 4WNQB 3ET9F 5I1AA 5DRWB 3MV8A 2Z31C 5DHYA 5IHLB 5DO2D 4FZEL 1M6OB 1J9CT 4M1GH 4WTXA 4XT1C 3VFVB 1CFTA 1SYSA 3VFNA 3MLXH 5JPNA 1N6VA 1MFCH 3IXAA 2W9DH 5JZ7D 2C3VB 4JANA 3C8DA 1EXUB 3QAZC 2W0KA 5JA9A 4ELKB 3U7AA 2X1OA 3LQZB 5TE6H 5EZLB 3KPRE 4ISVB 3BW9B 3BXNA 3LV3A 1QFHA 5MEND 2HFTA 3CX2A 2GW5A 5J1SC 1MUJA 4XH2A 3GSVB 5F1NA 5K9KB 3L5JA 2XZQL 4P23B 5C0NC 4M6MH 3WE6B 1C5DA 3VFGH 4POUB 1GAFL 1UADC 4FFWD 1I8MB 4XPBL 1WWBX 2FYYB 4HWZA 2HT2C 2OTWA 1H8NA 2Q3ZA 3ILQC 4JQIL 2IJ0C 1LK2A 5I16B 4NCDA 5HI4C 3P0YH 3S34H 3QH3B 1T1ZB 3CDFA 3DYMA 4L8CB 2VISA 3NPZB 2EIZB 4P59L 4OZFB 1MIML 2F53E 3RVVD 2F54A 4Y2DB 1D9KA 2X41A 3THML 4QRRD 5L2KB 3U0WL 5F1SA 2VAAA 4G5ZL 3JV0A 4X6FB 3LKRA 3VGAB 5FECA 5DVNA 2QV2A 3OF6D 3VWKD 4M93B 3TPUB 5IKCA 4EN3D 4GRMA 5AZ2H 3N1QC 5AUMB 2GI7A 1LO0L 2BSSB 3DECA 1XR8A 2DQDH 4PR5B 5CD5D 4F7TB 1YNKH 1MJUL 1MJ8H 1S78D 5EOQL 1LE5A 2DQIH 1I1CA 5IROC 5C07D 3W0WE 5IF0B 1BVLA 1KT2B 4JZOB 1PG7L 1YPZB 1WZKA 4NJAL 3WLBA 4FZ8H 3CFDB 3OX8B 3GBMH 4LCUA 4LHUD 4PGDB 2JCCF 5GISH 1OSZB 4I77L 1CLOL 3W9DA 4OD2A 5HPMB 4S2SB 1Z3GH 2K3TA 1WAAA 2ZPKL 5IWLA 1QFUH 3N50A 3DV6B 3GMNA 3C2SA 4LVEA 3QFDB 3FOLB 2ZWLT 1QBML 5ICXA 4U49A 4LLDA 1T0NA 3X12A 2NTFA 2NPLX 4QF1B 5DFVC 1WFNA 3ZT7A 3KHOA 3QWOB 1JGVL 3F7YB 2AXFA 1OQXA 5SWQA 5LWYH 3DUUA 4M5ZL 2FHFA 3N1MC 1KN4H 4YPGA 4HKZB 3DO3A 2BVOB 3O41A 1I9EA 2APTA 2IFGA 4XX1E 3DX8B 3D39D 1FV1B 1UM4L 2LV4A 5EUOE 1N8ZB 1ZS8A 1RD6A 1CYGA 5EZOL 4GRWF 2ZOLB 4O58L 1RZJC 5L8JB 2V7NA 4X80L 5ETUB 2NY3D 2X89D 4GKZA 3STLB 4TULL 4KHXL 4FQIH 2IGFL 4IS6B 2X4UA 1SY6L 4KDVA 1U9KA 1PBYA 3ULVF 1HKFA 5EOTA 5SX5K 5JXED 1UB6A 1BWMA 3D6GA 1NGQL 1JGUL 3TO4C 3QBTB 4CGTA 5GRZA 5LJYH 3GMOB 3T3ME 5JOEA 1JFQL 3EYQC 4PGEA 4HS6B 3CFJB 5HYJD 5K59F 5KN5B 5LQBL 1P4LB 4M6NH 1MPAL 5DQ9A 1AE6H 5DD1H 5E1AB 4NO3B 3VXPA 1YMMB 3GMPB 4FXKA 3HNVH 1OGAD 5IIEB 4UINH 3VGBA 5HHQB 5I8CB 2VDLH 2VTFA 4Y7MA 3UC0L 5JHLL 1NMAL 3KXFE 3HUJB 1UZ6E 3TYGL 4Z7WE 3PL6D 5FYJE 3BI9X 2GK2A 4BQ6A 3WUWB 1Q0YH 3ARGA 1EMTH 5KSBA 5KS9F 4S1QH 1PEWA 3KLAA 1SEBB 4TOYH 3RPIA 5J06A 4PJ9A 4EQ2A 3WLWC 5B38B 1FRGH 4PLOB 4XPTL 2E7MA 1CDCA 3E1F1 1BLNA 5EU5A 4LIQL 3ULUD 1YYLL 4CNIB 4WWKD 4IOFC 4EI5A 4Z5RA 9CGTA 2QQNH 4GLRI 3SDDC 1RMFL 4WHTA 3TBSB 2B4CL 1IGIH 4WFED 5CGYC 3KPRA 4FFYL 3X17A 4ZUUA 4Q9QH 1XF2A 5C08E 4YE4H 2BVUA 4EOWH 2ZCLL 2VAJA 3RY5A 4AEIL 5EO0A 5GS0C 1PKOA 1G7PB 2YUVA 1NGWB 4PBXA 4CL7A 1TDQA 1DN2A 3KGRA 4QHNB 1T89C 4TNVF 3VI4E 4MJIB 2OI9C 4PP1D 2D31B 1MI5B 1T5XA 2W0LA 5IMLA 2WMPA 1RIUH 3CMOH 3TA3A 4WWID 1IILE 2CDEB 4OCSH 2FEEL 1DL7L 2KQMA 4Q74A 5SWZA 4TSBH 1ZA3B 1YEHL 2HT4D 1CFQA 5I18L 1V8HA 3BP5B 4FNLH 5I73B 1A2YA 2F53A 1KLGB 4APQB 5C0BE 4Y16A 2YPKA 3KYNA 4RA0C 1OWRM 4HQQL 4YWGL 4U0RB 5KAQF 2ADIB 1B6DA 2Z8VC 1R3LA 7FABH 4MJ6B 4G42B 4LEXL 15C8L 4XPFL 1MCFA 2DL2A 3ILPB 3EYFB 5FKPA 4JO1L 3LS5L 1D6VL 4AG4L 4M02A 1T4KB 3TZVD 3W0WA 4G6JL 2PKDA 2HJKB 3G6AB 3HC4H 4OGZA 1CQYA 3TBYB 5A40E 1WAAF 4HMCA 3PIQB 2O5XH 3IU4L 3DO7B 1U2CA 2EH8H 2YXFA 5ALBL 1FZOB 5HHPB 4GKNB 3QUYD 5IVNA 2NTSP 4XB8A 3GI8H 3C6LB 4YHLH 3CVHH 1JV5A 3GSWB 3P9LA 3QI9C 1FAIL 2HKFH 3FN3A 1D5XA 4OI9A 4Y2DC 4ZD3H 5LAXA 1S7UB 5IB3A 3MRQB 2DOCA 4UNUA 3H9ZA 3MRFA 1FDLH 2R4RL 4P2OC 3BKMH 2HLAB 3GGWA 3VGAC 4MA3A 5FYJH 4M93C 2WWKT 1S7WB 4QXGH 1M7XA 1XGUA 1VEPA 1AKJB 4LPCA 3K1KC 5DJCB 2G9HB 2W38A 1IAIM 4YDJA 4OUOA 1TPXB 3ZKND 3HI1A 5HGDA 4GOSA 5J3HC 2EDFA 2GJZA 3HZYB 5EUOA 3MYJA 2X1QA 5DJ2A 3ZE1E 2PTVA 4PYGA 4NO0B 3GI9H 5DDHB 2O61B 2R1YB 5TE4L 3FN0H 1R3HA 3GSOB 3ESUF 1KGCD 2MKLC 3NACH 3ZDYE 3OJ2C 5J1TC 4OB5L 4WJ5B 3RVXD 1OP5H 4GW4A 2HFGH 4P57A 4N1HB 4XCNB 3QO1A 4YAQA 1CT8B 2A0LD 3IU3B 3DTXA 4HBCH 1KLFA 4EXPX 2V2TA 4XC3L 4HUWB 1Y18B 3H9SB 2IH1B 1PSKH 2FJGA 5JHDE 1AO7E 4OGYH 5DMIH 1OAXL 3X3GH 1BFVH 3TCXA 4Y4KA 1IQWH 1FL6A 1FH5L 4LLQB 5CIPH 5J56B 3QDME 5DD0L 3UPRB 3CVHA 3TIEA 1NDMA 5C0JB 1QYGL 4Q0XH 2XA3A 4XZUB 3IDMA 4NQSA 8FABA 3QT2A 2WLZA 2Z93B 4F80A 3KXFA 4K7PL 3CAFA 4Z7WA 5CSZA 1NUDA 2HG5A 3RVWC 1CICD 4HAFA 3HZKB 4X7SH 5J11B 5AZEH 1CDUA 1DQJB 3PP4L 1C16A 3MV9E 3OR6B 1E6OH 2YD9A 5CINH 2VDMH 5I1LA 3L3JA 3W39B 2GCYA 5M7QA 4NM8L 4RZCB 4FS0A 5I15L 3G9VA 2EYTA 1VGEL 4OKDA 5MEQA 4ZPTB 3ARTA 3TVMB 4NKOA 1VPOL 3ZTNH 3S6CA 5CGMA 3V6FA 5IMKA 1ZLWH 3ARED 1D5MB 5FO8B 5F44A 2MHAB 3QIUA 4KTEL 5EPMB 3U1SL 1VACA 3WIHL 1CFNB 3GM8A 2X4OA 4LSVL 2P47B 4HAGA 1Q0XL 3RAJL 5HSFA 2FEDC 4GSDL 3VRIB 4LCCA 5C08A 4GXUM 3OB0K 4DCQB 1FQ9C 2D03H 1U6AL 3NCYP 1I1FB 1OTSD 2Y06H 4PJIE 4OD1H 1FVDB 5KOVC 2ATKA 1LO5A 3M17A 5D2NE 3T1FB 1ZLUH 3LD8B 4I2XE 2D7NA 5CIPA 5EZJB 3T0DA 3VGHA 1AD0A 3S5LG 4GMTL 3HE6B 4QOKD 4LMQI 4F3FA 1QR4A 1NBQA 2BC4A 4K9EL 5FUOL 3DROA 1FL5B 4KQ4H 2CJUL 3PWNB 4LDLB 1FG9C 4NBZB 5INCA 2R2CA 5D1QB 1MCSA 4GXVH 1QFWH 3AMLA 1KJ3H 4ZNCD 3S35L 1JNNL 2JIXD 4P9MH 3SCMD 3HE7B 2GY5A 1I8LC 3PNWA 4A2MA 4BH8B 2QEJA 4E42A 3VFOA 5CCKL 5BZWB 1EZVX 2Y36L 1CR9H 4WI6A 1MWAB 2DWEB 1MY7A 4GLRH 3DVIA 2Y7QA 2F74B 1RIVH 3BZ4A 5ANME 5HD8D 4FQXD 5KG9A 1IT9H 1GGIH 4X7EC 4ZUTA 5CGTA 3MXWH 5BV7H 4YK4B 3JTSB 3MLSL 1JGDB 4JPWL 1U8QB 3U48A 4J3XA 4JRYD 4PRID 1NUFA 1DVFB 3MGOB 5FAAA 4YX2H 1I3VA 1QSFB 1JF5A 4PV8B 4BFIA 4NNXB 1T7WA 5DC4B 4Y4FA 3HLAB 3FT3B 1OAKH 4Z0BL 1O5DT 5I73C 3CSPA 3ELAT 1KTLB 4APQC 1CTOA 2NY7H 1K8IB 1F2XK 4NP4H 3H3PL 3OPZL 2X1XR 1C5CL 1HOCA 3FCTB 5CJOH 2NX5E 4XBGA 1H0DA 3TPKA 5L2JB 2D7QA 3EFFA 2QSCH 4YJZL 3WIFB 4JGUA 3NGBC 5IFAH 4GW5B 4P3DA 4QXTA 2VE6B 1ZXQA 3MLWL 1LGVA 3U4BL 1LEGB 4KRPD 2CO6B 2XNAA 4N0YL 1G9ML 3BO8A 3P73B 1WV7T 5EBWA 4P46A 1Z2KA 5D93B 3ME0A 1GOGA 2VDKL 1LP9E 4JQXA 3QUKA 3G6JB 2I5YL 4QTHB 1YY8A 2PTTB 3U6RA 1T20B 1JWSB 3BUYB 2FBOJ 1AQKH 1PYWA 2VZSA 4OFYA 3AS2A 5ESQB 5JHDA 4MA7H 2DIJA 5T1LB 2OK0H 5L88L 3O2VH 4MS8C 4ZS6C 4J8RB 4OLVH 2R23A 4LPUA 4N8VB 1DEEA 4JJ5A 3QDMA 1KNOB 4LMQE 1IQDB 1YN7A 3T04D 1SJEA 4Z7WF 3MRNB 4MNQE 1H3XA 3ZKXC 4HUKB 3VXMB 2XIDA 3V79C 1FZMB 5JQHC 3UBXI 4CVZA 5HHNA 5ISZD 3B5TA 4YBQD 5IOPA 3QNYB 1MRCL 3FO9A 1UWEH 3CXDH 5SWSB 5C70A 4FFZH 2BY3A 3GDBA 4Y89A 1KELH 3MV9A 4UV4L 4JFOB 4XP5L 3RTQB 2XWTA 4ONFH 2X4QB 5DHXB 3B5GA 1BQUA 3KWWB 1XGRB 5A2LH 4K3EH 5SV3A 3D3VE 2CQVA 4KUCF 2VXUL 3VFSB 4U1GB 5D7KD 5DJDB 1F4AA 4D0CA 3GSUB 2CPCA 3LHPL 5H8DA 2LTQB 5BS0D 1JUFB 2BFVL 4QGYA 1YEEL 4KI5D 3KPSD 2V5SA 4HKBA 1T1YB 3BP4A 4NQEE 3B8SA 3TBWB 2Z91B 2NY1B 3PHSA 1R6VA 5AEAA 2ED7A 4V2BA 1JNJA 3UTPD 1HINH 2OL3L 1C1EH 3RHWF 3TT1H 5E8NB 4JM4L 1A21A 4JDVA 2L7JA 4PJIA 1MFAH 5D2NA 4JO2L 4GBXA 5J11C 1B4JL 2IAND 4I2XA 3AU1B 1GGCH 1YEGL 2B5IB 2GTZA 3BWUC 2ORBL 5IVZA 1A3LL 5ACZB 3GJFB 1U8MA 5H37H 3PWUA 3BDYL 1NGYB 5DQJB 1HK6A 1JPSL 2A74B 2QBWA 4NBYB 3QA3B 1QVOB 1AXTL 1FNEB 4XCFL 3GKWL 4L9DA 2LU4A 3QEHA 3ULVL 2FWOA 1I1AA 4PJAF 1F4YH 3AY4C 3NIDE 3VFPB 1R0AH 4XWGH 4LK4A 3IGAB 3MOAL 5JXAL 3F7VA 4J3SA 3CIQA 5B3NA 3IDGA 3W2DH 4WU7B 5ANMA 4FTVD 2J8UB 1TQBC 2L4OA 4V2CB 5F7DB 5CD3B 3EOAA 4QNPE 1YEIH 2JLLA 2OCFD 4MHHI 3ZSSA 1B90A 3MV8D 4H0IA 1RUPH 3QFJB 2GHWB 4XPGH 3SGKC 4OAWB 4AT6B 5HGBA 1KV3A 3IDYB 5D71L 3IDNB 1A7PH 3CFEB 3GSXB 4JO4L 2FX7L 1NCCH 3L3IB 3ZTJH 2DIBA 5HJ3B 3DVNB 2BJMH 5ILTH 4Y4HA 3UAJD 4OLYL 2VLJE 3EJZC 3LCYA 5D1QC 4CAGA 1WEJL 1AGBB 3C8KA 4G7VL 1M7DA 4JFFB 4HXAH 3GMMA 1BBJA 3UTZB 1I85C 1RJYA 2BNQD 1T04B 3O6ML 2NY4B 4PJFB 1T0PB 1F6LL 4OQTH 4CJ1A 4HKJA 1GC1C 2ARJA 1B0GA 3OKKA 2OJZH 1MAML 4RDQF 1A6VH 4G8EB 1A7RL 4G8GB 2PW2B 4U7SA 3G9AB 3ZE1F 2AV7A 1U0QA 3LQAH 4Z18A 2F5BH 2MWCA 1JRHL 4NHUB 3HMWL 5FHAL 5TDNA 3ZDYF 1XF3A 3JWOH 1DVFC 4P2RE 1U3HA 3JVGC 1YMHA 1A6UH 3QZWG 5TDOA 1T22A 2F54D 1MJ7H 1D9KD 2F15A 3Q5TA 4FQLL 3HAEG 1S7TB 3ROLB 5JMRA 3MR9A 4MQ7B 4AH2B 1J8HE 1DBBH 1P6AB 3WXWH 1TVHA 4L4JA 2Q86A 4BUHA 1S7VA 3MV7A 4BSVA 3VXRE 3WJJA 1H5BC 4IRJA 2EDOA 1KB5B 1NFIA 1BOYA 4G6AD 4MZ2A 5SX5H 3NFSH 2APWA 4WI8A 4M1GL 2A38A 3PDOA 3QIBB 3CFBA 1AHWB 1MCNA 3MLXL 5J57B 4JPIB 2D7MA 4MNQA 1MFCL 2W9DL 3B83A 2ZSVA 4X4XA 4HV8A 4QHMB 1JWMA 4PJHE 4JGJA 1AXSA 1WFOA 3GHEH 4TUJA 4J3UA 5CBAA 2FIKB 1NSNH 3DIFA 4KDWA 4RISH 3H7BB 4HWBH 5EO9B 5AWNH 5TE6L 4OQTA 5EWIH 3DYOA 4OZ4B 4BJLA 3RX5A 3D2UA 3K7UA 3M1BA 4CDGC 1XGYH 1KPUB 4M6ML 3VD9A 1MCWM 2FECI 3VFGL 4JFPB 5DS8A 3D3VA 1JZ2A 3DGGB 2XY2A 4L4VE 4TPRH 1AI1H 3ES6B 1BF2A 5JW4Q 3P0YL 4Y5XA 3S34L 4NQEA 4I3GA 3OKEB 1PFCA 1FFPA 4X5XB 4ZPVA 4LLMB 2EZ0C 2C7UA 2Y25A 4PJIF 2BSTA 4LSTH 3QG6B 2FATH 3BIBX 1KPVB 2YEZA 1CLYH 1UKTA 1S9WA 5IB4A 1IBGH 1FYTB 4OJFH 4BH7B 5AZ2L 1KPRB 3GUTA 5GZOC 2UZIH 3RTQC 2ZUQB 3TBVB 5JO5A 4S1RH 2DQDL 4KQ3H 1MJ8L 3DX7A 5H35A 2DQIL 4NKIH 1WIPA 2GK0A 4U1GC 5HPOA 4HWBA 2EEDA 3NIGE 3O9WA 4FZ8L 4MNGB 2LTQC 3GBML 5GISL 1P4IH 5H2BB 5E1HB 5TQ0H 2EDKA 4NO2A 2R39A 1JGEA 1FFNB 1Z3GL 1QFUL 2NY1C 4JZJB 3QCVH 4JG1H 3S36X 4ZMAT 3S98A 1T7YA 5IT2H 3ZYJA 5IP4A 3ARGD 3HMXA 4C83B 2UZXB 1CF8L 4PJ9D 4CKVX 3NZ8B 1U58A 4YO0B 2VLRB 3HS0B 5LWYL 4DUWA 3I75B 2IH3B 4WO4B 2ZUXA 1DZBA 2B5IC 3RIFF 3FOMB 2YHGA 4Z7QE 5JPMA 4F37F 2E9IA 4QHLB 5HGGS 3MLYH 5ECJE 1K4CB 5C09E 5T1MB 43CAA 2GSIA 4YC2B 4JRXE 3ZDZF 1ZANH 1LEKA 4EI6B 3DX9B 5I1DB 1QD0A 1ZLVH 3KPRD 2VLJA 3DSFH 1HEZB 4X0KA 3BP6A 1LO4H 3UBXA 3VWJA 3STZB 1IEAA 1CLZH 2ENSA 2OS7A 1KBGL 3VWKA 4MCZA 4GFTB 2ATPB 4FQIL 1VKXB 1F13A 4NKDA 3T8XA 3L6FA 1UZ8B 1P7KB 1RAMA 1I1YA 4HUUB 1F3JA 1ZLSL 4F9PA 3ALPA 5DJZA 2HTKD 2GAZB 2DWDB 3TA3D 2Q6WB 4M6NL 2Y72A 3O2WH 1AE6L 3O3DA 5E7BA 1FNLA 4L8DB 5DD1L 4JM2F 1JBJA 5SWZD 1LP9F 3MRRA 4P2RA 3V8CA 3HNVL 2R1WA 4UINL 4YHPA 2PYFA 3FB8B 4YIQB 2F53D 2VDLL 5DEGA 3I2CH 4Y16D 2EIEA 5GS3A 2ZUUA 3PDDA 4L1HA 5F9DC 4F7EA 3TO4D 1J8HA 5HYEA 1Q0YL 1IEBA 3ALXA 3TJEH 1EMTL 5ENWB 5GQBA 1RZFH 4LP5A 4S1QL 1PZUB 3FT2A 1OP3K 3GO1L 4TOYL 2AJZA 3LRSA 3P4OB 3VXRA 3GMQB 1U93A 2H6PB 1FRGL 4UQ3A 5JW4N 2JKXA 1DDHB 1X3DA 3MREB 4FQHB 2FSEB 3VXSB 2VL5B 4UQ2B 2A6JA 2QQNL 4PJHA 4ZUVB 1MCRA 4OLWH 5ESVB 4GRLA 2C4FT 3NABH 1IGIL 3LKSA 5J1AB 4ETQA 4X6BA 1CI5A 1SJVA 5EBMA 1YY9D 5B4MC 3WLWD 3M07A 4Q9QL 4YE4L 3RBGA 3MX0A 3FB6B 1RZGA 4I5BB 5JNYA 3RWCB 5DC9B 3MOBH 2PYED 1NEZA 4I0PA 1FVEB 1XZ0A 5ELIA 2C1PB 4HKXB 5AAWA 3ZKMC 4L4VA 2IAMC 4M7JH 4HG4K 1RIUL 3TO2B 4N68A 4XWOD 3CMOL 3B9KC 5FDYA 5GRUH 1H9VA 4OCSL 4P4KC 4TSBL 1UC6A 4KMQA 3QIBC 3K4AA 4LNVA 4FNLL 2EC9U 5HXMA 5F8QC 1L0YA 5GS0D 3PWJA 3AGVA 3NOIA 1FFOA 3OXRA 5E8PA 5DMGC 2KUTA 2AK4E 4RIRA 7FABL 3MLRL 4M3KB 1P1ZA 4AK1A 5I66A 1Y0LB 2NXYD 2IPUK 3LN5A 4U6VH 1NC4A 4O02H 4P2QB 2P46B 5K9JH 1TVBA 3HC4L 4Y4KD 1K2DA 4HDIA 3GSNB 4U1HB 4ZFZA 2IQ9H 1DFBL 2O5XL 1AY1H 2EH8L 4L3ED 2DQTH 1N2RA 3FB7A 1GZQB 2GTWA 1R5WA 5JW4R 1DBJH 3KXFD 1VA9A 4QNPF 3GI8L 3T2PA 4YHLL 3CVHL 2HKFL 4ZD3L 4Q7DA 5DZLA 3U2SA 3T65B 2I9LB 2A6IB 2K7PA 4Z6AT 1FDLL 2C9AA 5F7LB 1BF8A 1QLRA 5GRWA 3BKML 2AKRA 5FYJL 4FN0A 4I8DA 4R7DA 3TC9A 3CLFH 5EU7E 2IBGA 4Q6YA 4QXGL 2WWKO 2K7QA 4PJBE 5DK0A 2EYSA 4WUUE 2ZUQC 5TQ2H 3BISA 3OHXA 5C09A 5HHMB 5IW6A 5JDJA 3ORJA 4OI8A 3L3HB 4JRXA 4KKAC 3QI9D 3JV6B 3QIUD 1M1SA 3HG1E 1IGTB 1CN4A 1FFQA 3MGTA 4PJ8B 4YH6A 3NCEB 1NGZA 2VSDA 4P2OD 3FN0L 3WS3A 5L6YH 3HN3A 3NACL 3OG6B 2JK5A 4TVSa 4UUJB 3AB0B 3VMPA 2AJ3A 3MA9H 1TJGH 5FO9A 4JZJC 3MODH 3WHXB 2HFGL 4OIAA 1KJMA 5EU6B 3SGJC 3VJ6A 1ZEAH 3TH4T 4ZOBA 4HBCL 4XRCB 1R3IH 1YEFH 1C7SA 4OGXH 5J3HD 1PSKL 2BNRE 1DCLA 3NIFF 4OUUA 5FXCH 2Z35A 3AS3A 4OGYL 3X3GL 1VFBA 2H9GB 4LCWE 1A1NA 1BFVL 1C08A 5MEOA 3BZEA 1IQWL 1PJ9A 3BMWA 4NZTH 4WO4C 3VH8B 1TZIB 1SVCP 4ZYKB 2VDNH 4MMXC 2JJTA 4ZTPH 5DMKB 4Q0XL 5BW7C 1DEDA 3LPFA 5E9DE 3VE0A 3HR5A 4YC2C 5D7JB 3VFWA 1M4KA 2GT9B 1N64H 3PWLA 3RKPA 1ORSB 4M61A 1VB9A 5AZEL 1A1MA 2VIRB 3MUJA 2E27H 4LASH 3QEUB 5I2IA 1E6OL 1Z9LA 2VDML 5CINL 1ZE3C 2WBJA 4PJCF 1EO5A 2P7TB 2EEBA 3VXTB 5KSVB 1IE5A 4XHQA 1N5AB 3FKUS 2HLFC 3L5HA 4QXUH 4H25A 4QXWA 1I3RA 1IGMH 3MRBA 3ZTNL 3VGDA 4AENA 2CRMA 2LU3A 4TUKH 1HDMA 3CFKB 3BMVA 3WFZA 2X05A 5IEKA 5IBUG 4X4YA 4R4FH 4I48B 3MO1A 1UH3A 4Y4FD 3HCVB 4Y2OA 3MNZA 3KNBB 1J1PH 3UBXG 3WDIA 4LQ1A 2DKUA 4CW1B 4LL9A 4X98A 1X5XA 3E0GA 4N0UE 4U3XA 5GRVL 4B41A 3V5DB 4HD9A 1XGPB 4AEEA 1GH7A 2D03L 5FF6B 3SDXB 3QUZB 4PREA 2Y06L 4OD1L 4RX4A 2H2PD 4L29B 4HIHA 1Q9LB 1U8PA 3PHOB 4G8FB 4XP1H 3VDAA 3O3AA 3CXHJ 4KQ4L 1QSEA 3QHTC 4MA8H 3CH1A 5K9OB 2FEDD 3BP7B 2X5PA 4PS4H 5EO1B 1MHHA 5C0RH 4GXVL 5BRZE 5D1ZB 1EUUA 1QFWL