3MJGX

The structure of a platelet derived growth factor receptor complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
280
structure length
274
Chain Sequence
LVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFSGIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGNEVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDHQDEKAINITVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a platelet-derived growth factor/propeptide complex and a platelet-derived growth factor/receptor complex.
pubmed doi rcsb
molecule keywords Platelet-derived growth factor subunit B
source organism Homo sapiens
molecule tags Hormone/transferase
total genus 50
structure length 274
sequence length 280
chains with identical sequence Y
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00047 ig Immunoglobulin domain
X PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mjgX03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mjgX02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mjgX01
1J1OL 2R2EA 4G9FA 4JQIL 3FQWA 1OTUC 3T0XA 4JFQB 4PRDB 2D7MA 5TJWK 5AYUL 4BH7A 5BJTA 3LPGA 3O45A 3RVUD 3U4BL 4QXGL 1LEGB 2ZG3A 5CILH 4BUHA 2XPGB 1CFTB 1D3CA 3SJVA 1A0QL 1FVDB 2ATPA 1R3LB 3AM8C 3HR6A 1DN2A 4AH2A 4Y5YB 4FQPA 5HYJE 2I26N 2FECI 2CQVA 4MCZA 1RPQA 4RFOH 4EQ3A 1U8IA 4ZD3H 1U8LB 2NYYC 4KI5F 1BQHG 3A6CL 4ZFGH 1SBSL 4OD2B 1FRGL 4CW1A 3OGCB 5DSCB 1G6RB 4MAYB 1SYVA 2HN7A 2VAAB 4BSVB 1TVHB 3VGGA 5CBAA 3X3FH 1DUYB 3O81A 3MCKA 3QUXD 4HLZG 1MCLA 1I8IB 3MV7D 2JF1A 5IFJA 4U1JB 4E42B 3T04D 5DJ8A 3PWUA 1Z6JT 4PJXA 1KG0B 3ROLA 3JXAA 3R06A 5C0CD 5DK0A 1OAKL 4Z0XA 3DRQA 1NCAL 4Q6IA 2WUBH 5EU7C 5IVNA 2ARJB 2AW2A 1W8NA 4QF1A 3THML 3D0LA 3IKCA 4I77L 4WEBL 1KGCD 3AROA 1NFDA 2QQKH 2AJXH 3GBMH 4L3ED 3BEWB 5J4MA 3F5WA 1ZSDB 4YXHH 1T83C 3LN4A 1I4FB 3FT4A 3T0WA 2R23B 4PJEA 5D2LB 4Y7MA 3GKWL 5IT2L 1F4YH 5E00A 1J0HA 2BDNH 2MKLC 2DS4A 3HG1B 2CH8A 5DJZB 1TVBB 2DYPB 1JZ4A 4NO2A 3D69A 3QIBD 5I6XC 4W4NA 1IL1B 3X3GH 3MRMB 4ZNEE 3UTSA 3KLHC 1SY6H 2XACC 3LB6D 4XCEA 4L1DA 2BY3A 3I2CH 3MRQA 3U6RB 1A5FL 2EC9T 3QXDB 1GPOL 3O2VL 1L7IH 4PJ8C 4MJ4A 4YDIL 3TZVD 2XG5A 1MVFA 1MCJA 2N7BA 2QADC 4D0BA 5IJKC 3DVGA 3QWQB 4KY1L 2IEPA 2VXQH 5JZ7C 3WIFB 3FHQA 3GK8L 1ZEAH 3TN0A 5EZOL 3QXUA 4WY7L 4K3GA 1JZ8A 5K9OB 1RIVH 1NC4B 1NLDL 1F58H 5B39A 3L5XH 1KTLB 4LOUD 4N1CA 1I7TA 3RRQA 4U1MA 5F7DA 2B5IC 2M1KA 4FFYL 3S98A 2VXVL 3O6LL 4BQ6A 4NN7B 4HAFA 4K8RD 5D70L 3ARXA 3GEWB 3DUUA 4XMPH 3GSRA 1MH5A 5I18L 1U8QB 5FKPB 3VXSD 2BMKA 1ROWA 4NUJB 1R6VA 5MENA 1I7UB 2NX5E 1Q0YH 1RUPL 3ROOA 4NKQB 2Q7YA 4W68A 3F58L 4NHUB 2XZAL 1IGTA 1LE5A 5FUOH 4X8XA 2K9UA 1SEBA 3MYZA 2YUWA 3L95B 1I8LA 3L7FA 3PJSA 3VXMD 4DEPB 4U1HA 1ZHKA 3BI9X 4BA8A 1GH7A 1QFUL 3GHEL 2GSIB 2B8OT 2I5YL 4ZSOB 3UAJC 3WFCH 3K74B 1IC4H 4JO3L 3ULUD 4JCMA 4P49A 1DDHB 4TSAH 5KW9H 3KNBB 2ZPKL 1NL0H 1YEHH 2FWOA 1EMTL 4GFTB 3LCYA 5I8OL 3KLAB 4XC3H 1XF5A 4DAGH 3V4PL 1TJIH 5AD0B 4X7DC 5IVXE 5I71B 1UQSB 3NN8A 3RWEA 2BCKA 1CDCA 3P9MB 4KVNH 4PY8J 5CEZE 4LHQB 1VFAA 2D7OA 1N64H 3WNMA 5T1KA 3NFSH 3NCCB 2CR3A 2FJFB 4DZBA 5ITFB 5EU6D 1T20B 2PO6C 1GXEA 4V1DB 2V7HB 4FZEH 3PE9A 1QFHA 5IEKB 3LSOB 2Y6SD 3MRLB 4I9WD 4U6HB 2CK2A 4HSQA 5HHXL 3UBXB 5D71L 1MRDH 3UTZA 5E5MA 3ZE2E 4JGMA 5MEQA 3ARDB 2XKNB 1WZKA 1OVZA 5CEXA 1NBZA 2HTLD 4QYOA 4OLVL 2HWZH 3GSWA 4NOBA 1IAIH 5GRJL 3MZGB 3PHSA 4GLRH 3WL9B 4LMQE 4XCCH 5F7HA 4H20L 1U8MA 2HMIC 1BM3L 1PLGL 2MJWA 4P59H 1CD0A 4ZUSA 5EH1A 4L5FH 3BRGC 1UC6A 5D7JB 4HIIA 2F5AL 4I0PC 4I4WA 1T0MB 3BDYL 5CZXD 4Y5VA 4M6OH 5DYOA 1ZTXL 5HHOD 5HI4D 4S1DC 3H3PH 2YA1A 2V2XA 2C3GA 5LGJA 4PG9A 3RP1A 5IM7B 4Q6IC 4ZS7H 1OGAE 2PCPA 3QIWD 5FM4A 3V79C 5D7IF 4D9RD 4M62H 4OQTA 3P73B 1CL7I 1OPGH 4RFOL 3W0WB 2JKXA 1OP9A 2GKIA 2GSGB 4WO4A 3ULVD 1EO8H 4ZD3L 2I9LB 5GRUH 1L7TH 1YPZF 2SEBB 1QSFA 5A16A 1IAMA 2FCBA 4ZFGL 2P44B 4CMHC 4LSUH 3QUZB 4KMLB 1MI5E 4TSCL 2EE9A 3GJFH 3BEVA 5CGYC 5C09D 2OS7A 1HI6A 4OZIA 1HXYA 2CIKA 4HWBH 3X3FL 3AY4A 4TVPD 1QQDB 1J0IA 4PJBF 1OAXL 4ZFFB 1HKLL 2KZWA 5SWSA 4YDJB 1JWMB 5ESQA 3F65A 2YHGA 2VLRA 1DTUA 4BZ2H 2APXA 5EORH 2WUBL 4O2FB 1MHCA 1V5JA 3DMMD 4XPTH 5F9WC 1YEIL 1WFUA 3DPBA 2CDFA 4KWUA 2QQKL 4GKSA 5I6XB 4HBCH 1KLGB 4HIXL 1WZLA 1OLZA 3MGTA 3TJHD 4YEEA 4DGIH 5H2BA 2QV2A 1F4YL 4PJHA 3OTTA 1ZKAA 1P69B 4PJ8B 3RAJL 2APTA 3SKOA 3LEYH 3BUYB 2QADB 4IBLT 2QEJA 5DJYA 2CRZA 2O5XL 3X3GL 1NAMH 5C7XH 1WEJL 2FH6A 1SY6L 5GHWH 4PJ5A 5F7UA 2X42A 4X9HA 4UQ3B 4C83A 1I8LC 2GAZB 3WO4C 2B5IB 2BNRD 1Q1JL 4LCCB 5EC2B 5DMKB 3P4OA 1LVEA 4YBQC 4HUWA 2CPCA 3VFWB 4DUVA 5T1DL 5I1CH 2AV1B 1YJDC 3RUGF 4K71C 4C57C 2BRQA 4LAQL 1T4KB 3PNWA 4LSVL 4POYA 2FL5B 2IALB 3VXUE 2KDGA 1VERA 5DEGA 3AS2A 2OL3B 3MXVH 5D7JD 4QTIL 4XMPL 1ZANH 5F96H 1MCOL 2HKHH 1WISA 2ZKHH 1H0DB 1VACA 4XNUH 4HXAL 3G04A 5B38A 1A1NA 1QEWA 4RGND 2OQJB 3QDJD 5JIPA 5HDQH 4M43H 1UXWA 3LMJH 5FUOL 3NIGE 1T03L 5ESVB 3WDJA 3BPLC 3OZ9H 4RNRB 5EO9B 3T1FB 4LK4A 1UT9A 3HNVL 1YQVH 4FQCH 3DUSA 2NY6D 4GAFB 4AY0A 5DC4B 2YPLB 5T5NG 1K9TA 1N2RB 1RZFL 2FHCA 1KB5B 1UJ3A 4TSAL 2W07A 2ZUQC 3B2VH 1F11A 4OI9A 5KVGH 4Z6AT 3EJYD 5GJTH 2AEWA 2NLJB 5CP3A 3QUZD 4XC3L 2PO6B 1KELL 1HDMA 4PD4J 4JO4H 3GMPB 1G7MB 4Y2DA 3MV9D 1GOHA 4G9FB 5FGCB 3O6FC 4KVNL 3FQWB 4KPHH 3CPLA 4A6YL 4BH7B 2EKJA 4XX1G 1S7RB 3DROA 2BVYA 4O2EB 1KIQA 3SJVB 1JYVA 4LEOA 2ATPB 1GGCH 1VA9A 4Y5VC 5L88H 1CD9B 1T7XA 4G7YH 4MCZB 1U8IB 2YZ8A 4FTVA 3ARFD 1OT1A 3VFOA 1IT9H 1ACYH 5HY9B 1MRDL 5J13C 1J8HA 3S5LG 1KN4L 4MMZC 1WTLA 5L9DH 4CW1B 1MF2L 4K23H 1SYVB 2R0KH 5DQJB 1DANU 4WO4C 1NMAH 5I8CB 1IAIL 2UWEA 5TF0A 3MCKB 3BOVA 4PJCE 5D5MA 3CFDA 3N1FC 4DN3H 3PWPE 3GRWH 4FXGA 4MGXA 4F8TA 3BGFC 3LQAH 5K9QG 4PJXB 3IDGB 3GO1H 3AS1A 1WTGT 4P59L 5DUPL 3ROLB 4HUNB 3V4VH 5IVZA 4L5FL 4M03A 4CBPA 4Q6IB 3AY4C 1KLFA 2VZ1A 3MUJA 2ZUUA 4FZ8H 3D0LB 2XV6B 4OF6A 5EZJA 1FNSH 1BWWA 2NXYD 4M5YL 1U6AH 1S9WB 4D2NA 4WFGD 1XT5A 1FYTE 1QSEA 3F5WB 3LN4B 4CN1A 3ARZA 3PXJA 4JKWA 1G0XA 4EVNB 3MGOA 4L1HA 1S9VA 4PBWD 2R39A 4ZS7L 3CMOH 3HZKB 3H9SE 4CMHB 3IXTA 5GGQH 4JG0H 1QFWH 1IGML 4R96B 2F74A 4U7KA 4NO2B 1OPGL 3D69B 1KV3A 2YSSA 4JHWL 4XHQA 3UTSB 5GRUL 3A6BH 3H7LA 1H8SA 4XCEB 4EUPA 1YDPA 4HF5H 4JJ5B 1FLRH 5E1AA 4OBSA 4CDGC 5C3LD 2P42B 2DN7A 3EJZC 5TE7H 3KHQA 1MVUA 4NQCD 1AGBA 1XCTA 3L3OA 1RVFL 3B3IB 5I1GH 1REIA 4HWBL 1MY7A 5F9WB 4HEPG 4MZ3A 3P77B 3VA6A 1UVQB 1UKQA 5CSBA 4XI5D 2X1OA 2XYCA 3DLQR 4KRMB 1I7TB 5D7KE 4I3SH 1WFTA 2F58H 2HJLB 4NQDD 3QUYD 4DQOH 3CNKA 2EIDA 4WNQA 4JPWL 4XPTL 3MROB 3GSRB 1MH5B 3IDYB 1FFOB 4UT9H 2BMKB 2DKSA 4YHPB 3Q5YA 3QJHA 5J8OA 5MENB 1OWWA 4M7JL 1JWUA 5IWLA 1KEMH 2C3XA 4PJIF 5FB8A 4HBCL 4KRPD 1KXTB 5GGVL 3QUML 4DGIL 4X4XB 1A9EB 1IGTB 2O5ZL 3SDAC 5B3JE 2HLFC 3IFNL 4O9HL 2EDQA 1C12A 3L7FB 4HKJA 3SJVD 2ZOLB 3WO4B 3VXQA 4F3FA 1MY5A 1FV1A 1XIWD 4MB3A 3QCTH 4ODTH 1NAML 4P9HH 3SDXE 3OKNB 4OUOA 3PGDB 4OZGA 4K71B 2GJ6A 2RR3A 2FWOB 4P2RB 4HZLA 4LPWA 5CJXC 5GS3A 3DBXB 5IESL 1XF5B 5I73B 5IK3A 4L8DA 4FQJL 1VFOA 1KULA 5CGMA 3NN8B 3RWEB 1OWRM 5DVKA 2NY2C 1YYMH 2BCKB 4I8DA 4MNQB 5I1CL 3ZE0F 1UJ3C 4FNLL 4R4ND 1LQSR 1SM3L 3O6MH 3FO0H 1JI1A 5DR5H 5GGRY 5CJOH 1HHKA 5TDPA 3FCTA 4LU5H 4RIRA 3OXSB 1U95A 3MUY1 2E27L 3QHZH 4OAWA 2YC1A 3MXVL 3QWOA 2OR9H 1X5AA 4X6CF 3BPLB 1FG2B 5F96L 2HKHL 2X5PA 1TCMA 3V95A 4FABH 5F8RC 4JB9H 2ZKHL 2ED8A 3L6FA 3RIFK 5E5MB 5EUOA 2XT1B 3CUPB 5MEQB 5HDQL 4M43L 2ZUQB 5CEXB 4IHOB 4WW1A 3KPQB 1NBZB 1RZIA 4KDTC 3MOAL 3GSWB 3OZ9L 2DDQH 3VE0A 2G2RA 1RHFA 2VOTA 1SHMA 1YQVL 12E8L 2P46B 3EGSA 1ORQB 1U8MB 3UTSD 3UO1H 3B2VL 5IFHL 4WEUD 5AWNH 4ZUSB 3GJEB 5KVGL 5E9DE 3LKQA 4RCAA 3QZWA 4NRZA 5GJTL 3KG5A 2V9TA 4X83A 4I4WB 5D7LB 4JO4L 4Y5VB 5DYOB 1JIBA 2P1YA 3D3VE 3ULUF 4MB5A 4H1LA 1X6LA 2V2XB 1CU4L 5LGJB 4X4YA 5K33A 4Y1AB 4KJYA 1AQDB 5F71A 2AQ2A 1MCRA 4PG9B 3TN0D 1JZ6A 4H26A 5INDA 1CN4A 4PJAF 5J13B 1TIUA 2PCPB 4YFLF 4POZC 1AJ7H 1GGCL 3MLVH 5L88L 5A3IC 1UWGH 1WJ3A 2AJSL 2H8PB 3DVNB 3MBEA 4IOSD 4WO4B 3BHBA 4W6YB 4KAQH 4ZFOB 2DLFL 1IGJA 3SE8L 1IT9L 5MEND 1ACYL 2NXZC 2W0PA 2OMBA 3SKNA 1Q9LA 1V8HA 5L9DL 3BGFB 3GNML 5EN2A 5CLWA 1BD2E 1BEYH 4K23L 3BEVB 4Z9KB 2ZJSH 5GS0H 4OZIB 1NMAL 1HXYB 4XC1L 1PEZA 4I1NB 2CIKB 4MQ7A 3SDCA 4X99A 1TETL 3EYQC 5ID0A 1S9KC 3GRWL 5SWSB 2P5ED 3X11B 3T2NL 1WZ1L 1R3HA 5ESQB 1LO4L 1EO5A 1FHGA 5D2LF 4HLZH 2VLRB 5A2FA 4J2XA 1CD8A 3F8UB 4Y16A 1H3PL 4XMKL 4DKEH 1PSKH 1MHCB 1D5MA 5DJXA 4FZ8L 3QHTC 4P99A 2AJVL 5LBSL 5FYKH 5SX4H 5T3XH 4HJJH 1F4XH 4GKSB 2J7LA 1U6AL 3MGTB 1E28A 2FECL 1CL7H 2XI9A 3TA3D 5T1KD 1A9BA 2CK0H 1EEUA 4PJHB 4H25A 5GGQL 4OI8A 1K5NA 4JG0L 5T5FL 1WCQA 5BS0A 2F54A 4B41A 5ILTH 3IFLH 4HUUB 3DV6A 1N59A 5F7KC 4M8VA 5DJYB 4NJ9H 3BKML 5GRZA 3TPUB 3H0TB 5DTFA 1CK0L 3A6BL 1CI5A 2VDOL 1FLRL 3QBTB 5IBTH 2R69H 3MGAA 1Q8MA 5TE7L 4F33B 1C8PA 2NY3C 3B5HA 3ULVF 4ONFH 3P4OB 5HGAA 4NFBA 4HUWB 4W4OA 1WAAF 4KI1A 4P57A 1XR9A 3ILQD 4M61A 1MQ8A 4Y8AA 3BKYH 3HNSL 2D31A 3I85A 3PNWB 1EGJH 4N5UA 1NCCL 2Y7QA 3JVGA 3N9GL 3BPOC 4OZHB 1RK1B 2F58L 3G5VB 4Y2OA 2X6MA 5B21A 5DEGB 4CADB 4DQOL 3BO8B 1VPOH 3SDAB 1X5XA 2BVTA 2NY7H 5C08E 4ZNEA 1JV5A 4QXWA 1PKQE 1JCKA 1F2QA 1KEML 3G04B 4QHMA 2AQ3A 1JL8A 1KJ2B 3P0YH 5B38B 1A1NB 1QEWB 2BVQB 1P4LA 3F7YA 4HKZB 3BKCL 5D9SA 4N68A 1A6ZA 3S36X 3WMSA 3EOBB 2ORBL 1T66D 2LTQB 4NC1C 1CVRA 2H2SC 1CTOA 3ARBC 3DUSB 4P9HL 1OSZA 2QJDA 2OR8A 1UJ3B 2GIYA 3IAGC 4KH2A 1QSFD 4FS0A 3HI6H 4X9BA 4JM2D 2W65A 3E2HC 4TUOA 1E6JH 3OKMA 1UM4H 3FONA 4HKBA 4JGUA 4YK4C 3MBXH 5KSBE 4KROD 4Z7QE 2HJFB 1GGIH 3ECBB 2F8XC 1T04B 1WIPA 2BVPA 2C9AA 4HCRH 2G9HA 4JM4H 2VSCA 4M6AA 1SY6A 1A3RL 2VZOA 3DROB 5SWSD 1IFHL 3O6ML 1CGVA 4GW4B 3FO0L 3HFML 1KIQB 2VQTA 2YRLA 1WUNT 3GM0A 4QWWC 4OZ4B 5CJOL 4LEOB 2K1MA 2VLRD 4MCYA 3QHZL 2R2HB 2XZQH 3VH8A 2OR9L 1K3IA 3G08B 1HKFA 2J6EH 4FTVB 3G6JE 3W11C 3VFOB 4LL9A 4ETYA 4APQA 4RFEA 4FQLL 1LO3H 1W0WA 5D7SH 2NR6D 3VGDA 5GS2H 4YIQA 5IMMA 1F3JA 2G5BA 1UB6A 5IVXA 3MRKA 1Z5LA 1I7ZA 1RUML 5DFVC 3KR3H 4K3EL 5JIHA 3MBEC 2DDQL 2UWEB 3VGEA 3PDGA 3AREC 5D5MB 1MLCB 3QJFB 3CFDB 4M9OA 1FZMB 5BRZE 4FXGB 3KPNA 4NNPL 3QPXL 4JVUA 4KU1A 3K4ZA 4GXVH 2AGJH 3RVTC 5ANMA 4PJ5D 1H3TA 1ZHNA 1D5IL 3SDCC 2Z8SA 3SGKC 2ICCA 4F9LA 3SKJL 1NPUA 4BYHA 2YK1H 1TLKA 2HFGH 1MEXH 5HGDA 4KKLD 2JJSA 3TH2T 4J6RH 3S34L 5IHUH 5FM8A 3V6OC 2ARWA 2NXZB 1K6QH 3MGOB 3KYNB 5IOPB 1HINH 4LCIL 4U7SA 3MLVL 2F74B 1FL3A 1BGXH 1JHLL 1VESA 3RWJA 3LKNA 4X6FB 4L4JA 3OJDB 7FABL 4KAQL 4LFHG 2AXJA 2OX5A 4N90D 2HJKB 4MJ6A 5F9AC 3VI3F 4A6YA 4CRPA 4EUPB 1NSNL 1MCIA 1K8IA 1YY8B 4LCWA 3BPCB 3O4OB 4OF3A 1MVUB 2JJTC 4OCNC 3ZSSA 1ND0B 4TTDC 3V5KB 3L3OB 1AGBB 1BEYL 5SX5H 2ZJSL 2R56L 4JZJC 1K4DA 4ZODA 1CLZL 2XOTA 1Q9OA 1EJOL 5J1AA 1CQYA 5DI8A 4AEEA 3L5IA 3VJ6B 5IROA 4JFDA 2Z4QB 4QOKE 4W4OC 3VG9C 4DKEL 3NABH 1PSKL 4WNQB 4Q2ZA 5ITBH 3VI4F 5J1TC 2VSDA 2WQRA 2BSTA 2XN9D 3QJHB 3L3HA 4Y2DD 2J5LC 3GUTA 1LGVA 2J1KA 1CL7L 2WV3A 3ARSA 4PJFF 2ZG1A 4LDEB 1RZ8B 4S0TD 1C12B 3I3EA 1CD1A 3K2UH 4Z7NF 2NY3B 5TFSH 3VXQB 4F3FB 5JHDE 4KHTH 5ILTL 1N6QH 1T80A 4R2GC 3IFLL 1VHPA 4HMDA 1J1PH 5TF1L 4NJ9L 2Y07L 1QBLL 5IBUB 4G42A 5I15H 4YX2L 4OZGB 2VDPH 3QAZC 1ED3A 2A9NH 2GJ6B 4P23D 5EBLA 5IBTL 5MHSD 1J8HD 4HZLB 4GRWE 3BPOB 5IK3B 4ZFZB 3IGAB 2VQUA 3WCYA 4U1NA 1CICD 2Q6WA 4N0UA 3PF2A 2AXFA 2R0WH 4Q6YA 1EGJL 5B22A 5AG8A 4TNVK 5KSUA 3TH3T 2I25N 3PP4H 5TDPB 4Y19B 3FCTB 5KZCB 4RIRB 4OAWB 2MMXA 2X4UA 4JFHE 2YC1B 4P46A 1VPOL 2VYRE 4HWBA 4TUJA 2ZNXA 4K9EH 1L0XA 1VKXB 2JELH 3X17A 5ACMA 3P0YL 4OFDA 3U9UA 1QSED 1BVLA 3CLFH 1RZIB 4HIJA 1XGQB 3NVQA 3E2HB 2Z31C 4GO6B 3VE0B 2ZWLT 2BERA 2VKWA 4YK4B 4MNGE 3C5JB 1QNZH 1VGEL 4LDOB 5FFLA 4EXKA 2WIMA 1MFDH 3VXUA 3EGSB 4F80A 3VFMA 4QRRE 5FK9A 3TVMC 4ZXBA 4LLWA 3LKOA 1A7PH 5I19L 3QUMA 1IC5L 3HI6L 3LKQB 2IF7A 4NRZB 2DKUA 4NBYB 3BFOA 5DJ0A 4HH9A 4U1LB 5C6TH 4ODSL 5DUBB 5B3NA 3ARRA 4H1LB 2XFXA 4X4YB 1NAMA 4HCRL 1HN1A 5A1AA 5DURB 4KJYB 5F7EH 1XGTA 4H26B 5INDB 2E3VA 2GEEA 4GRMB 5F6HJ 2EH7L 4HQQL 3WUZA 2XZQL 2IPUK 3JTSB 1S7WA 3MBEB 3MACL 1KTDB 3BHBB 4FQ1L 1N0XL 3TO4A 1IGJB 1QLRA 2MHAA 4PLKC 3UDWC 3KS0H 4PJXF 1LO3L 5EU4A 5D7SL 1Q9LB 5JHLL 1P4BH 4YHOH 5EN2B 2ZSVA 3F7PC 4HXBH 3GMRA 1KXQE 3KR3L 5F89B 3OKEA 4MQ7B 5DZOA 3SDCB 4NFCA 4X99B 3LY6A 1XF4A 4F57H 5GZNC 1NFDF 2JCCE 5ID0B 2PUQT 3S8WA 5DHVA 1OP5K 5EC1A 1N0LA 4PJEF 1AD0B 1T1WA 3T65B 5HHQB 2AGJL 2YD7A 2V7NB 4Y16B 1NGZB 1SMOA 2W91A 2FDBP 1C7SA 1D5MB 2IGFH 3D25A 5DJXB 5T1MA 3Q2CA 5IMOB 5IR1A 5JPNA 2YK1L 3QR2A 3HZYB 4G8EA 3VD7A 3RVWC 1J88A 4LVOC 1MEXL 1E28B 3ZL4H 3ZYZA 4Z95L 3EUUA 4P2QE 2G75B 5F97E 5IROC 3BRDA 1A9BB 1J1XH 5AUMA 1F3RB 5KN5A 4HAGA 3VXNA 3BMVA 1BFVL 1LD9B 4NN5C 4PJCA 2FO1A 4DGYL 5BS0B 2F54B 3PWPA 3V4UH 4L3CA 3DV6B 3I6LE 2FGWH 3QPQD 1N6UA 4JZJB 3FO1A 2D2OA 3OR6B 3MR9A 3IDXH 5DTFB 3UTTE 4CVZB 2VR4A 3ALWA 4KQ4H 5MI0C 1OTSC 1FFRA 4PJDE 2IQ9L 1KEGL 3VG9B 4LVHC 1FNGA 4C56A 5JXEA 4FQHA 5JMRA 4PJ7F 1XR9B 1FYTA 2PXYD 5CP7B 4J3OC 2VLJE 2J5LB 1QYGL 2EDBA 5J6HA 1ZA6A 2DQFA 5FKAA 2WQ8A 1DL7H 4CMMA 3FRPA 3HE7A 5INCA 5ITBL 3WJLA 2JB5H 1BX2B 4PG2A 1R5VB 3P2TA 2HFFA 3QXVA 4R2GB 3QRGH 5CZKA 3GRWA 3LKPA 1P4LB 3X12A 3F7YB 4ZOAA 1R3JB 4PRNA 4ZTPH 3ET9F 2B1HL 3QAZB 3UTPE 3DGCR 3MRHA 4P46C 3PWNA 4WIQA 1MFBH 1P7KA 1DJSA 3K2UL 1FO0H 5TFSL 5B8CA 4P4KD 2A6KB 4G80A 3QO1A 3R8BB 1OW0A 1NGPH 1R5WA 1OSZB 2RHEA 1NEZA 1MIEH 2A77L 1NGYA 3C5ZC 1DN0A 4D0CB 2K3TA 1RJZA 5BMFL 4QKXB 2IANB 2W65B 4TUOB 2B0SH 3OKMB 1YC8A 3KWWB 4IRSD 3RVTD 3HAEG 4YFDB 2L0DA 4AL8L 5HDOA 3U9PH 2CLVB 2OMNA 1D5ZB 2G9HB 1B6UA 3AU1A 3MO1B 2DQIH 4MCYB 2QSTA 4D9QE 5H35A 4Y16D 4F7PA 5HYJD 3MJ9H 3B9KA 3VH8B 4LEXH 4H5SA 1IGFH 2Z31B 3SDXA 1MNUH 3DX8A 4K9EL 1I9RL 4APQB 4JREC 4M6NL 1W0WB 4OV5B 1L9NA 1RUAH 3WLWD 1Y0LA 4YIQB 5IMMB 1F3JB 1JZ3A 2G5BB 4YO0B 4P3DA 2Y9RT 1EVTC 3CLFL 3RY4A 4J12A 1I7ZB 1A6PA 1ORSA 4QNPF 5IJVA 4HK0A 1A6WH 2OP4H 4GG6E 3TO4C 3N1GC 4QXUH 2VDKH 1LO2L 1NBYB 5BS0D 1I1YB 5E8DH 5EA0H 3KPNB 1G9NH 3H7BA 1MFDL 3U0WH 3MLYL 1AFVH 4KGJA 1Q72H 5ANMB 2FNBA 1MQKL 3QG6A 5C0EA 1IQWH 4XGZA 3E3QC 3T3ME 4GJTB 4XBEH 4NUGL 1V7NL 4ELKA 1Y6KR 5DMIH 4ALAL 2AI0H 4RISH 3RIAF 4PRIE 8FABA 1LE9A 4UILH 4R0LA 4U1SB 3HC0B 4XP4H 2EXYD 1S7XA 4JM2F 2DIAA 5F7EL 2COQA 5E7BA 2AERT 2GHWB 4HWZA 4WW2A 1UEYA 1UJTA 5CJQL 4OZIF 1WBYA 3GIZH 5CUSL 2OXGA 4X6DA 2CMRL 3ZYOA 1CDHA 4PS4H 4LARH 1BBDH 2EEAA 5E9DA 1ES0B 3ZE1E 4EBQL 4LCWB 1E27B 1OD7A 4YHOL 1MHPH 1N3NA 1XGYL 4M1DL 1AIFB 3WD5L 3OXRA 3GSQB 2D4DA 3FB7B 1K4DB 4TNVF 4F57L 3CZJA 3WSQH 5KS9E 4R26H 3GMMA 1Q9OB 5J1AB 4LVOB 4DTGL 3HR5A 1M05A 1PG7W 2MQ0A 2EZ0C 3D2UB 3ZKMD 1EVUA 1AI1H 2VXTL 2YD4A 3I50H 4FRWA 4JFDB 1ZLWH 3U7YH 1P7HL 1D6EA 1KLUA 4MD5B 2CUHA 1UZ6F 4LASL 4Q2ZB 5JXEC 1I3RB 1CGYA 4NN5B 5DA4A 2BSTB 2I24N 2CO6B 4Z8FH 3GUTB 5I1JL 3ZL4L 1JJUA 3HZVB 3EHBD 1BD2A 4QRQA 3QEQE 4G8FA 2EIEA 5KVFL 1I8KA 1I1CA 3QQ9C 1KN2L 1RQ5A 1CD1B 3BAEH 4HJ0D 5MI0B 4JFZL 5E8EB 4PG2C 2FGWL 4LVHB 5ICZA 2K7PA 2KUTA 3M07A 4QO1A 4YNYA 3RWHB 3PABB 4G42B 3IDXL 4F7MA 3LQAC 1ED3B 3PHQB 3EO0A 1BMGA 4APQD 4JO2H 1OAQH 1PG7X 4KQ4L 1MRCH 4DZ8B 3UYOD 1UA6L 2GCYA 5J3HC 3B2UC 4GKOA 4XCFH 1JMZA 4B0MM 3S7GA 2Q6WB 3U30B 1HHJA 2IBGA 4NO5A 35C8L 4N0UB 3BZFA 4HFWA 4FQIL 3DHJA 1FFNB 1HYSC 4LHUG 1U3ZA 4IM8A 5KSUB 5F88A 1P4IL 2UUDK 2XWJA 2DI8A 3IDUA 1JWSA 1BFTA 1VGKA 1MCEA 1BQHA 1MCBA 3ZT6A 3GJFB 4P46B 2DQEL 3UYRH 4HIEB 1LK3H 4HKXA 2ADGA 4NNYB 4TUJB 4CKVX 2EDXA 3NZ8A 3RI5F 1RZJH 1SVCP 3BZEB 1B90A 1JK8B 3QRFM 5C0AE 1QLFB 3U9UB 2ERJC 2D03H 4F7CA 1KCKA 3ARWA 1BVLB 3BP4A 5DD0L 1JF1A 3B9EA 1U8KB 3PL6A 1MHEA 1MFBL 3GMQA 5GGRA 3RGVA 1FO0L 3LKSA 4YHZL 4ZDHB 3T77B 3ISWA 3WKNA 1H3GA 4UAOC 1NGPL 3VXUB 1UADC 5FK9B 4KHXL 5ERWA 1KCRH 3TPKA 5TE4L 1KACB 4QRSA 5DJ0B 5C08A 4RWYL 5HI5D 3O4LB 2IFFL 1L4IA 4LSRH 2JIXA 4NWTH 1U92B 2X4SA 3CGTA 4ZOBA 5ELIA 3U9PL 1NJ9A 5IMKA 2XFXB 1NAMB 5HHPA 2E7LA 1XGTB 1PQZA 1T0NA 1NCDL 4JREB 2DQIL 1Y18B 2ZUTA 1OGAD 3F7VA 1OF2B 1JNHA 3MJ9L 2UWEF 2X05A 4TSBL 1S7WB 2E7HA 3ZHLA 3MV01 2HLAB 1IGFL 4BKLA 4P9HC 1MNUL 3TO4B 2MHAB 1U8HA 1T5XA 4JPIA 3M8OH 1FDLH 1J5OL 4EOWH 5EU4B 2J8OA 1EGJA 2P5WA 1RUAL 3D48R 5CINH 5C0IA 1MI5D 5SV4A 2NY0C 25C8L 2ZSVB 2BXYA 1PW3A 5FM5O 3QFDA 4M1GH 2LAAA 1A6WL 2X4OB 1XF4B 2VDKL 1R5IA 5E8DL 1CGWA 4JFPA 4OLWL 4EDWH 1A6TA 1HILA 3SKMB 4ZPVB 5EC1B 2Z0BA 1T1WB 2GTZA 5EUKA 4RBPK 1M7DA 1BREA 2DLEA 3MLZH 3D85D 5BZWA 5GRYA 1IJ9A 1WWAX 1IQWL 4LPTA 3L3KA 2JK5A 4OF7A 3STLA 3D25B 5IR1B 5JPNB 3G6JA 4DOHB 2B7DT 2Y72A 3C2AL 1FNEA 3BH8B 3BT2L 3SN6N 1IQDA 1KJMA 5DMIL 1QRNB 1FZJA 4NIKB 4NO0B 1Z0NA 4S1RL 4G8EB 4YXLH 4UINL 5BOPA 4UILL 4XP4L 5KVDH 4CU7A 1DEDA 3VRLE 4S2SA 5AUMB 5KN5B 3VXNB 3E6HA 4OLZH 3UJIH 3ABZA 4UTBH 4LAJH 4PJCB 4NZTL 4PLJC 4OF0A 1NC2B 4L3CB 4KKNA 4RRPA 5BRZA 4AJ0A 4YHIA 3MR9B 1GGUA 4PS4L 3VFVB 2JE8A 4HCRA 4LARL 3EDJA 4RMRA 4G6AC 4YH6A 5I75C 3D0VA 4M5ZL 1MHPL 3HUJB 3HG1E 4QXTB 1KSRA 2VLME 3WE6B 5E7FA 1IKNC 4C56B 1CGTA 3BVNB 3DSNA 4FQHB 5I1LB 1FYTB 2J6EA 4R26L 4U7MA 4Z18A 3NCEB 4PGCB 5HI3C 1CTNA 2EO9A 3CFBA 4MA8L 3VXUD 2XTJC 3JBG7 4W81A 4ZUVA 3OKOA 5JQ6H 4ZXBD 3M17A 3V8CA 4BM7A 5CMAA 2DQJL 4YE4H 2DQFB 5FKAB 2H2PC 4M7ZC 1BLNA 3EYFB 5HD8C 2HFFB 1VFUA 3LKPB 4OZGF 1T3FA 4JFFB 4M7LL 4OLUL 3X12B 3O9WC 4K07A 3CXDL 5GZOC 5FECA 4PRNB 1EZVY 3AXLB 2DL2A 3PWNB 4LGRB 5IW6B 5GS0C 2YA0A 3D5OF 4PPTA 1B0RB 1P7KB 3BAEL 1F3DJ 4PLOB 4PJGA 3HPJA 3SGEI 4G80B 3DO3A 4BUGA 15C8L 4WJ5A 1KF9B 5D8JL 1AXTH 1DBAL 1NEZB 2BP3A 2FLBT 1NGYB 2B1AL 1E4KC 5F72S 2F53A 1DN0B 4QOKA 4JO2L 4C58B 1RJZB 1YEDB 1CIUA 4JZOB 4TVPE 1RV6X 3BRFA 3KPSB 4P5MA 1HXMA 4ZO6A 4DW2H 4ZSOE 2W1NA 5LG1A 3FN0L 2APFA 1GOFA 3MA7A 1ZLSH 1O5DT 5EUOF 4MA7H 1BVKB 4PY8I 5EOCH 2I60L 4N0FA 2ZUXA 1N7ML 1UWXH 1S7VB 3G5XB 3OKKA 1UYWH 5CD5D 4OT1H 4C4KO 4GMSH 2P4AB 4F7PB 3QIUD 4XBGA 1QR1A 5D72H 4TQEH 1I1AA 2YD3A 4H5SB 3UYRL 4CUCA 4X6EA 3MRGB 3DTXA 4UAOB 2BK8A 3QXWA 1AGDA 4U05A 4X98A 4ZAKD 4NCDA 4V1DE 5E4EB 5KTEH 3VXPA 4J8RB 1ORSB 2Y1VA 3ILPB 3O3BA 1OARH 5TDNB 4PGZA 2ADFL 4PGDA 4KK8C 2FSEA 1YECH 1YEEL 2R9HD 3PWPD 1VENA 1IRAY 5HYQB 4N1HB 1JP5A 3H7BB 2Z93A 5SWQB 1YA5A 4NKDB 4PRPB 4GKNB 5IQ9A 2JJVA 1KCRL 3LS4H 1IEBB 3QG6B 3SHSA 1G7JA 4XGZB 5E99H 2BHYA 3TT3H 1T89A 3FO2A 3NAAL 4ELKB 2OTWB 4JKMA 1MCKA 2A6JA 4XB7A 1D9KC 1CDIA 2W60A 1A6AA 2UY6A 3KPRE 3RTQA 3GJFK 4P2CG 1LE9B 1DQTA 1FYTD 3GSUA 3T4AA 4LLYB 4X8JB 2BX5A 4I2XA 2FX7L 5JW4N 4HLJA 4HWZB 4WW2B 1KUMA 2R1XA 5I1KL 2P8LA 3L3JA 4X6DB 3HE7D 2IADA 2XQYK 5I74C 5I30L 1RFDL 4QRRA 1J05A 3NCJL 1HSBA 3LH2H 1ADQH 2QQNL 3WXVH 2E9BA 1T6WA 1RULL 1S8DB 5HVGB 1U8JA 5E08H 5CINL 2BNUB 3SCMC 3L3DA 3BW9B 4XP5H 3MRPB 1CXIA 2Q8BH 1N3NB 3IS0X 2UV3A 3W0WE 1LMKA 1MLBB 3GMNA 3T0BA 4M1GL 4X9FA 5EBMA 2MNUA 3GMMB 2AV7A 3KYKL 3B2UD 2H26A 2YUZA 5E0QA 1U9KA 2ICEB 5B4MD 5D7KD 3HR5B 4EIZC 1M05B 1PYWB 4UNVA 2O61B 1JE6A 3MLZL 1ONQB 4BFBD 3PUCA 1D6EB 2E9IA 5DA0B 4W6XB 4JE4B 5EU7E 5IFAL 2Q76A 1IAKA 1EX0A 4KJPD 1JNLH 4UB0L 4IDJL 1M6OA 3QDAA 5JQHC 2VKXA 2ZUWA 4R4BA 2Z8WC 4I3GA 4E0RB 2DRUA 5AZ2H 2KQNA 1BD2B 4QRQB 4ZO9A 1GYAA 4G8FB 2A1WH 1LO5A 2FRGP 2GI7A 5SWZA 3UJIL 1OHQA 5DMGD 4UTBL 5I75B 3DX6A 4PY7A 4XTRD 2JCCA 3MQIA 2ZG2A 4IRZL 3B9KD 3T1WA 5EFIB 4UNUA 4MDIA 4YNYB 4F7MB 2X70B 4XH2A 3AMKA 3NIDE 3EO0B 5E8NA 3WUWB 5GGUA 1V3JA 2IG2H 4P2OD 2HFEA 3PGFH 3D1MC 5HTSA 2GCYB 5LGKA 4BFGA 3DETD 2VZVA 3QYCA 1IZKA 3V5HA 3U1SL 4YHKH 2BRRH 3C6LC 1HHJB 3V5DB 4M7ZB 4NO5B 3RVXC 2EDYA 4GUPA 3BZFB 4HFWB 1GGBH 4NNXB 4NO3A 1OB1A 2OBGA 4IRJD 2WWMC 5BXFA 3BN9C 3LS5L 5F88B 2WBJA 2MSPA 5JQ6L 3O9WB 1JWSB 1JGLL 2X4QA 4KKCC 4YE4L 5L8LB 2GFBA 2WSKA 3S5LA 1ULVA 2FBJH 1OOAA 5ICXA 4HKXB 2DQCH 3FJTA 1RUKH 5JUEL 3L5JA 4Z7UB 4KZDL 3NZ8B 3IFPA 1JPSH 3UTTA 2X41A 2YUVA 4O5LH 1GZPA 4NZJA 5HVHC 3IXAB 4L8CA 4F7CB 1X5JA 4F7EA 5DDHB 1YQ2A 4PJDA 3RNQB 1JF1B 1A1MA 5E24E 3PL6B 4D8PA 1KCLA 5GGRB 4TULH 3RGVB 4ZMAT 5F7YC 5JIKA 3LKSB 4N8VG 1OQXA 2YD1A 4MMXC 3I75A 4G6KL 1AXTL 1NBVH 3KGRA 1T2JA 4MNHA 5ERWB 4RA0C 5E9DD 2H32H 3MRBA 2D0FA 4LSSH 4XMLH 2IH1A 4XNYH 3BQUC 2JIXB 5H37H 4IOFD 4UV7H 3D3VD 4Q7DA 5DJ2B 5FO8A 5GRVL 2AJ3A 2BNQB 3HKFA 1NJ9B 3BDBA 2YPLE 5HYSG 3HAEH 4MA7L 1ZLVH 2WUCL 5EOCL 1FGVL 5D1XD 1PQZB 5DGRA 1LEKA 5J57B 1T0NB 5JW4M 2FEDC 3LN5A 1AR1C 1TXKA 5IVXF 1Y6NR 3B4NA 2LFGA 3F7VB 32C2B 4PV8A 4GMSL 2HKFH 1JNHB 1DQJA 3W39A 1AGEA 3NPSC 4LGSB 5D72L 4TQEL 4ZQKA 4G9FE 3T0EC 5FGCE 4OCSH 5IUSA 1U8HB 4JPIB 1BJMA 4X7EC 4HUXB 4XPBL 2EECA 2P5WB 5C0IB 1G1YA 1CFSB 2VIRA 1U58B 3RVVD 1BD2D 2YOCA 3BKJL 4G8GB 4JY6B 2VL5A 3QFDB 2JB6A 4OGXH 4MQXC 1YECL 1W0YT 4JDZA 4LRIA 3ZE2F 3MODH 1R5IB 4EI6A 4JFPB 2AQ1A 1XGRB 1BFSA 4LPYA 2XZZA 3JWNC 2GTZB 3TYGH 5HVFB 1MJUL 1M7DB 1I9JH 3BIKA 4JZNA 1CFNA 5BZWB 4NGHH 4ONHA 4P4RA 1RIHH 2DQGL 3L3KB 2JK5B 4Y5XA 3STLB 3TT3L 3RKDC 1RIUH 1FO0A 1KJMB 5CKAA 5IHBA 2YWZA 3UYPA 4DKFL 4PJXE 4NKOA 2GJZB 2YEZA 5F1KC 3VMNA 1C5BH 3E6HB 4U6YA 2HH0H 4NT6B 2X2YA 3L1OH 1YNKH 2QHRL 2X4TA 3RL1A 3SCMB 4P5TC 3CVHH 3ARGA 3HTLX 4XCYA 1S78C 4LCYB 5JIIA 5ALBH 4WI8A 4ERSH 2DOCA 1FFPA 2VDLL 3ZHKA 4ENED 3HPLA 5DRZA 1TZGH 2VZUA 4XNQA 4K3JH 2HVJB 3D0VB 4UUJB 3QQNA 1ZAGA 4PGBB 2EKSA 2Q8BL 3ETBF 1KCUH 3MJ9A 2AABH 3PL6D 1MCNA 2AXHA 3RGVD 2VQ1A 2RIKA 5D1QA 4PJ9A 3CFBB 3DSFL 1KOAA 5BO1H 5E6YA 1KJVA 5IW1A 1FFQA 4KRLB 3M17B 1IVLA 5JO5B 5CMAB 3QO0B 5JOFA 5F3BA 4YEFA 5C08D 1T21A 3IJSA 4E9LA 5FYJU 1CFBA 1YN6A 1E4JA 2WMPA 1X5LA 4MXQD 1T3FB 4XNXH 1IE5A 4MJ2A 5FECB 4LNRA 1EA9C 1H8OA 2CKBH 3VCLA 1IGCL 2GUOA 2M8XA 4FQ2H 4X7TA 4PJGB 5KS9A 3D9AH 3PHOA 3HPJB 5MENE 4YFLI 5FGBA 3FKUS 4O02L 5D6DA 1OLLA 4YHYC 3C6LB 4MDJA 3ZKNC 4BH8B 4XAKE 2F53B 2D9QB 5FCSH 3UXFA 5DK2A 4OGAD 1IGIH 2P5WD 5TQ2H 3TFKD 5C07B 3PGFL 3AC0A 4FFVD 3D39A 1NGQL 5DHYA 2BSRA 4Y4FC 4HGKC 2AJZB 4YHKL 2BRRL 2YBRA 3CU7A 3MA7B 3Q1SL 1DVFA 7CGTA 4N0FB 3SE3C 4P2RE 4NHCH 2E8YA 5IBLC 2I07A 5HVHB 2BC4B 4IS6A 3VDBA 3OX8A 5FYJH 3U46A 3QEUA 2CO7B 3BD3A 5CJ5A 3OKLA 1X6NA 4XBGB 5I76A 2FBJL 4NKIL 3I3DA 1EXUA 4MNQE 4PRHA 2EEBA 1DQMH 3QA3A 4PLNC 4WI4A 3BZDA 3UTQB 1I85C 4DVBA 1G7LA 4O5LL 3SGEH 3DTXB 1MFCH 5F7MC 4U0RC 3NMEA 4TRPH 4X98B 3GBLA 3VXPB 5IHZB 1KENH 5D1ZC 2OI9B 2DM7A 5FUZH 3B8YA 3W82A 3O3BB 3L3GB 4JFOB 5HPMB 4TULL 4AENA 2FSEB 3VWJC 1HWGB 1ZOXA 3D6GA 3BQUB 4XXDA 4S11A 5BRZD 1X4XA 2Z93B 1NBVL 3NIGF 3RZCA 1P1ZA 5TPWH 1CLYL 1G7JB 3RQ3A 3FO2B 4XMLL 2A6JB 4GG8B 4ZS6C 3B9DA 3WN5C 3NPSB 3IU3B 3T0EB 2W60B 5C0AA 1SYSA 1FE8H 2XWBA 1BZ7A 4C59B 1F90H 3GSUB 3T4AB 1U91B 3S96A 4I2XB 5D7LE 3VFSB 2R1XB 5GS2D 1OAUH 4UBDD 4LQFL 1A6UH 4J1UA 2FGZA 4PB9H 2IADB 4OCSL 4EI5A 3VA2C 4XHJC 1CT8A 1J18A 4LLMA 4Y1AE 3HMXH 4LVEA 1P9MC 3C8DA 5J6GA 4PP1D 2AAVA 1DE4A 1U8JB 4ODWA 3CC5A 3EYOB 3L3DB 2CJUL 1A21A 5JW4R 2XY2A 3GMNB 3TBWB 1G7IA 1G9MH 3MCLL 3MODL 4AQ1B 2DLGA 2H26B 4NC2B 3QXTA 3RHWF 3T8XA 4DUXA 3TYGL 3NCBB 1EAPA 1I9JL 5DMYA 3TBYA 1TVDA 4FG6D 2VABA 4NGHL 1XGPA 4QOKD 2IPTH 1ACZA 4PJCF 2P48B 1RIHL 2VDRL 3G5YA 4CU6A 1ZMYA 3TT1H 2GITB 4NZRL 3QWRD 4PRDA 5DRWA 3L3IA 2W59A 4M8QB 1M6OB 1JPST 1H3XA 4P5TB 5D1QC 5EO1A 4PJ9C 1LEGA 1ZHLB 2ADIA 4HS6B 4R4BB 2XPGA 1NQBA 1R3LA 3PV7A 2X4PA 3GBNH 4NSKA 1XGUB 1C5BL 2HH0L 4PTUA 5SWZB 1U0QA 3L1OL 1U8LA 3DX6B 5DD6B 3KXFB 3MNWB 5JHDD 4YWGH 1LK2B 1FLTX 3BYYA 4OLYH 1I1AD 1G9NC 2QR0A 5ALBL 4XH2B 4TOYH 4MAYA 3IDMA 5EPMB 5E8NB 4BSVA 1TVHA 4PJHE 3WFBL 4HUMB 2BZDA 2HFEB 4E41B 1NCWH 1I8IA 1KCUL 1K4CB 3V5HB 2AABL 2AS5M 4FFWD 4H0IA 2H6PA 3O6KH 4E42A 4RAUA 1DFBH 2EDFA 4OTXL 4F37K 1AGCA 1KG0A 1OB1B 2A83B 4OCMC 5BXFB 4AEIH 2ARJA 2WBJB 1UACH 3GGWA 1MJ8H 2EYSA 4JFHD 3FZUD 2GFBB 4EZMA 5DO2C 4JRYA 3S5LB 1MFEH 1AR1D 1IZJA 4Q97A 1OSPH 1IILE 5BZDA 1YJDL 1YEFH 1ZSDA 2D3VA 1DVFC 5I8EB 2CRIA 3BE1H 3IFPB 3UTTB 4Q0XH 1J0YA 2VDML 1GZPB 1CXFA 2YS4A 3CSBA 5JR1H 4YHYB 3RTQD 4OZHE 4L8CB 3HG1A 5DJZA 4F7EB 2DYPA 1FL5A 2RFXB 2CKBL 5D2NC 1FSKC 5J9PA 2F8VA 4D8PB 4FQ2L 4HIHA 2IQAB 2QQQA 2FIRT 3I75B 4TTGA 3QXDA 4O2CB 3WFZA 1TZHB 1S5IL 4MQXD 4QRRD 5HBBA 4MNHB 5B3JF 4JPKH 3FQXA 3SOBH 4HULB 4ORGB 3WIIH 4HPOH 4XPAH 1NDMA 5AAWA 4K2UH 5FA4B 2EC9U 5TQ2L 3O41A 3WIFA 2J4WH 1QKZH 5TE6L 1C16B 3BH9B 4N0CC 3SDXF 5LKNA 3EO1B 5K9OA 4N9GA 5FO8B 2V2TA 1FP5A 4NN6C 3VFGH 2ENSA 4TVSa 5BCAA 1T6VN 1IM3A 2Z92B 3LN5B 4NHCL 2XZCH 4U0RB 5GJSH 5ACLA 4PV8B 5FYJL 1DQJB 4JRXA 1I7UA 5TDOA 5D1ZB 4HX1A 3B5GA 2WIIA 5CWSB 3L7EA 3H42L 3MXWL 1DQML 3PQYE 2EE3A 4JHZA 3SO5A 5IV2A 1KPUA 3VGAC 4IIQA 1CVSC 5D4QA 2WLYA 5DXWA 3O8XC 2A73A 3NTCL 1GCFA 2VIRB 3BDXA 4UT7L 2GK0A 1GJIA 4HUKB 4QHKI 4ELMB 1KENL 5B39G 5FUZL 2DWDA 4XWOD 9CGTA 2VL5B 5GIRB 5DLMH 4F7TB 2B2XH 5SWZD 4FTVE 1X4YA 5FCUH 4EI5C 4JDZB 2HRPH 3NA9L 3KNBA 2ATKB 4LIQH 4L4VB 2KH2B 4ODUB 4GLRI 4GBXA 3VFNB 4W6WB 5EOQH 3OGOE 4D9LH 1CWVA 4KK5D 3KLSA 1FGNH 4K3DH 4WW2F 1ZLUH 4JZNB 1CFNB 4ONHB 1NMBL 1TJHH 3P9MA 4ZFOL 4YAQA 1CBVH 4X6DF 5D5ME 1N8ZB 3HMWH 2ESVE 1WT5C 1FO0B 3VXRA 3P0VH 2D0GA 4YQXL 1A2YA 1RZJC 2FJFA 5T3ZH 2VH5H 1WITA 5ITFA 4XVTL 4K94H 5KSAA 4KZEH 3GSXA 1J12A 4UDUA 4OCXL 2V7HA 4RGMC 5SX5K 4P2QD 1A3LL 1B88A 3E8UL 4Z7VB 3LSOA 3MRLA 4U6HA 4U6YB 3UJJL 5CZVH 2WBJD 3ZTJG 3DXAA 2X4TB 3RL1B 4MXWL 1OAUL 1AH1A 3ARGB 5DD3L 4XCYB 1A6UL 2GK2A 3I6LD 5K9JH 3O11A 3SBWC 1F4WH 4PRBB 1MAJA 1FFPB 3QQ4A 3UTTD 1UH3A 4XCNB 4OD3H 5DRZB 1JI2A 4HC1L 3TNNB 3FO9A 1QOKA 4NP4H 1FCGA 3WL9A 2EKSB 4WHDA 5FUCC 3CDFA 5ETUA 4UQ2B 1YNLL 3KPRA 2VQ1B 3NCFB 1G9ML 3RWDB 2VZSA 1CLCA 5D1QB 5IB2A 4PJ9B 2VLJD 2MKWA 4M6MH 5T3ZE 5TH2A 5IW1B 1T0MA 3AM8A 4QGYA 4L9LA 3LHPL 5JOFB 5F3BB 4N5ED 3TT1L 1GAFL 1T21B 3IJSB 1MJ7H 1LWRA 1YY9D 4KXZH 3QG7L 1PFCA 3G9VA 3W9DA 4GRLD 3LD8C 1D6VH 1JBJA 3UTPD 1JPTL 1YEJH 3N85H 4MAUL 4G7VH 3W0WA 3VCLB 3HC3L 5CCKL 2NW3A 1L6ZA 2I9LA 2WW8A 2CUIA 4AMKH 2SEBA 3CFJA 4WI5A 3MMEA 3MLPA 2V5TA 4K8RH 4JDVA 4MDJB 5GSRA 4FP8H 4TOYL 3QNYA 1U3YA 3VFUA 4U6TA 3D39B 3EFDH 5GGSY 4MQTB 4P9MH 1KJ2L 2E8ZA 2LU4A 4YDJA 4PB0L 5I1HL 2YBRB 3CH8A 1JGEA 4Z76A 1DVFB 1XF3B 2NY1D 5ICYB 1VEOA 2GJ6E 4I18C 4O2FA 1NAKH 5BOZG 4NQTA 5EBGA 4D9QD 4IS6B 5BVPH 3OKLB 2QQLH 1FSKB 5D2NB 3ULUH 4XVUD 1AR2A 5E6IA 1EXUB 4N0YH 4PRHB 1YEFL 1YMME 4KTEH 1QFOA 3LEXB 1BOGA 3QA3B 3GIVA 4DVBB 1UXSA 1G6RH 2X7LB 4PGJA 4FQXD 4PJ8A 3QI9C 4Y19E 5EOTB 3F7RA 4OGZA 1EO7A 4CVWA 1INDH 1J87A 3BUYA 5IJKA 3GI9H 2AEQL 5FF6A 3QDGA 4NC1E 4WFHD 4AT6A 3ARGD 2WBWB 3AGVA 4UQ3A 4JN1L 3RJQB 3TIDA 4EN3C 3K0WA 2GAZA 1M1SA 4NN6B 2GYSA 5EC2A 4JPKL 2AK4E 3SOBL 5DMKA 3WIIL 2ZUSA 3FFCA 3M1BB 2VUOA 3TESA 3K4DA 2AV1A 1G0YR 3SE4C 4B53A 1T4KA 2R1WB 3VD9A 4GBXC 4RGOL 2FL5A 4OLEA 1QD0A 4PRID 3KPTA 4LKXA 5IB4B 2XWBB 1BZ7B 1CFVH 3R0MA 3VFGL 1BPVA 2HT3C 3VGAB 3R8QA 3O8XB 2XZCL 5KSBF 4Z7QF 5GJSL 3KYAA 1MHHA 1TITA 2ZCLL 4HPYH 4HJGA 1I75A 2OQJA 4BK4A 4EI5B 4HS3B 4LLMB 2Y06H 3MLWH 1IAOB 4PR5A 5ESVA 1CGSH 2DQHL 5EO9A 3FMGL 4JFEB 2HTKC 3G6JF 1PZ5A 5DUML 1UCBL 2B2XL 3O2DH 4GH7B 5FCUL 2HRPL 2GT9A 4HD9A 2VDNH 1Z3GH 2X89A 2YD5A 4XP1L 1DLHA 2NLJA 4DFIA 5EOQL 3T8XB 4D9LL 4U31A 2PO6A 2F9BT 1EAPB 4G3YH 1FGNL 4K3DL 3GMPA 4P3WA 3TBYB 2VABB 3FQNA 3G5YB 3WUWG 1KBGL 1XH3A 1F8TH 1S3KL 1CBVL 5DRWB 1DCLA 3L3IB 4QRTB 1TNNA 3K2MC 3UP1A 5EO1B 3VRJA 1INEH 2X9YA 1S7RA 2ADIB 5T3ZL 2VH5L 4O2EA 5M7QA 4KZEL 3V7AG 2WAHA 2CSPA 3S35H 1K85A 1DVFD 3QEQD 4NSKB 2X4PB 4X5WA 4L9LC 3TCXA 4UIKH 3T4YA 2Q3ZA 2FYYB 2NMSA 3OPZH 4LP4A 4PTUB 5CZVL 1KFAL 2W9EH 3VFTA 4LSTH 4DFHA 5IGXH 5JDJA 2R0ZH 5HY9A 3NZHH 1QFWI 5K9JL 2D7TH 2QR0B 4PRHD 1F13A 1YZZA 4WWKA 3HAEA 1CS6A 4WHTB 5DQJA 4HG4K 5GISL 3IDMB 3P9LB 2J8HA 3WS6C 4OD3L 4I0PA 5I8CA 4NP4L 5BS0E 2F54E 4LLQA 1FC2D 1B3JA 4A2MA 2H6PB 4RAUB 4OFKA 2DD8H 3IDGA 1AGCB 5BQ7A 5F9DC 1NUGA 3JUZA 3GI8H 4M6ML 5ID1B 4HGWB 3GGWB 3RZCD 2EYSB 3BD5A 3QEHA 1NUDA 4JRYB 2PYFA 4G6FB 1S9WA 1HHGB 5BZDB 4G8IA 2KQMA 2YA2A 2PW1A 2DQUH 4NBXB 4EVNA 3IVKA 2FHFA 3EDDA 3UPCA 3HZKA 5C0AD 1EFXB 4R96A 4KKAD 1FL5B 3TGXA 2VZ3A 4F58H 5J9PB 2J8UB 4BQ8A 1P5UA 4OZFG 4KJQC 4EXPX 5E6IC 3S36H 4HIHB 4WUUB 1RHHA 4AMKL 4U3HA 3LAFA 4JJ5A 3KDMB 1A64A 4WFFE 3I9GL 2E9WA 3FQXB 3JWOH 3BXNA 2Q7NA 3B3IA 4I18B 1MAML 1NDMB 4DN4H 3O41B 1FJ1B 4ZO8A 3P77A 3EFDL 4KJWC 4LLVA 2VC2H 4NWUL 1UVQA 4OF8A 3JV0A 2APWA 3CVIH 3PDOA 3OL2A 3RZWA 4N9GB 2V2TB 2XXMB 2HJLA 1FIGL 3ZKSD 4GRWF 1IM3B 1YMHA 2IC2A 5D93C 2IANE 4TUKL 3MROA 3RWCB 1FFOA 3QI9B 3K4AA 3PXHA 4TNWF 4YHPA 5BVPL 4JRXB 5TDOB 2FX9H 2QQLL 3ULUL 4HX1B 2WIIB 4DGVH 1BJ1H 3L7EB 5TGBA 4XAWH 3CK0H 4KTEL 1CE1H 1A9EA 2A9ML 4X4XA 1HSAB 1C5CH 5IV2B 1KPUB 3FT2B 3BIAX 5C0JB 4IIQB 2EXWD 2LE9A 2NQCA 4OJFH 4EN3B 2R8SH 1A4KA 1T22A 2A73B 3WHXA 2ZOLA 4Y8DC 1CLOL 2GK0B 2IH3A 4JHAH 3PV6B 3C60C 1MREL 2DWDB 3OWEA 1TJGH 4QY8A 1EEYB 4RQQA 4MJIA 3OKNA 1OQOA 2AK1H 3LQZA 3PGDA 4EEEA 3V8OA 5DF0A 2ILLA 2VTFA 4GBXB 1CDGA 5IEHA 1QPPA 4P2RA 3DBXA 2OTUB 1KNOA 4ODHL 1AQKH 1AXSB 5DD1H 3KS0J 4MAYD 3UZVB 1HYRC 1K8DA 3WFDL 4OLXL 2CKBA 3H6JA 1IM9A 4YAQB 4MNQA 5CEYA 4JJHA 2BVOA 3VXRB 1BQLH 4OCYH 3AUVA 1A2YB 5L2KB 5KSAB 2N1KA 3GSXB 4UDUB 1CFVL 3TM6A 5ANME 3OXSA 5DJ6A 4KDVA 2XIDA 1FG2A 4I3RH 5DMJB 4QHNA 2C4FT 4YXKH 3DXAB 4R7DB 4HPYL 2NY5H 4WENB 1C1EL 4KI5C 3OR7A 3CUPA 3O11B 2N7AA 5CFHA 3ZDYE 4WDIB 1OTTD 4IHOA 3QQ4B 3KPQA 4MD4B 1D5XA 1CGSL 1AGFA 2OZ4H 1F6LL 3FO9B 2VJXA 5C2BH 3HG1D 2VLMD 2DYPD 1LEIA 1KB9K 5ETUB 4LHUA 1VFBB 3RPKA 3O6FA 3KPRB 1ORQA 4WWKC 5DC0A 3QDMA 4PRAA 1DQDH 1Z3GL 3GJEA 5IB2B 2J88H 5LGHH 2CUMA 4D3CH 1EK3A 4GKZA 4LCWE 5D7LA 5TH2B 3MV8B 4LF3B 4AEHH 1A1OA 4L9LB 4JO1H 1TMCB 5C3TA 2I27N 2JCCF 1F8TL 4PUBH 4Y1AA 1AQDA 4X80H 1NC4D 4QRPA 5CILL 2EDHA 3W9DB 2ICWB 5SX4I 5FEBA 5EG6C 2CXKA 4KK6C 2YN5A 1YN7B 3S35L 4JFDE 2H8PA 3DVNA 4CDHA 4JLRA 2NW3B 4LFHD 2QTEA 1O0VA 2DTMH 3IYLW 4ZFOA 4XPFH 5IGXL 2QSCH 3CFJB 3QZWG 1IAIM 4PJBA 2FEEI 2HFTA 3MMEB 5DGQA 4HG4J 4JDVB 5GSRB 1C5DB 3QNYB 1I3VA 4P3CH 5AEAA 4OSUH 4OI7A 4FFZH 3VFUB 5L6YH 4Y4KC 3QCVH 3SQOH 1UWEH 5C6PB 1YYLH 3N1MC 1RK0A 3HB3D 3SDDC 1CDYA 3NIFE 1U3HC 5C0FA 2FATH 1FVEB 5C0GA 4NQEE 3WO3B 3X11A 1JGEB 4Z76B 4QGTA 4GBXD 2CRMA 1FN4B 2H9GA 2YN3A 3ARVA 4PJDF 4WI3A 1QVOA 3MA9H 4HC1A 4RMVA 4XT1C 5F21B 2EDOA 5LAXA 3RL2A 3FN9A 4L3AA 1GZQA 1MJJA 2AJXL 4UZGA 3GBML 2ZOKB 2BSSA 5E6IB 4M48H 5LWYH 4YXHL 3IETA 1AY1H 4MA1C 3VXRD 1BOGB 4N0UE 3GIVB 2VNCA 4XP6H 2DI7A 4C4KT 1UXSB 2VXSH 5KSAD 3FL7A 2DQDH 2BDNL 1F00I 3ARPA 4V1DD 4YPGA 3BSZH 1OD9A 4MVBC 4PTTA 4HUUA 4CJ0A 4F58L 4WGWB 2RB8A 5FF6B 3TPUA 4PGEA 4KVCH 3QDGB 3H0TA 4AT6B 1NCBH 4XVSH 3T0AA 3ZDXE 5HHMB 5KANG 3I2CL 4PBXA 1WIUA 3RUGA 3TIDB 5FHAH 2C1PA 1L7IL 4F33A 3ARDD 3O2WH 2MQ3A 4L9DA 4OD1H 4CVXA 1A7RH 3LRSA 3FFCB 2MCG1 4MS8C 2FJHB 2N56A 2VXQL 2EICA 1ZEAL 2EC8A 4URTB 3CFIC 4HK3N 1RIVL 2A38A 1F58L 3L5XL 4JKKA 5EWIH 3KPRD 1OTUD 4OZHA 4LKXB 1RK1A 3G5VA 1JMXA 5FHBH 1QO3B 4CADA 1B4RA 1S7SB 2OCFD 3BO8A 2AJUH 3SDAA 4Z78A 2LQRA 1MHHB 3O4LE 3MLRH 3WEXA 4HJGB 1JNNH 2FX9L 3MJ7A 1U42A 3OJ2C 1KJ2A 1Q0YL 4JKPH 4B5EA 2VL4A 4DGVL 2BVQA 1DBJH 4KKBC 4HKZA 2JLLA 2NYYD 1NH6A 1C5CL 3KAAA 4PR5B 3EOBA 4OJFL 5CJXA 2R8SL 4BQ9A 1A7BA 1V05A 3W0WD 4WI6A 1PZ5B 2DKMA 1TJGL 3WFCL 1IC4L 5KW9L 4WUKH 2GT9B 1NL0L 1UGNA 1YEHL 5HDBE 2DJ4A 1DLHB 3GSVB 3W5MA 4DAGL 1ZWIA 1TJIL 1AQKL 4LVNC 2HJFA 3WNPA 4GG6F 4WEMB 3FQNB 3RBGA 3ECBA 1XH3B 3E3QE 1P84K 1T04A 1ITBB 4UDTB 3PQYA 1N64L 4OIBA 3VRJB 1IC1A 3NFSL 4KMTH 3FQTA 3R1GH 3F6LA 2HT2C 1D5BA 3MLXH 4GW4A 2RCSH 2DF3A 4OZ4A 4WWID 5FO9A 4F8QA 1PBYA 4FZEL 4H0HB 3IFOB 4X5WB 3T3MF 4H88H 2R2HA 2Z9TA 4KDTA 3T4YB 3WKMH 1NUNB 3G08A 2H32B 4I3RL 1BF8A 3V0WH 3VFTB 4DOHE 3H3BC 1QRNE 3EO9H 3ZTJH 5J06A 1RJLB 2JTDA 2BSED 3MLUH 2IAMA 4WWKB 3KLHD 3HAEB 1DBBH 4LSPH 5L2JB 2DWEA 2HWZL 2OZ4L 3OSKA 4RDQG 4I0PB 4PJ8D 1MLCA 3QJFA 1KYOK 2ESVA 4KUZH 4LLUB 3TYFA 1FZMA 3QEGH 2QADD 1FIEA 4LLQB 1A47A 4XCCL 1M4KA 3EYVB 5JZ7D 3ZE1F 2NY4C 4KJWD 5BQ7B 5E2VH 1E0OB 3H8NA 4B50A 4D3CL 2HAZA 1B9ZA 3HUJE 4WU7B 4M6OL 2R4RH 3QEHB 4GSDH 5K59E 5KS9F 3H3PL 5I1IH 2PYFB 3FFCD 4C56E 5KJRH 1FL6A 4G8IB 4CN4A 1A6VH 4U1GC 2PW1B 4X80L 3IVKB 4UI2A 3RDTC 1EPFA 2BHZA 3KYNA 5IOPA 3INUH 1TCRA 1RURH 5DVOA 4YDKH 4MLSA 4M62L 3E6FA 1ZGLB 5GRVK 1KPRA 5L8KB 4GQ9H 1I7RB 3UC0H 3BGAA 3C08H 5ADOH 1EO8L 4X6FA 4Y4KB 3OJDA 3KYOA 4K7PY 5GPRA 1RHHB 4XPFL 3MRNA 2QHLA 3K81A 1L7TL 1G9MC 2HJKA 1UWXK 4Z5RB 3SDDB 5C0BB 4GMTH 2R1YA 2VWEC 1UM5H 3UAJD 4MX7B 1YY8A 4JFFE 4LSUL 3BPCA 3HE6C 2DLIA 1ND0A 3V5KA 3BXNB 3UTOA 2A74B 4OSUL 4EDXA 4FFZL 3T09A 1X5IA 1RD6A 5L6YL 3H9ZA 3QCVL 1CXHA 1UWEL 1YYLL 4LLVB 3OJVC 3KJ6H 1DLFH 1JHKH 3MV7A 3PDOB 2FATL 3CVHB 1YEKH 5KANI 5EZLB 4UIMB 2YPLD 2ID5A 1CR9H 3DVIA 1CQKA 4MA1B 3VJ6A 4BZ2L 5L0QC 1JPGA 2AKRB 2Z4QA 5EORL 1Q9KA 1YMHB 5F7NC 4OQTH 2PO6D 3KPSE 1K2DB 3VW3H 5EDXA 1QFWM 1MCHA 4G9FD 1B4JH 5LWYL 5TGBB 1SEQH 2NPLX 1F97A 3UJTH 5DJCB 4U6VH 3NOIA 2VXSL 1RZ8A 3IDIA 1A4KB 1T22B 3WHXB 3O0RH 1FAIH 8CGTA 3LEYL 2EYRB 2IH3B 3BSZL 3QIBA 3MFGB 1YUHB 4JGJA 3GFUA 4QY8B 4RQQB 4MJIB 5C7XL 1NCBL 2C3HA 5F7LB 3LQZB 4XVSL 5GHWL 1I1FB 1LP9E 2IPKB 5E8OB 5IEHB 2NZ9C 1F02I 5DVMA 3LEVH 2RAMA 1KNOB 3TZVA 3O2WL 1E4XH 2HMID 3BUTA 4OD1L 3SKUD 4LHJB 5F9OH 4ZFZA 4IMKA 2O93L 3IGAA 1A7RL 1OP3H 1K8DB 3H9HA 2CKBB 4I0PD 3TCLA 1UG9A 1IM9B 5CEYB 1YMMA 1HH9B 5C0DA 2BVOB 1G7QA 1MIMH 2WBKA 2ZSWB 2FD6H 2VAJA 4S1DD 5EWIL 1XCQA 3K1KC 3UPAA 5A2IH 5C8JB 1L6XA 4PRPE 5JORA 4Y19A 2YXMA 3OAYH 3PWLA 2B4CH 1UZ8A 1TFHA 4NRYA 5DJ6B 1RUQH 3G6DH 1ZANL 3VXSA 4QHNB 1JHTA 1ZA3B 4KK6D 4F15C 3ARBA 3MLRL 2MWCA 1VKXA 1JNNL 4XNUL 1RSFA 3OR7B 5FYLH 5E2UH 4M4RA 3T3PE 4K7PH 4LBEA 2K7QA 2AK4A 3LMJL 2VR9A 4K7FB 1WV7T 1D5XB 1XGQA 1AGFB 1FVCA 5F1OB 3C5JA 1BQSA 4LVNB 1LEIB 5CGYD 4FQCL 1MCWM 4X6DE 3BWUC 4LHUB 5KAQG 5CHNA 4MQSB 3O6FB 3I6GA 2IAMC 1BBJA 3VFPB 4YC2C 3QDMB 1H15A 4PRAB 1A02N 4M1CC 1LDPH 4NCC1 4GKZB 4JG1H 1R0AH 1P7QA 4PJAA 4U1LA 1CZ8H 4FOMA 1A1OB 5DUBA 2NCMA 4KPHL 4YR6A 5FYKU 1WCBA 5K9QI 1X5GA 3DURB 1DBMH 1MCCA 3LPFA 1YPZB 3MLXL 3CAFA 4QRPB 3BP5A 2A2QT 3C5SB 5FYLE 1BFOA 4GRMA 2AVGA 4N8VA 3K3QA 4YUEH 3FAWA 4H88L 1OGTA 3I3BA 4G7YL 3JTSA 4JLRB 1KTDA 3GKZA 4U49A 3EYUH 3RVUC 3AREA 4XZUB 4PJBB 3VRLF 3MLUL 2YRPA 1IC7H 2NY4B 2MOVA 4XAKD 1DBBL 5CP3H 2R0KL 1DSFH 1GIGH 3P4NA 1XFPA 3LQMA 5F89A 1R3KB 5CD3B 3SGKA 4HWUA 1RK0B 4J23A 4DN3L 2EDLA 4YBQD 1DEEA 4B7IA 5C0FB 5LXGH 2MPAH 5C0GB 4CL7A 1AD0A 3LQAL 4K94C 3T65A 5HHQA 2V7NA 3GO1L 4U1GB 3V6OA 3V4VL 1NGZA 3MX0A 1WF5A 4L4TB 4P2RD 3RDTB 2H9GB 1QVOB 2AEPH 1U41A 2XTJE 5IMOA 1P2CB 2PW2B 3O3AA 1FNSL 5HHOA 4WGVB 5A2LH 2R4RL 4GSDL 3HZYA 5LAXB 3RL2B 1GZQB 1MJJB 4R3SA 4LPUA 3HNTH 3STBA 5KJRL 4HW6A 2BSSB 4MNQD 3IETB 1A6VL 2G75A 1SJHB 3KYMA 3VGBA 4QHLB 3QIWA 3CMOL 3TEUA 1Z9SA 1CF8H 3HE6B 1LD9A 1RURL 1QFWL 4OFPA 5EOCJ 2VDQH 2JJTA 4UT6H 4YPGB 1DQQA 4OM1H 3DGGA 4PTTB 4GQ9L 3ESVF 4M3KB 1RJCA 3UC0L 4PGEB 3NCYS 3OAZH 4JZJA 1ZLVK 3OR6A 5ADOL 3BGMA 1EEZA 4Z7UE 5HYFA 3CDYA 4HF5L 4GMTL 4OZFH 3AFLA 3RUGB 4CVZA 3DIFA 3REWA 3UEZA 1LO0H 2C1PB 4X4ME 5KSVA 5GQBA 2BOCB 1AKJB 4K55A 1I1RA 5C09A 4CVXB 4J3UA 3ZT5A 3QIBC 3UMTA 5L0QB 1M71B 5I1GL 3LRSB 3LB6C 3KJ6L 1DLFL 3EDEA 5CP7A 5FA3A 4NDMA 5FYJD 5FYKE 5T3XE 4X6BB 1CR9L 3O6FD 1T1XA 3TZVC 4I3SL 1MSPA 3QDMD 4IMKC 1EAJA 1Q0XH 2HT2D 3DMMA 3IAPA 4Z78B 2EYTB 5D7LD 4XBPA 5HHVH 4UT9L 1BX2A 5F7WC 1R5VA 3WEXB 1J1OH 3TC9A 4LOUC 3MJ7B 3VW3L 4JQIH 4BJLA 4DKAA 4BELD 2BNQE 5AYUH 3AS0A 1R3JA 4K8RC 3UJTL 3U4BH 2IFGA 4Y1AD 4LGPB 1A0QH 2FB4H 2OJEA 2X4NB 2A6KA 2L7JA 3QCTL 2NY2B 4ODTL 4WO4D 1NCNA 1BZ9B 4P2YA 1Q94B 4RA3A 4WVRA 3A6CH 1GSMA 4D0CA 4IOIA 4N0RA 1FRGH 2BNRA 2IANA 2P5WE 3TIEA 1IEAA 1KXVC 1X5HA 1ZWIB 3KWWA 4OFIA 4G8GE 5F9OL 4D0DA 3FOMB 1YYML 3ULUC 1A7QH 2CLVA 2J12B 4LSQH 3T2OA 1D5ZA 2D7NA 1MIML 3PQYB 4F15B 1NLBH 3MO1A 3C87A 2Z8VC 3FQTB 2FD6L 3MYJA 1D5BB 3OKDA 4LLDA 4U6XA 1MWAH 5DR5L 3TJEH 3MRIA 3NA4A 5FO9B 2ADJB 1U8NA 3IJYA 4RWHA 4LU5L 1OAKH 1RUQL 2ARJQ 3G6DL 3THMH 1KIPA 2Z31A 1H3VA 1CG9A 1BQUA 3QSKB 4FABL 3VFRB 4HS8H 4JB9L 1QBAA 1JZ5A 3QDJA 5FYLL 3DX9B 5E2UL 4OV5A 2Y5EA 2DMBA 4K7PL 3HCVA 1A7NH 4YO0A 2IAMB 3TVMA 1IKFH 1EV2E 2Y6SC 4YC2B 1CIDA 2DWEB 1EZVX 1J0ZA 5HPOA 3EJZD 1JTOA 5CBEB 5IMLB 1BWMA 3AMLA 2ESVB 4QTHB 3TYFB 1NBYA 1I1YA 4CU8A 5HGHB 3UO1L 2WWKO 1CDBA 2HTLC 1BIIB 1A5FH 5AWNL 3KPPA 3WNLA 4HFUH 1GPOH 4N8PA 3O2VH 1LDPL 4OF5A 3S3JA 3SY0A 1R0AL 2KL6A 4YDIH 4JDTH 3FQUA 1CZ8L 3VD5A 4X9IA 3TLRA 2GJJA 3MV9A 4KY1H 3V7MA 5K93A 1FL6B 3GK8H 4U1SA 3HC0A 2ICES 1NANH 1NLDH 3UDWA 1T1YB 2VXVH 5FOBA 5CZXC 3ZDZE 1TCRB 1AJ7L 5HI4C 3E6FB 1AE6H 4NKMB 1KPRB 1UWGL 1X5YA 3SDAD 4TN9A 2HLFD 2GQHA 1CYGA 4R9HA 3EYUL 3KYOB 3MRNB 1RUPH 4BSJA 2R1YB 1ES0A 3ARYA 3QIWC 1PEWA 5EU5B 1E27A 2DQTH 3F58H 4NN7C 1VEMA 2C5DC 3ZHDA 3TNMA 5H8DA 5IB3B 3ULVC 1AIFA 4EDXB 4F9PC 5GS0L 1TDQA 1QHOA 3GSQA 3MV11 4JR9H 3FB7A 3FB8A 4PJGE 3GHEH 2VB5A 3MV7B 5LXGL 4F2MB 4JO3H 2NY2D 3NIDF 4PJIB 4QRUA 3D2UA 3V6FA 5IP4A 2OK0H 2ZPKH 5MP6H 4HH8A 2F53E 4PJFA 4AG4H 1JPGB 5DFTA 1Q9KB 3RIFF 1QSZA 1RI8A 4MD5A 3V4PH 2OZ4A 5C07E 1I3RA 3MCG1 1EDQA 5FYKL 5T3XL 1ZT7B 4HJJL 1F4XL 3VXOB 3R0NA 3HNTL 1WZMA 1T7WA 2DICA 4LPCA 3HZVA 3PQYD 1W0VA 2CK0L 3DMMC 5JLZA 3IDIB 4I0KA 1CF8L 5DD5H 5F6IC 5E8EA 2VDQL 1TTUA 3QIBB 5GS1C 3OJMB 3TJHC 4NQEA 1MELA 4HHAA 5HSFA 3RWHA 3PABA 4FTVD 1TENA 4KMQA 4ONGH 4G9DA 5HDLA 3PHQA 4JRWA 2BFVH 2R69L 4NQCA 4DZ8A 4HDIB 3OB0H 3TZVB 1RJYB 3I84A 4ONFL 1T5WA 1WBXA 1YNTB 2D7PA 3N06B 4OLVH 1P53A 3BMWA 5GRJH 3H9HB 3TCLB 2UUDH 4L8BB 2Y5TA 1YMMB 3NCMA 5C0DB 5E5UB 1G7QB 2ESVD 3BKYL 5HXMA 4ACPA 2YXFA 4ODBD 1FFNA 1F4HA 4H20H 1BM3H 1PLGH 1XCQB 3FT3A 2L4OA 3DHMA 5JORB 3PWLB 1UZ8B 3GJFA 4NRYB 3BDYH 2NY7L 4HIEA 3VXSB 1JHTB 5HHVL 4POZD 4NNYA 3BJ91 3MJ8B 3ARBB 1NGXA 5A3ID 3BZEA 3ES6B 1JK8A 1ERNA 4YZFE 3T0EE 3HC4H 4BZYA 1QLFA 4JFXB 4LBEB 3IB4A 3U79A 2AK4B 3C5ZA 5HYEA 2NXZD 5D7JC 3JWOC 2NTFB 4I2XE 3VXMB 2FB4L 1U8KA 1FVCB 1XIWA 1AO7A 3IDNB 4ZDHA 3T77A 4RGNC 5CHNB 3UCRA 3CH1B 3I6GB 1BBJB 5IIEB 3EYQD 1H15B 1QRKA 3LKRB 1QP1A 4TSCH 5T3ZD 3P4MA 1E6JL 1P7QB 4PJAB 1TPXC 1UM4L 3O4LA 3MJ6A 4EKXA 3MBXL 1N6VA 2C3WA 2NY6C 2IBZX 1U92A 1GGIL 1TQBC 1A7QL 4LSQL 4OUUB 4LCUA 3F12B 1HIMH 1OAXH 4YR6B 1HKLH 4JM4L 1WCBB 3EJYC 1NLBL 5EU6B 3QUZC 3BP5B 1MWAL 5A40E 3TJEL 2D9CA 1Y18A 1NDGA 3HN3A 1BFOB 4I5BA 1OF2A 4N8VB 4TYUA 3DVFA 3IJHA 1CXKA 1OGTB 1YEIH 2J6EL 2HLAA 3A0OA 3DARA 4K3HA 3AREB 5TQ0H 4HS8L 1QR4A 5HJ3A 3TBSB 2C4XA 4HIXH 3OF6A 4E5XA 4HV8B 2IMNA 3JV4B 1NEUA 1A7NL 5DC9B 3P30H 1IKFL 1BVZA 4BSWA 4ZUTB 4NC0B 3P4NB 3ARFC 3RAJH 5KVMC 5BW7C 5SWZE 5HYSB 2X4OA 3N1PC 2NY3D 4RBPH 3KXFE 1DEEB 2O5XH 4NFDA 3SKMA 4ZPVA 5GRXG 3CFKB 1WEJH 3ZSTA 4GXVL 43C9B 3FB6B 1HNFA 3EOTH 3IU4H 4PREB 2GJ6D 4HFUL 5JOPE 4U1KA 1J10A 1Q1JH 2YWYA 4JDTL 3O3AB 3W9EA 4E41E 2P8MA 3BH8A 5HHOB 4XX1E 1QRNA 2HFGL 4NO0A 1PAMA 2NY5C 4R3SB 1TQCC 5T1DH 1KJ3H 4N8CH 3H9YA 3N50A 4J6RL 1UKTA 1YMMD 5IHUL 4LAQH 4LSVH 5GGSB 3KYMB 4R8WH 1K6QL 2X1XR 3QIWB 4LCCC 1HINL 5E56A 3T2QA 2E6JA 4Y19D 5KZCD 1AE6L 2NXYC 1DQQB 1CE6A 1NC2A 1BGXL 3DGGB 5CEZH 4QTIH 4MLIA 2WLZA 1MCOH 2XKUA 2H2SD 3BGMB 1EEZB 4PJ7A 3RWGB 3ARBD 4HXAH 3VFVA 3DV4B 4XWGH 3DIFB 3ULSA 3REWB 5DRXA 1BECA 2DQTL 1LDSA 3CXHK 5KSVB 2X4RB 3HUJA 4QXTA 1T03H 5C09B 2AK4D 3WE6A 4S10A 4YBLC 1KT2A 3BVNA 2CIIA 4JR9L 5I1LA 1ZT1A 2CRYA 3HNVH 3X13A 2P5EA 3ZMRA 3T0VA 4PGCA 5FA3B 1V3KA 4NDMB 1L0QA 1RZFH 6FABH 1T1XB 2OK0L 5JW4Q 2UVEA 4G6JH 2LVCA 5MP6L 1EBAA 3G5ZB 2EE6A 3FFDA 4RRPG 4AG4L 3D87B 1PY9A 4ZUWB 3DMMB 1BOYA 3NABL 1KELH 4QWWD 1P7QD 4XBPB 2R2BB 4XI5C 4FQQB 4NQSB 5F6IB 3EYFA 4J3SA 4KDWA 5GS1B 4ZOCA 5DQ9A 4A6YH 4PD4K 4IEFB 4JFFA 4S0SD 3QUYC 1ZLUK 3TA3A 1MAKA 5DURD 3W11D 3CFEA 3AXLA 4RFNC 5IW6A 3DYMA 2OJEB 3LPWA 1B0RA 4GS7C 2DLTA 5DD5L 1U93A 3S3SA 1FAKT 4KHTL 1N6QL 3KPLB 4KRPC 1J1PL 5DFVD 3RY5A 4IMLB 3MBED 4AQOA 5GGVY 5I15L 4ONGL 1T1ZB 3ARED 3HA0A 2VDPL 4J3VA 2A9NL 4IOIB 1KN4H 2BFVL 3ZTNH 1YEDA 2BNRB 5H37G 3DJ9A 3RY6A 1MF2H 1IEAB 3TIEB 2BXZA 2ICWI 4JZOA 1XIWC 3KPSA 4ELME 4D0DB 3SDCD 1CDUA 3PIQB 5I1DA 4NCC2 1BVKA 4KRNA 1FH5H 2R0WL 4L4VE 3MYJB 4U6XB 3OKDB 4LLDB 5F93C 1X44A 1S7VA 3MRIB 1C08B 3G5XA 4MZ2A 5DUPH 3IJYB 1S9YA 1U8NB 3PP4L 3RGHA 4NBZB 3MRDB 1FNAA 1M7IB 5JDSA 1S7QB 3MLTB 2F5BH 1KIPB 3A67H 2CLRB 5I17A 1CG9B 4R4NC 3IS1X 5CIPH 2JELL 4M5YH 1LP9A 4RGNB 1YEGH 3DRTB 3QDJB 1S7TB 3MRGA 2OLDA 3HC4L 3HCVB 3TVMB 1IGYB 4Z7VE 4J8RA 3ILPA 3EOAB 5JA8B 5TDNA 2ZUVA 1INQB 1IGMH 5EO0B 4WFHE 1TPXB 4LPXA 2UZXB 1QNZL 2VE6A 4RMTA 4TTDD 2F54D 2NY6B 1TQBB 5HYQA 4JHWH 4UU9B 5SWQA 4NKDA 1X9QA 4PRPA 3E0GA 1A7PL 4GKNA 5KG9B 3KPPB 4LKCB 4JM2A 1IEBA 4ZUUB 3U48A 3CSYB 3SY0B 3Q3GB 3FQUB 2BVEA 2OTWA 1RVFH 5C6TL 3MV9B 5JMOC 1AC0A 1HIML 1MUJA 4LLYA 2ED9A 4X8JA 5FXCH 5GGTH 5FOBB 4GAGH 4Z7OE 2G60H 2WNGA 4JPWH 3ARFB 2CR6A 3KVQA 3TN0C 2Q20A 5TQ0L 4M7JH 2DIBA 4WTWA 4R2GD 5I66B 1NFKA 3ELAT 1S8DA 4ODVH 4WFFD 2BNUA 3QUMH 5GGVH 1P4BL 2O5ZH 1MFAH 3P30L 3BW9A 3TNMB 3U0TA 3MRPA 3TWCH 3IFNH 4O9HH 4HXBL 2EDNA 1MLBA 4KC3B 3IDYC 1FC1A 1WWBX 1X3DA 3FB8B 1W2KT 1I3UA 4Z77B 1TQCB 2ICEA 2YZ1A 1WBZA 4QRUB 1PYWA 4ZPTA 3V6FB 1FNFA 5I8KH 3EOTL 4PJHF 3IU4L 4PJFB 4DKDC 2O61A 3VGHA 1ONQA 2D4FA 2E6QA 2FR4A 1CFQB 4GT7A 5IESH 5IKCA 2IAND 2IGFL 4FQJH 4X5LA 3VDAA 5E2WH 3D39E 2V9RA 2NXYB 3GDBA 2QKIA 1KJ3L 4E0RA 4N8CL 4FNLH 1L9MA 3V52H 2DL9A 3WDIA 3CIQA 1W0VB 1SM3H 1J1XL 1DUZB 4R8WL 5DFWH 1R3IH 5I73C 5JLZB 4CVUA 2B39A 2E27H 5CEZL 3GSNH 3V4UL 2UYLA 5D2NE 3QT2A 5EFIA 1IKNA 4NQEB 5E4IA 4YBLB 4HHAB 4N1EA 2Z31D 5DHVH 4PRHE 3TA3C 3CXHJ 4G9DB 1S9XA 2X70A 4JANB 2HG5A 4NRXA 3VXTA 2GTWA 4OZHF 4XWGL 3ARUA 3WUWA 4RZCB 4NQCB 3TVMD 1U8OA 1T5WB 1WBXB 3MOAH 1TZIA 5DVLA 5IB1A 2Y5TB 3V5DA 5EBWA 1S7UA 5GXBB 12E8H 3Q6FA 4NNXA 5HYIA 3VMPA 1KTKE 1JZ2A 3RY6C 6FABL 3FT3B 4NQDB 5IFHH 3O9WA 3QUYB 3IAQA 3PDDA 4G6JL 4NQVA 1NKOA 2XXCB 5C9KA 3M45A 1DL7L 4RFNB 2EDTA 4HEME 3ILQC 4GS7B 1R24B 2XN9A 2JB5L 4Z7UA 3BJLA 1NGXB 3RJDA