3MJGX

The structure of a platelet derived growth factor receptor complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
280
structure length
274
Chain Sequence
LVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFSGIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGNEVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDHQDEKAINITVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Platelet-derived growth factor subunit B
publication title Structures of a platelet-derived growth factor/propeptide complex and a platelet-derived growth factor/receptor complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/transferase
total genus 50
structure length 274
sequence length 280
chains with identical sequence Y
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00047 ig Immunoglobulin domain
X PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mjgX03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mjgX02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mjgX01
2CRZA 4L4TE 4IDJL 2EDOA 2ZUTA 1EHAA 4DK3A 2C1OB 1VFAA 3DX7B 4PJ8D 3SPVA 3X12B 5IQ7H 4A6YL 5TPWL 4QXUH 1MWAL 4M4PA 1T1ZB 3NCJH 3ZKMC 5C2UB 1QSFD 3V7AG 2EDBA 2Z35A 4XP6L 4KKNA 3VXUB 2BVQA 3IU3B 3EJYD 4NM8L 3MV8D 3OX8A 2NPLX 3DX8B 4HV8B 4OGZA 4HGWB 3SCMC 1U8KA 4ZUWB 3MRBA 2R2EB 3X13B 4EI6A 2CUHA 3I85A 1GGTA 1D5BA 4NKQB 2ADFH 5C0RH 1V5JA 1VFOA 3TJEH 1RY7B 5J6GA 2MQCA 3RKDC 1OW0A 4D0BB 2ZSVB 4PJIF 4TVPE 1RJZB 1CYGA 2OP4L 3VXOA 3OF6A 4JR9H 4KDWA 2G60L 5K9KA 2IMNA 2AJZB 1FP5A 1OP3K 4JO1L 5B3JE 1FN4A 1A47A 3L9RA 2VLRB 4HAGA 5EO1B 3S6CA 2X4SB 2DMKA 2J1KA 3O45A 5KOVC 3D2UA 4JGJA 1W2KT 1JMXA 3M8OH 5ALBH 4PV8A 5EA0H 5EDXA 2YBRB 1IC4L 4M03A 2KQMA 3VD7A 4TVPH 2P5WD 1ZXQA 4LFHD 4ZFOA 1CLZH 3AMLA 2FX9H 1JZ7A 4PV9A 3LEYL 4F9PA 1GOGA 2X89D 4YK4B 1IAMA 5FB8A 1CFQA 4PLKC 3NTCH 3KWWA 3AB0C 3S36L 4Z0XB 1W72B 4JZOA 3PHOB 4NT6B 5FGCE 1NGXA 5E2UH 1IC7H 3RNKA 4RZCB 4JY4A 3AY4C 4PYHA 4EDWL 3P77A 4JDZB 1S9YA 5EU4B 4UUJA 1FNFA 5KOMC 3KPPA 5BZWA 1DCLA 2A6DA 3E6FB 3EDKA 1G1YA 5D7IA 3CAFA 3GHEL 4JZNA 3T1FB 1IBGL 1LK3L 3UO1L 1R5IA 3TN0D 5IIEA 2R9HC 4JPIB 3WIIH 1BX2A 4TNWF 1N0XH 3BMVA 1FVDA 4MJIA 4QKXB 5D7JC 4M1GH 3G6JE 1RAMA 1EMTL 2W9EH 3SDAC 1SJHB 2ZUUA 3GMOA 5E8OB 1VEPA 3P30H 4LOUC 1NGZB 3FB5A 5D7SH 3TIDB 5ECJE 4HJGA 1WISA 4OD1H 4P46B 4K23H 5GS0L 5MHSE 1P7HL 4N8CH 1PYWA 4FXLA 4X4ME 5ESQB 5K93A 4AYFA 4GG6E 3MFGB 3NZHL 2ZG2A 2F74A 1OD7A 4PS4H 1K4DB 1IAOA 4HBQA 4J3WA 4MQXD 4LNVA 2XQBH 1P84K 3VWJB 4QHKJ 1EXUA 4LLYB 3SE9H 4XP5H 1X9QA 4HT1L 3WXVH 2CJUH 2UWEB 1SEBB 2BDNL 2GSIA 2ZUQC 3CFIC 4H26B 3T2PA 2IBBA 3CU7A 4I18B 4LSTH 5L6YL 1IILE 4HC1A 4HEPG 2MCPL 4O2EB 3T2QA 1Q1JH 4PUBL 1VENA 2VZTA 3A0OA 5D5MF 3ZT6A 1A1MA 4E42B 3EYVA 4S1QH 1OP5K 2ERJC 4KI5E 2I24N 1FGNL 2I5YL 5CSGA 2WZPD 3IDXL 4OV5A 4L5FL 3SQOH 4CGTA 4JJHA 2P45B 1NCAL 2QSVA 4RBPK 2G5RA 2GYSA 2VLKE 3E2HC 1I1YB 3X3FL 4KTDL 3RA7L 4Z95L 4ZFZB 1IGCH 5CZKA 4M6MH 1J0JA 1OHQA 2Y6SD 3QWRA 1INDL 3HAEB 5HSFA 5D1QD 3RVWC 4MXWH 4XCYA 2R1YA 2HJKA 3IVKA 1WTLA 4Q6IA 3EO0B 3Q2CA 2RBLA 5F7HA 1N2RA 4ERSH 1WV7T 2P5ED 3H3KA 5F9OL 1I4FB 5ERWB 3WV0A 1L9NA 4Y1AA 3FO9A 4F37F 4H88L 4L8CA 2VDKH 2C4XA 2V2TA 5C0JB 1OTSC 3SCMB 4WFGD 5CBAB 6FABH 2HWZL 2R39A 4QT5A 2CGRH 2OK0H 3GHBL 2VDNH 5SWZA 3WNLA 1NKOA 3U6RB 1CBVL 4YDIH 5GPRA 5IOPA 1JGUL 5CJ8A 1S8DB 4I2XB 3STZA 1RV6X 1PD6A 2G75A 4G9DB 5CCKL 4J12A 2VIRB 5DJ2B 2V6HA 2AXFA 3GFUA 4XZUB 1U2HA 5DK3A 2VKXA 3KR3H 5DQJB 1GC1C 3B8SA 2DF3A 2C1OA 3AFLA 3DX7A 3EJZD 3L3OB 3X12A 2VDOL 3UX9B 1CCZA 5DVLA 1L6ZA 1T1ZA 5DA4A 3W2DL 3K81A 4DW2H 4HIXL 1KTLB 1CLOH 2ZNWA 1DQQB 4M1CD 3AB0B 4MAYC 4O58L 3VXUA 4GJTB 2XA8L 3IU3A 4NZRH 3DX8A 4HV8A 4PB0L 2CMRH 4HGWA 3K2UH 4HH9B 5JQHC 4ZUWA 1HHIB 5BS0D 2OR9H 3OKYA 4HS8H 2R2EA 3X13A 2AJXL 2X70B 3DXAD 3NAAL 2NY5L 1DBKL 1RZKH 4D0BA 2ZSVA 4S2SB 4WEBH 5A3ID 4HCRA 1YNTB 1RJZA 3VXRD 3F7RA 4K8RC 5HYJB 1OP3H 4WVRA 2FD6L 4OCWH 3ZYZA 2EZ0C 2AJZA 4YNYB 1TQBC 3P4NB 3DOSA 4YHML 3BDYL 3JTTB 5D7JB 2VLRA 5EO1A 4OCYL 2BNQE 2X4SA 4LKCB 1RFDL 3FN9A 1G9NH 4TPRH 4WWID 5I19L 4NNPH 4H8WH 1C7SA 1YYMH 2YBRA 3MRNB 5CSBA 2QV2A 4PRHD 1N0LA 3FB8B 1ROWA 2VZVA 1UT9A 3HA0A 3QDHA 3WMSA 4JDTH 1BBDH 4UV7L 1CFVH 3BPCB 2HJFB 4NZJA 1T1WB 5BW7A 3BI9X 5C08E 3F12B 4K7PL 3TT3L 2XNAB 4Z0XA 3ARGD 3LMJH 3JUZA 1W72A 4OFVA 1OARL 3PHOA 4KK8D 4NT6A 5E2TL 3RIAF 5LXGL 2QQNL 3V7MA 3UC0H 4RZCA 4XMKH 2VQ1B 2ZUQB 1PKOA 3V8OA 5ADPL 4JDZA 5EU4A 3LD8C 5BJTB 3E6FA 4LNRB 2AJYL 3T1FA 2OZ4H 2IBGA 2ERJB 5LGHH 1MRCH 1AP2B 4F7MB 3U79A 4Z7WB 3TJHC 5JW4R 3ZHKA 4M5ZL 1IGIH 4JPIA 4Z7OF 3ULUE 3E2HB 4PB9H 1A4JB 5BOZG 3C2SA 4R7DB 2HT2D 1V3JA 4FZ8H 1SJHA 5E8OA 5E2WL 4PG2A 1WIPA 3S4SB 1NGZA 3TIDA 4JHAL 4P46A 4K94C 3WO4C 4KPHL 5ESQA 4IMKC 3QG7H 2CQVA 4NP4L 1KXTB 1K4DA 1UADC 4LLDB 1FO0H 2X4QB 3VWJA 2LV4A 4LLYA 3KPSE 4X99B 2XN9E 1KYOJ 3QPQC 2UWEA 1SEBA 2CLVB 1V7NL 2E9IA 5KVDL 4H26A 2BOBB 1KB5L 1F58H 4M43H 4I18A 4OLZH 3RZCD 1RD6A 4O2EA 5AYUH 1OP5H 4E42A 2VJXA 3ZTJH 5CGTA 2GK2A 3U0WH 1GH7A 4XCFH 4PD4J 4ACPA 2X6MA 4RBPH 4JM4H 2Q86B 4HBCL 1I1YA 3MV9D 1Q8MA 3JV6B 4ZFZA 1SYVB 2IFGA 4QTIH 3WFBL 3T1WA 1D5IH 1KLFA 3K1KC 3QFJD 5HHXL 2H3NB 3HAEG 3HAEA 3MRIB 2A73B 1A6ZB 1MREL 1ZLSH 2VDMH 1P4IH 3ULVD 3EO0A 1JPSH 5EORL 4PJEE 4TSBH 5EZOH 5BRZE 5FF6B 4CVWA 2VLJD 1I4FA 3FFDB 4MAYB 4G6JL 3RAJH 4G8EB 5ERWA 4EBQL 4Z18A 4C55A 1I9EA 5L2KE 2B4CC 4Y4HC 2XZCH 3NFSL 1NCWH 4DGIL 3W0WD 5C0JA 1IVLA 3SCMA 4OCRL 4XCCL 3I3BA 2X4NB 5CBAA 2J8UE 4KHTH 4WI9A 4KV5E 2I9LB 1N59B 3MLXL 1URLA 5ICYB 1FBIH 1LNUB 3QCUH 3U6RA 2JJUA 2I60L 1TZHB 2WUBH 4MXQC 1ZANL 1MCNA 1S8DA 4I2XA 1EEYB 4WHTB 5KTEL 1YQVL 1TQBB 4LIQL 2DLHA 3VW3H 5IFJB 3MCLL 3FKUS 4G9DA 4HFUL 2VIRA 5DJ2A 1A8JH 4XZUA 3BSZL 4M8QB 5HGDB 2WBJC 5DQJA 3WNOA 3L3OA 3H42H 1E6JL 1ZA3B 3TBSB 2J6EL 3BP5B 5C6TL 3OKOB 4LQFL 5DZNA 2L7UA 2ARWA 3VMPA 1WFUA 1CIUA 5IBLD 1KCRL 1JGLH 3MRJB 1KTLA 4MNGB 1DQQA 4X7FC 4Q6YA 5D7LD 1CN4A 5IGXL 3WL9B 3BT2H 3AY4A 3MLWH 4CMHC 3N0PB 4HH9A 1F4XH 1H0DB 1HHIA 4LRNH 2X70A 3LD8B 3QUXD 1CDHA 4M7LT 5I71B 4DZBB 5EIQA 1FL6B 2VH5H 4S2SA 3U9UB 1YNTA 1NC4B 3CFCH 3MCG1 4OQTA 2ZCLL 2E7BA 5HYJA 2QL1A 4X4YB 1Z9SA 4YNYA 3P4NA 3H3BC 3HMWH 3JTTA 5D7JA 1DR9A 2X05A 3MRDB 4W6YB 4LKCA 1CIDA 3WNPA 3D9AH 4IDJH 3MRNA 3UJIL 3UTTB 5F88B 3FB8A 1IM9D 2B2XH 1XGYH 4A6YH 2XRAL 5TPWH 3WO4B 1JHLL 2R0ZH 2YD1A 5EU3B 3BPCA 2HJFA 5C09E 1T1WA 3F12A 3VDBA 1D6VL 1JTPA 4TUKL 2XNAA 3R4DA 5DMIL 5DD6B 3IXAB 4OF5A 1RUQL 4NM8H 3EHBC 1QFOA 2VQ1A 1L0QA 5ISZB 5BJTA 5I8OL 2PR4L 4LNRA 2VL5B 5L8JB 4NN6C 4OJFL 4E41B 5EBGA 1AP2A 4F7MA 4HJJL 4Z7WA 3DI2B 5GGVL 3SKMB 4LVNC 4D2NA 1A4JA 5JXED 1P6AB 4NGHL 4R7DA 3QXVA 1N6QH 1U2CA 1ODAA 1YY9C 2F58H 3LRGA 1D9KC 1OD9A 3S4SG 3S4SA 3O2DA 2EE6A 1I7ZB 4IRJD 3VI4E 2O5XL 3PGDB 5GGTL 4X6CE 3Q5TA 4JRYB 3HTLX 3CLEL 3ARDC 2YXFA 1XF3B 3FZUC 4Y4KD 4LLDA 4QHNB 2K1MA 2X4QA 3U1SL 5ACLA 2JJWA 5EOTB 1BF2A 3NCEB 4CN1A 3QHZH 4WW2F 4X99A 4OB5L 4Y4HB 4CMMB 1KJVB 5B21A 2ARJB 2CLVA 4HK3N 3WSQL 5HHQB 4XGZB 1T5XB 2BOBA 5TF0A 2YK1H 2IG2L 3FHQA 3GHEH 2DD8H 1H3TA 1LK3H 3VCLB 3UO1H 1TFHA 3EFDH 5T1MB 1AXIB 3U9PL 3X3GH 4W6XB 3QDAA 4OSUH 1EBAA 1UB5A 2R0LL 5TDPB 4ETYA 2IC2A 2Q86A 4CU7A 2BY3A 3JWOH 4OT1L 1AQKL 3NZ8B 5TE4H 3CFKB 4XBEH 5DMJB 3JV6A 3K1DA 2EDRA 4K9EH 5F1NB 5MENB 3N1PC 2WBJB 4PP2B 2D7PA 1OGAE 3MZGB 1RUAL 5ALCL 4NN5C 2H3NA 3CX5K 3MRIA 1CE1L 2A73A 4I77H 2OL3H 1A6ZA 4E0RB 1HHJB 3C8KB 5CD5C 4FQHB 5GJTL 5F96H 3HUJE 5FF6A 5KSAD 3BRGC 5I1HL 4MAYA 3FFDA 3K80A 5AWNH 5T3XD 4G8EA 3ZE2E 1WUNT 5TE6H 2F19L 4DGVL 4XP9H 2YPKB 1T22B 4CMHB 2X4NA 1H3XA 1QD0A 1A3RH 1B4JH 2I9LA 1N59A 5ICYA 2RCSL 1LNUA 4RWHA 4KJPD 3HG1D 2O93L 1VFMA 1CL7L 2CKBB 4M1DL 1TZHA 3AM8C 4I48B 1QFWH 2AXHA 3BRFA 1FC2D 1A5FL 1EEYA 5JZ7D 4WHTA 3U48A 3X3FH 4W81A 5IFJA 2ICEB 3MZTA 1KB9J 5EU5B 2IMMA 5CJXA 4M8QA 3QWOB 2YWYA 5HGDA 5ACZB 3MLTA 1J1XH 5BQ7B 4GRLD 2AJUL 1ZA3A 1AJ7H 2BZDA 3TBSA 3IAPA 2BNRE 1QBLH 3BP5A 2QSCL 3OKOA 5ID0B 1CQKA 1UWGH 1PLGL 4KROC 3MRJA 4MNGA 4J2XA 1KIUA 4ZAKD 3RI5F 2AXJA 1B6DA 1YZZA 3MACL 5GXBB 5C71A 4KQ3H 3IT8D 2C7UB 3RX8A 3WL9A 4H88H 4ZS6C 2AXGB 3LB6D 2DLEA 3M17B 3OQ3B 1JCKA 1H0DA 4PJ5B 3TPKA 1OAQH 5EFIB 1KUMA 1OAYH 4JRXB 4LU5H 4MX7B 4DZBA 3GHBH 3MOAH 1A2YB 1KEMH 4NN6B 1FL6A 4M5YH 3P40A 1CBVH 3U9UA 3GIZL 3STLB 1KJ2B 1NC4A 1VERA 1JGUH 5FCUL 2FO4B 4X4YA 4YE4H 5EUOF 5DYOB 4LVNB 1T4KB 1DBBH 5T5NG 3MRDA 5J9PB 2NXYC 5FYJU 1BREA 1D9KB 4X5LA 3N50A 1MCFA 1DVFD 3LS5L 4ODSL 3UTTA 1KFAH 5CJOH 4RX4D 3TBVB 2F15A 4ZNEA 3QEUB 1T1YB 3O3EA 3GSXB 4IMKA 3ARDB 4NQDE 5EU3A 1ZT4B 3W2DH 5B22A 2M26A 3QEQD 3LV3B 5HVHC 1MCOL 5T1DL 3I50L 5DD6A 3IXAA 1P7KB 1ZMYA 4LCWB 4AT6B 2OTPA 4X8XA 5I1KH 3QI9C 4Z7VE 2XQYG 3PP4H 5IVXB 3MOBL 3DUSB 4O4YL 3BKJH 4OBRA 2NY5H 5ISZA 2R29H 1EFXB 3MXVH 4YLQT 5IK3B 2VL5A 2VN7A 1TMCB 4E41A 2Y06H 5JW5B 3MLZH 2IF7A 4YHMH 4Z7QE 3SKMA 3BDYH 3WIHA 2QSQA 4KJQD 5ETUB 3PQYE 1MHEB 1RZ8B 3BISA 1PGRB 4EVNB 1NBVL 1BFTA 5D1XC 1UFUA 4NN5B 3B9DA 1CGXA 4DQOL 1I7ZA 1QHPA 3PGDA 1SVCP 4JRYA 3WFCL 2W0FB 2WSKA 1CDUA 3VGAC 1P5VA 5F7FA 2VDLH 1XF3A 3P11L 4XTRC 4XC3L 3TT3H 5GS2H 1EX0A 2XOTA 1JP5A 4QHNA 3FO0L 3NGBC 4Q9RL 4XPFL 5EOTA 2DKUA 2QQNH 4Y4HA 4CMMA 4PYGA 1KJVA 2QQLL 5I0ZA 5JIIA 1UWEH 2ARJA 1G7MB 3B9KC 4WFEE 1N5YL 3E6HB 5HHQA 4XGZA 1T5XA 4Z8FH 3IKKA 2C3GA 3CVIH 5JR1L 4FP8L 5GISH 3C5ZC 3VCLA 4Y2DD 2AEPH 3OZ9H 1ZE3C 2JCCF 5T1MA 4PJIE 1YYLH 4P49A 5CWSB 3LN5B 4HAFA 5TDPA 2EE9A 4N68A 2RFXB 3TP4A 3NZ8A 4KKBD 3CFKA 1U8HB 3IAQA 5F1NA 2EIZB 3ZDZF 5MENA 5HGAB 4PJDF 1OAXL 2WBJA 3OKMB 4PP2A 3LEVL 4JHAH 4R2GC 1RZKC 1VB9A 5LCVH 1TCRB 2DI8A 3BE1L 4JN2B 2EYSB 5FO7B 2LU7A 3IKCB 3RJQB 4BK4A 1P53A 4E0RA 1HHJA 3C8KA 3IDUA 1CE6B 2B1HL 4PGCB 4FQHA 1DL7L 3K74B 4AJ0A 4KROB 4HX1B 5I1GL 2VZUA 4L9DA 1LO3L 5TQ0L 1RZJC 2M8XA 2Z31D 3O4OC 4LVOC 4ALAH 1QSVA 4JPVL 2YPKA 1T22A 4X4ZA 5FYLL 1DP0A 5BXFB 2XY1A 4PTUB 1JPFB 2G9HA 3OKEB 1E4XL 5C0GB 4LDLB 2VC2L 3DRQB 5F71A 1UCBH 2PUQT 1QLEL 2CKBA 3SOBL 4I48A 2D0FA 4U33A 4U05A 3PWPD 1ONQB 2ICEA 4DVBB 4ZQKB 2FX8L 1TVDA 3RIAK 2NXYB 1ZVYA 5EU5A 1UM4L 3WFBH 5C1MB 3QWOA 4XVUD 1PG7W 4HJ0D 5ACZA 5HHXH 5FHBH 2WP3O 5BQ7A 3ISWA 2BJMH 4P3CL 1YEFL 3TA3D 3VXNB 4F80A 1BF8A 4ZO7A 3O4LD 4LPYA 1U8NB 4JKPL 1VKXB 5ID0A 3LQAL 1JYXA 4ZODA 1NGYB 1OF2A 4Y2OA 5HVHB 4M7JL 1SBBA 1DQML 1AGBB 1OPGH 1U93B 2ID5A 1TJGH 3BGMB 4LIQE 2C7UA 1MRDH 3NFSH 3QI9B 4APQD 2AXGA 1WZ1H 4OCRH 3M17A 4OLUL 5FM5M 3R0NA 4PJ5A 4WJ5B 4ONGL 4M7KH 4WU5B 2C4FT 5EFIA 2APVA 4LEXH 2DQFB 4KKCD 4JRXA 3R8BB 3LPGA 4MX7A 2Y7QB 2D0HA 1A2YA 3ULUC 5E9DE 2GKIA 2I60H 5D5ME 1EDQA 1KJ2A 3STLA 4J3OC 2FO4A 5EPMB 4LIQH 5DYOA 4Z76B 2WM0A 4NQED 1JZ6A 4CVXB 1T4KA 4YFLI 3RVXC 5J9PA 2FBOJ 2MMXA 2N7AA 3RHWK 3BSZH 1SEQL 1D9KA 3H0TB 2HRLA 2NTFB 5D1XB 4IM8A 3OMZA 2Z93B 2KDGA 5FV1L 3QRGL 1MIML 4ZOCA 1E6JH 5FGRA 5DUML 2EDLA 1OAUL 2A74B 3QEUA 2J6EH 3GGWB 5JIKA 2XFXB 5K59F 1T1YA 3ET9F 3GSXA 5GSRB 3ARDA 3VGAB 4LQFH 1ZT4A 3KAAA 3GMNB 4PJ9C 1VSCA 4CUCA 2Y5EA 3UTSD 1MCBA 3OR7B 3NGBB 2AEWA 3LV3A 2F54B 2WAHA 1P7KA 4LCWA 4LEOB 4AT6A 1G7IB 4XPHH 4G8GB 4JFDB 1R3IH 4K71C 1Z0NA 3B9KB 4KDTC 2VZOA 5IVXA 3DUSA 5FKAB 5IJVB 1EFXA 4DEPC 3B2VL 4R26H 5IK3A 3E8UL 5J1TC 4PRPD 3MNZB 1EEQA 4OM0H 4OIAA 1I7TB 3ULVF 5KSBF 5JW5A 3IB4A 1FORH 4UT6H 1MAKA 2AK1L 4GAFB 2BRRL 1RIHH 3DHJA 3QH3B 4QYOB 3VFWB 1OM3L 4XAKD 5ETUA 4MZ3A 1MHEA 1RZ8A 3L5XL 4EVNA 1MQKL 3D2UD 2YPLE 4R2GB 3HRPA 4LSVL 4ELMB 2JF1A 4L4TD 1HE7A 1WQVT 4KHXL 2W0FA 4HGKC 2ADJB 3OTTA 1FLRL 5EBWB 4OM1L 1GAFL 1IAIH 4NWTL 4TUKH 5DVKA 2VDRL 4MA1C 3O4OB 3JV0A 4LVOB 1AKJB 1I1AD 5I1AB 1H8OA 4OV6F 1G7MA 5LGKA 3E6HA 2PW1B 4BZ1L 4RWYL 2ZJSL 4JCLA 4GT7A 1FCGA 4H20H 2AJSH 5E56A 2CK0L 1WFNA 1WBZB 1MCCA 5EZIL 4EXKA 3AM8A 4NWUL 5CWSA 5GGVH 4XNZC 3LN5A 5JW4M 2RFXA 5DURD 4XXCC 4NPYB 1X5YA 2RQ8A 3K2MC 1U8HA 3QPXH 3A67L 4OCXL 1NJ9B 2EIZA 2IANE 4ONHB 5HGAA 4MLIA 3OKMA 3C5SB 5C7XH 5C08B 1TCRA 3HI1B 4M48L 4JN2A 2EYSA 5FO7A 3IKCA 2JIXB 1VFUA 1CE6A 1YEHH 4Z0BH 4GFTB 1F97A 4PGCA 4RMWA 4HX1A 2OCFD 4GSDH 2R1XB 2JELL 4PY8J 3U1SH 5DC0A 2EO1A 1FYTB 3Q3GB 3N06B 4NOBA 4WTZG 1XGQB 2ZPKH 2NY6D 3WSQH 4M6NH 2E7CA 5BXFA 4PTUA 1ED3B 4I3SH 1JPFA 5IW1B 3OKEA 1KC5H 5C0GA 1QBBA 3DRQA 3NMEA 4HMCA 4N1CA 4QHKI 3ZT5A 1Y6KR 2R0LH 1OQOA 4NHCH 3T0EC 4NKOB 2NR6D 1ONQA 1ZWIB 4YXHH 2IAMC 1A7OL 3QXTA 4DVBA 4ZQKA 5DMGD 2FBJL 4UOJA 4MJ6B 3QQ4B 3PGCB 1X5ZA 1JF1B 4KGJA 1MFAH 5ALCH 1RUAH 4C57C 4P2RD 1C12B 5D1ZC 4GO6B 2YA2A 3TH2T 1CE1H 1QPPA 3QHFL 3QWRD 2NCMA 1WZKA 4Z7UB 3QHTC 3VXNA 4GUPB 5F1IB 2XIDA 5CJ5A 3KPSB 2EIEA 3BPLC 3WDHA 5CS7A 1U8NA 3L3JA 1VKXA 4PJ9B 4B0MM 1UEYA 5IMOB 4J6RL 1NGYA 5JLZB 3LKNB 4NKMB 4NRYA 2MHAB 1AGBA 1U93A 4K71B 3BGMA 4K7FB 4AM0B 3O2WL 1DANU 5K33A 3QI9A 4GRWF 1TTFA 4X7CC 4ZOAA 4Y1AD 5T5FL 2LFGA 4NQCB 4WJ5A 3VGHA 4RRPG 4WU5A 4RRPA 5KW9L 3QIUD 4XNYL 2DQFA 2Y7QA 2AEQL 1DN0B 1T2XA 3RWIB 4Q0XL 1BVLB 1HZHL 3RKPA 1M6OB 2WWKT 4LSDA 1A5FH 4KK5D 5EPMA 1KXQE 4Z76A 4CVXA 2YUZA 3RWHB 1RULH 1TNMA 3PV6B 3PDOB 3H0TA 2NTFA 3FQNB 4WI6A 5D1XA 4DAGL 2Z93A 4K2UH 2FZ3B 1XZ0B 1FZJA 4PJGB 3ULSB 3HR5B 2A74A 4U1LB 3GGWA 2XFXA 2PKDA 5GSRA 5L2KB 1QLRB 3GMNA 4HZLB 1K85A 1L9MA 3OR7A 3NH7H 3PWNB 3N1QC 1KXVC 4MA1B 2F54A 4ZYKB 4DWHA 1KTKE 4LEOA 4POYA 1G7IA 4G8GA 4JFDA 3WHXB 4UT9L 2IH1B 2PYEE 3ZL4L 3VXUD 2XTLA 2O5YL 3B9KA 4OD3H 1T03L 5DLML 5L88L 5FKAA 4NZTL 5GS0C 1EBPA 5IJVA 2XXCB 1KACB 5KAQG 4KXZI 5DJ0B 5SX4H 5KANI 1U3YA 2ICWI 3MNZA 4I9WD 1CDBA 1DQDL 1I7TA 3HI5H 4NO5B 1FIGH 1RIUH 4XNZB 4JANB 4RGNC 4NKDB 3KXFB 2E7MA 3FQXB 4ZUVB 2UZYB 1E4XI 3QH3A 4QYOA 3VFWA 4M02A 3NCBB 4U49A 1GGBL 3W11D 3HNVH 1AH1A 2VL4A 4NQXB 3ARSA 4PJBE 2CO6B 4TTGA 3AROA 4ELMA 3MLSH 1JPTH 2ADJA 2CR6A 2YD6A 5EBWA 1BGXH 4XXDB 4EUPH 2XY2A 3QR2A 4OFPA 2FLBT 1NGPL 4E9LA 4N8VB 1AKJA 5I1AA 1Z9LA 3MOBH 5T3ZD 2H32B 2PW1A 1KN4H 1T80A 3ILPB 4WFFE 1MWAB 3BQUC 1GOHA 1NLDL 1WBZA 2H2PC 4NM4L 4OZIB 1FG2B 2VDQH 4RSVA 3T0EB 2P7TB 3RI5K 1N4XL 3WLWC 4EKXA 2IAMB 4HLZG 1YEIH 3VWKD 4NPYA 3ESVF 4X6FB 3OJVC 4XC1L 1NJ9A 4ONHA 4Y89A 4UNTA 3S3SA 1XCQB 5C09B 1RUML 3C5SA 3VRJB 5D2LE 1WTGT 2KPNA 3MLRL 5D1ZB 4MNQB 4F57H 2OZ4A 2BERA 5C08A 3HI1A 3WFCH 3STBA 1B0WA 2JIXA 3ULVL 3BPLB 1LEGB 3P11H 5HHVL 2L0DA 1CFSB 1N5AB 4HS6B 3BO8B 2R1XA 3FO0H 4Q9RH 1S3KL 4DVRH 2Y07L 5C6PB 3PWUB 4NNYB 3V0VB 2WBWB 1FYTA 3QUZB 3Q3GA 2QQLH 1XGQA 3FB6B 4XVTL 2DBJA 2YWZA 2IFFL 1MELA 2FNBA 3R1GL 2Y4SA 1F90L 3HZKB 3C2AH 1ED3A 3TT1L 1MCPL 4FP8H 5IW1A 1AO7E 3HPLB 4HIJB 4N5UA 3MRLB 2H8PB 1NEZB 3HFMH 5SWSD 1I8MB 3PL6C 1MLBB 1ZK9A 2QSTA 4YDVB 2YD8A 5IMLB 4NKOA 3V6OC 5E6YA 4FQXC 1ZWIA 5JO5B 15C8L 1J8HE 4LDEB 5EIIB 4LF3B 2NY5C 3QQ3B 4MJ6A 3QQ4A 3PGCA 2X4TB 3IAGC 2KBGA 5F6IC 1OAXH 4FXGB 1JF1A 2AVGA 3S34L 5J13C 2EH8H 1C12A 3LQZB 2CUIA 3BE1H 4IOFD 1P5UA 3PABB 3PP3K 4P3DB 4Z7UA 3DUHA 4GUPA 5F1IA 5HDLA 3KPSA 3TZVC 1UKSA 4XVSL 4DKFH 4PJ9A 1JRHH 5IMOA 5TQ0H 5JLZA 2OM5A 3LKNA 4NKMA 2MHAA 1IC5L 2Q7YB 1O5DT 4K7FA 2R8SL 2IGFH 3T2NL 3F8UB 5AUMB 2XN9D 4P5TC 4NUGL 4ESKA 4X80L 1RMFL 2NW2B 4NQCA 3PUCA 3SCMD 3TNMB 1F13A 5F8RC 4Y7MA 1E4XH 2D4FA 2VC2H 1UB6B 1DN0A 3RWIA 1RURH 1F6AB 5KVFH 4YZFE 1BVLA 3OPZL 3UTPD 1U9KA 2A38A 3RKDD 3KLHC 1NQBA 2MCG1 1M6OA 2PXYD 5DJ8B 1QSFE 4RGNB 5I8KL 4OZHF 1NGQH 1D5XB 3L7FB 1OGAB 2HFEB 2C3WA 2ARJQ 3RWHA 4U6VL 1UM4H 3PV6A 4XVJL 1DQLL 2DYPB 3PDOA 4P99A 2AERT 4OFYA 3FQNA 2ZCKL 3HRZB 2QHRL 5DGQA 3NACL 3SDDC 2FZ3A 1XZ0A 4FZEL 4I0PC 1QRKA 8FABB 1NFDB 3WDIA 5CJQL 3HC0B 4PJGA 1H3WM 3ULSA 3HR5A 4U1LA 5CZXD 2LVEA 5L2KA 2FEDC 3LQAH 5I30L 1JHKH 2JB6B 3DGCR 3EO9L 4GAJL 1QLRA 3LKQB 4HZLA 3VFSB 1IE5A 2VE6B 3C60C 4KWUA 4QHMB 1QP1A 1DQMH 3PWNA 4ZYKA 3NA4A 3CVHH 3BESR 2FEEL 5J1SC 3VXSD 3WHXA 2IH1A 4X6DF 2BNUB 1VEMA 5EU6D 4JY5L 5KN5B 1BFSA 2ZUXA 4YIQB 3BQUB 4GRMB 4ZSOB 3B9EA 5DJ0A 1FGVL 4AEFA 1GHFL 2P5WE 3VD4A 3RWJB 4FQQB 5E08L 1KOAA 4JANA 4AG4H 3NA9H 4MS8D 1CDGA 3FQXA 3KXFA 4NKDA 1T0MB 4ZUVA 3BGAA 3DETC 4XXCA 4AZ8A 4Y5YC 1TXKA 4NQXA 4LPTA 1E6OH 1MIMH 3ZE0F 1H3PL 2FATH 1A6PA 2HG5B 2YKLH 3T3PF 3ZHLA 2I25N 1DBJL 2GJJA 2E6PA 1OTTD 4YDLC 3DMMC 3WS6C 4PJCF 1Z3GL 2VITB 3ZLQC 4XXDA 3WIFB 3KPQB 4KRMB 1A7BA 1V05A 3S35X 1AI1L 4LARL 4N8VG 5FYKE 4N8VA 4G80B 4LSQL 1I3GH 3GBLA 2A0LC 2VXQL 2VDPL 2H32A 5HYEA 4QRSB 4X7DC 5DFVD 3ILPA 1MWAA 3B2VH 4YGAB 1F3DH 2GY5A 4KJYB 4OLEA 4W68A 1JTTA 3MV7B 3IS0X 5DD3H 3D39D 5C0BE 1FG2A 4CRPA 4OZIA 2OJZL 5FYKH 3PL6B 1KENH 2BRRH 3T0EA 2P7TA 5EUOE 2Y72A 4FQXB 5C70A 2HKHH 5HHPB 2IAMA 3VDAA 5I1JH 2PO6C 1VESA 2DJ4A 1FFPB 2NY7L 4X6FA 5E2VL 5H37H 2LU4A 4PGJA 5F6IB 1JGDB 1MQKH 4M6OH 4NQDB 5JNYB 1XCQA 1FNGB 2FHCA 1ORSB 4YXKL 5C09A 4BQCA 5J13B 3VRJA 5D1ZA 4MNQA 4UOW0 5EBMB 4G8IB 4KHXH 4P5MB 1BQUA 1GRWA 3EO1B 4KVCL 2A9NH 1LEGA 4U1JB 3TZVB 1CFSA 1N5AA 1UC6A 4HS6A 2OLDA 5LKNA 3BO8A 4G6AD 3LN4B 4MVBD 2KKQA 3PWUA 4NNYA 1OWWA 3V0VA 3QEGH 3PDGA 3QUZA 2D03L 2AK4E 3WJJC 5GGQL 5EZJB 3FB6A 3UTQB 1OCWH 4KRNA 1T5WB 1NAKL 4P5TB 4RWYH 2ZJSH 4OLVL 4ZD3H 1INEL 2A77H 3HZKA 3O81A 3O3UN 2V9RA 4XB7A 4O00A 1E4KC 1OT1A 2OTUB 4GMTH 1MH5B 4HIJA 1HN1A 3HPLA 1NEZG 2H8PA 3MRLA 4NWUH 1NEZA 3CUPB 4UBDC 4X5XB 5TH2B 4CKVX 1I8MA 1C1EL 4YDVA 1MLBA 4P2QD 1CD1B 1ZLWK 3IDMB 1X4XA 5IMLA 4XNUH 4QF1B 1OAKL 5JO5A 5F7UA 3SE4C 4OCXH 3A67H 43C9B 3ZDYE 4OLWL 5EIIA 4LF3A 4P9ML 1GZPB 3QQ3A 3ZZ1A 2ED8A 2X4TA 4PRAB 4FXGA 3L1OL 5JUEL 3SDDB 4WFGE 4I0PB 4LGRB 3LQZA 3PP3H 5JMRA 3OB8A 1FNEB 3PABA 4P3DA 3MJ7B 3V0WL 5GRUL 5HJ3B 2ORBH 3C60B 2Q8AL 1J18A 1NBQA 4U3HA 4C4KT 4WEMB 4G5ZH 3KYKL 5DR5L 3RZWA 4DUXA 2Q7YA 3OSKA 1KSRA 5IW3A 4PRIB 4BM7A 1NAML 5FUZH 1A02N 5AUMA 1U3ZA 2NW2A 3X11B 1U41A 3CMGA 4PJHB 3TNMA 3WHE1 3TYGH 2PN5A 3QO0B 1CK0H 4POZC 1UB6A 5F8QC 1F6AA 1ZTXL 3NIDF 1K3ZA 3A6BL 5D4QA 3ZYJA 4MQSB 2JCCE 1R0AH 5DJ8A 3GK8H 3L7FA 1D5XA 1OGAA 2HFEA 3F6IA 3OAUL 4Y5YB 1KB5B 3NIFF 4JCMA 1I9JL 2DYPA 3MRQB 1MFDH 3ZDZE 3CK0L 3HRZA 4I0CC 5HPOA 4PJDE 1PZUB 2WWMC 2R2CA 3VGBA 8FABA 1JPGB 5BS0E 1NFDA 3DXAE 3HC0A 3UDWC 1HWHB 1NCDH 2APTA 3EYSL 5HDQH 3CFBB 4YDLB 3DMMB 2H45A 2DLGA 5D7IF 1LILA 3RX5A 2JB6A 1ZGLM 3VXRE 1IQWL 3LKQA 4IRSD 3VFSA 2VE6A 2FGWL 4QHMA 5ADOL 3FMGH 3OBAA 2EYTB 5C0AB 2D2OA 1JYWA 2E5EA 2R0KH 3RTQC 4UI2A 2BNUA 2BSED 2YA1A 1CLYL 1P9MC 4LLUB 5KN5A 3MA9H 4YIQA 3WNKA 1G9MH 3BQUA 3GJFB 4FXKB 4GRMA 4XNYH 4ZSOA 1CXIA 3NIGF 3VXMB 4DN3H 3PGFL 2YPVL 1KBGL 1UYWL 3GI9L 2D7TL 1HZHH 1V3KA 3RWJA 1LO2L 3LS4L 4PJ7A 3VA6A 2YMXH 4FQQA 4FQCL 2BC4B 1T0MA 3LQMA 4X5WB 3TJHD 1M7IB 4RAHA 2YHGA 2PO6B 1S7SB 4X9IA 3B43A 4L3EB 4QHLB 3GZKA 5CSZB 5DK0B 4ZO8A 3UTTD 4NQVB 2NYYC 1CS6A 2HG5A 1T7VA 1IGYB 2R69L 3MNWB 3W9DB 5I16B 1QKZL 5I18H 2VITA 4R0LC 5HVGB 3WIFA 3KPQA 4U1NB 1BMGA 2BNRD 4XP4H 5FM4A 1F4YH 4K3DH 4YO0B 4G80A 3T3MF 4UT9H 3ZL4H 3FOMB 4JHWL 2IQAB 5E9DB 5L88H 3RDTC 1TZIB 3EIFA 4QRSA 4V1DB 1X5IA 3ZKQD 5GGRB 1G7PB 5DA0B 2E9BA 1GVIA 1M71B 4XWOC 4KJYA 4MHHI 5ISZD 1J1OL 4X83A 1HYRC 3MV7A 2DQGH 2LVCA 1Q72H 4E41D 3ROOB 5KZCB 4PJAB 3TVMC 3PL6A 4ZOBA 5E2JA 4D9QD 4QXWA 3V6OA 2B8OT 1TNNA 4FQXA 5CEXB 5HHPA 3WNNA 1GGBH 3T08A 1FFPA 4U6YA 5BOPA 3NFNB 4NC1E 4NJ9L 4RCAA 5HBBA 1K2DB 1JGDA 4NQDA 5JNYA 5E8DL 1FNGA 4KRLB 1ORSA 5I73B 4WI5A 3EBAA 2KZ1B 4GS7C 5EBMA 4GW5B 3ZKNC 4G8IA 2ZP0T 4P5MA 4RA3A 3RBGA 5A2KH 1MF2L 4HIEB 3ZTNL 3EO1A 5K59E 4FQIL 5DUPH 2VXVL 4JRYD 4U1JA 3TZVA 1JZ3A 4GBXD 3QUML 5DD0H 1CZ8L 2IPTL 1NGPH 3LN4A 2NY2D 3CSPA 1WWCA 4DUVA 4AK1A 3BZDA 5EZJA 5EC1B 3UTQA 3U7YL 2ZCHH 2CXGA 2Y5TB 3SN6N 4P5TA 4Y4HD 2MOVA 2XT1B 3INUL 2FEEI 1F00I 1TQCC 2OTUA 1KIQB 4QOKE 2NY4C 4R8WL 1MH5A 4HXBL 4N9OB 5TH2A 4KMLB 4OZGE 3CUPA 3QFDB 4X5XA 5INCB 1ZLWH 2MKLC 3ULVE 5KSBE 1N6UA 2EE2A 2MPAL 4AEIL 3ETBF 1CD1A 1YNLH 1H8SA 3IDMA 4JFZH 4BQ8A 4YHOH 1MOEA 4QF1A 2VLJE 1JGVL 3TO2B 1V3LA 1TZGL 4U7MA 43C9A 3ARPA 32C2B 1GZPA 2B0SL 2BY0A 4LAJH 4PRAA 3PQYD 1MRFL 3W0WE 3SDDA 4I0PA 2HKFL 4PJFB 2WBJD 2BXYA 1FNEA 1KCLA 3ULVH 5I1IH 4K3GA 2R56H 3MJ7A 1UM6L 2Y1VA 3Q5OA 1HXMB 2F53D 3QIBD 4KVNH 5HJ3A 1S3KH 1I75A 3C60A 3I6KB 3ZT7A 4BQ6A 2K7QA 4XMLL 5EOQL 5E5MB 3RTQB 4PRIA 1A6AB 3P4LA 3QDJB 4L1HA 3SDCC 3X11A 4JN1L 1A1OB 1IZKA 4PJHA 5DWUL 3QO0A 1BD2B 3D85D 5GS3A 1BJMA 2E8YA 4HXAL 4U1HB 2PTVA 4FA8A 5CKAA 2ESVD 4BQ9A 1TTGA 4OKVB 1QZ1A 5D71L 2FJFB 15C8H 4L9LC 4KZDL 4Y5YA 3G6DH 1KB5A 2X1XR 5D7LE 3MUY1 3HE6D 3MRQA 2DLTA 5D6DC 5I17B 1JPGA 1M1SA 4WUUB 3VA2C 1PEWA 1Q38A 1MCJA 4LSUL 4DFIA 4H1LH 3CFBA 3KLAB 3DMMA 3WS6A 2X40A 4R0LB 2QLVB 1WIUA 2BCKB 4JFEB 3S98A 1KGCE 1MCHA 4FMKA 2GTWB 1JNNH 2EYTA 5C0AA 3SGEI 1VPOL 2R8SH 2FYYB 1ZVHA 3T2NH 1YEEL 3RDTB 2AJ3B 2CRMA 2X5PA 1BLNB 4LLUA 5IB4B 4FRWA 4KI1A 3GJFA 4FXKA 1JFQL 5C3TA 2GQHA 3G5ZB 4HPOH 3QDMD 3VXMA 1KULA 4I13B 4MQTB 4S1RL 2X42A 4JFQB 4JRXD 7CGTA 4OI8A 3TVMB 5IQ7L 2BC4A 4QXUL 4X5WA 1M7IA 1ORQB 2PO6A 4N0UE 1S7SA 1DQLH 4XVJH 1T66D 4L3EA 1UWXK 4EN3C 2QHRH 4QHLA 2UWEF 1YY9D 5CSZA 5DK0A 4KGLA 3AAZB 4NQVA 1G7QB 4NO3B 4X6EB 2JB5H 1EGJH 1IGYA 1AR1D 3MNWA 3RJDA 3W9DA 5I16A 5F1KC 4FNLH 5I30H 3D6GA 3MLYL 3MROB 2ADFL 3IFOB 1F45A 4U1NA 5C0RL 2W1NA 3TJEL 5KJRH 5B4MD 4YO0A 4MJ5B 1IGFH 1QFUH 3WJJA 4JR9L 4POUB 3FOMA 1XR8B 3EYOB 2IQAA 3MRGB 5E9DA 1TZIA 4GRWE 1UH3A 4V1DA 4WV1C 2I26N 3RWEB 5GGRA 1G7PA 1M71A 4R4NC 1GHFH 1E4KA 1TQCB 1EFXD 4KRPD 4WU7B 5EA0L 2NY4B 3HE7C 4KK9C 2R1WB 3ROOA 5E08H 4PJAA 2DJSA 4Z7NF 3WBDA 5CEXA 2DI7A 4UDTB 5GZOC 4GRWH 3SE4A 5HHMB 3K8MA 4I1NB 3NFNA 5CKGA 1MCRA 1K2DA 1MHPL 2H2SC 1I3RB 5SWQB 2NX5B 3SDXE 2VTFA 4GW5A 1A6WL 5E2UL 1IC7L 4HIEA 3WFEH 4D3CL 2PYEB 1S9XB 2RHEA 4D8PB 1AI1H 5IEHB 5CD5D 2QBWA 3WN5C 1T1XB 3A6CH 1UXWB 1QOKA 3AVEA 4PJ8C 1PSKL 2Y5TA 3WIIL 2V17H 3BN9D 3SDCB 5E4EC 3W5MA 3OJ2C 4M1GL 3NFPB 1S7TB 3X17A 4EXPX 5HI4D 3C09C 3ZDXF 1KIQA 2DQEH 2OJZH 3QFDA 4OD1L 5INCA 4OAWB 2IPUK 3EJYC 3WUZA 5CZVH 1HH6B 3SY0B 1B0RB 4K23L 4N8CL 4PJBB 3BWAB 1HWGB 3DUUB 1NCUA 3ESUF 3QUYD 4L9LB 3TO2A 2NY7H 5T3XE 4PS4L 5JHLH 4FMFA 32C2A 1SY6H 3VFVB 4F3FB 2XQBL 4YXKH 2DN7A 1GXEA 4UMGA 2EH7H 3SE9L 4XP5L 3GMLB 3IDIB 4PJFA 2CJUL 3WXVL 3UDWA 2YPLD 3ARQA 3SGEH 3H7LA 1YPZB 5JW3L 4LSTL 3HG1E 5IP4A 1FYHB 1HXMA 3ALPA 2EDWA 2QEJA 3TF7C 3KVQA 5T3XH 2DS4A 3I6KA 3HZVB 3HN3A 4FG6C 4S1QL 3WKML 5E5MA 3RTQA 4CJ0A 1A6AA 1Q9WB 2V5YA 3SQOL 1P9MA 5IVOA 3QDJA 4OLVH 1D5MB 5GGTA 5HHNB 5HGBB 1I85C 4M93C 3ELAT 3FQWB 1A1OA 4GXVL 1IGCL 3MOQA 1BD2A 1MNUH 5AZEL 4M6ML 4BYHA 4PY8I 4U1HA 1OLLA 3H6JA 5L8LB 1C1EH 1SVZA 3NOIA 2F8VA 1DLFH 3LKOB 4OKVA 4IIQC 4MXWL 1PEZA 2J88H 5D2LB 4MA8H 35C8H 2FJFA 1T0PB 4XWGH 1XR9B 4UILH 4EN3B 3UPCA 5I17A 4WUUA 5IEKB 3MJ6A 2VN4A 1NEUA 2GHWB 3KLAA 1KTDB 4S1DD 6FABL 4CU6A 1MI5B 4R0LA 2BCKA 2CGRL 4JFEA 1XIWA 2XXMB 2OK0L 1QSEB 4Z7WF 2GTWA 5DR5H 5BVPL 3FAWA 4LSSH 2FYYA 1NAMH 3EYUH 2GCYB 3RDTA 2AJ3A 4FOMA 1AO7B 1BLNA 5IB4A 4OFDA 2X4OB 2B5IC 2VUOA 3G5ZA 4I3RH 5E1HB 1VGEH 3ARTA 3CX5J 2W07A 4NRZB 5DHVH 4M62H 1ZTXH 4MQXC 3A6BH 4JFQA 3HE7B 4JFFD 1FPTH 3DSFL 4MD4B 3NCYS 4HCRL 3TVMA 5BV7H 1I7UB 3VD9A 4G8FB 4NQUA 1LE9B 4AQ1B 3OAUH 3QEQE 3FJTA 5C07E 5E8NB 1ORQA 3KG5A 1OL0A 1UWXH 1I9JH 1ND0B 1HQ4B 1GGIH 3KPOB 2P8PB 3EYQD 3I6GB 3CK0H 2HAZA 2BVPB 2W38A 3RGVD 4NZRL 1GCFA 3AAZA 1G7QA 2AABL 2CMRL 3DX9B 4NO3A 4X6EA 3SJVB 1FNAA 3ILQD 2IALB 2OR9L 4HS8L 2B20A 5LVEA 1IQWH 3MROA 9CGTA 3I3EA 5JPNB 1U8LB 3IFOA 2FGWH 3WN5B 4XTRD 4AIXA 5HXMA 4ZUTB 1LDPL 4MJ5A 3WFDH 1W72L 2F54D 2W60B 4B50A 5LBSL 4PJ8B 1XR8A 3EYOA 4MXVF 3I9GH 3MRGA 4G8GD 4JFDD 5D1QC 2HRPL 3UXFA 4RMUA 4MA7H 3T77B 3RWEA 5E4EB 3GRWH 3PGFH 4J3TA 3TGXA 3U0TB 3GI9H 5IFHL 1G9NL 1U91B 4NNPL 4WU7A 3C09B 4H8WL 2D7TH 5JPMB 1YYML 4XT1C 4BKLB 4L1DA 1LO2H 3BD4A 3BKCH 2R1WA 3MV8B 1FL5B 2Q8BH 4P9HH 3FFCD 1BBDL 1CFVL 4OZHE 1WBXB 5HHOE 4UDTA 4YUEH 1AGEB 3V52H 1CFBA 1LMKA 3RU8L 3LMJL 1I3RA 4YFDB 1PKQE 5SWQA 2NX5A 5FHAH 1RVFH 3UC0L 3L3HB 4WW1B 4XMKL 2R69H 4V2CB 5IMMB 1F4WL 3KHQA 2PYEA 1SBSL 1JN6B 1S9XA 2X4UB 4D8PA 3TPUB 5IEHA 5FDWB 2BHZA 1ZVSB 3OL2A 1T1XA 5LGHL 1MRCL 1UXWA 5H35B 1KG0B 2M1KA 3PF2A 3EJZC 5DD1H 5DSCB 1WK0A 1IGIL 2RB8A 4QRRD 4X6DE 2HTLD 3QB7C 1GGUA 2R2BB 4PB9L 3SDCA 4NZUH 5I74C 4M93B 1Z9OA 4TTDD 4DTGH 3FB7B 3NFPA 1S7TA 4FZ8L 2CO7B 4GQPH 4M1CC 4EQ2A 1T83C 3BP7B 4KJWD 1SJEB 1WLHA 3UPRB 5HI5D 4OAWA 1ZHBB 1HH6A 3SY0A 4IIQB 1B0RA 4GAGL 4PJBA 3BWAA 3CH8A 4L9LA 3QG7L 2Q3ZA 3WDJA 4DCQB 4NJ9H 1L4IA 4IJ3C 1FO0L 3D48R 3VFVA 4F3FA 4Q9QH 2J12B 4FFYH 4AQOA 5GGSY 3P9MB 3PIQB 5A3IC 5D6DA 3MO1B 3GMLA 1FH5L 3IDIA 3ZE0E 4E5XB 1MF2H 3I2CH 4YXLH 1LP9B 3PWVB 4M3JA 1HNFA 2ZKHL 4XP1H 4M43L 1F58L 3T3PE 1YPZA 5E6IB 3R0MA 4OLZL 4PJCE 5IM7B 4LQ1A 1A9BB 2DQIH 5AYUL 4K07A 2IPUG 1W8NA 3HZVA 1Y18B 3U0WL 1BVKB 4J3XA 5AYQA 4XCFL 4ZTOH 4B7IA 2WINB 1Q9WA 2P47B 1MCWM 5FDYA 4JM4L 4HD9A 1YEDB 2X9XA 1JIBA 1D5MA 3SE3C 5HHNA 4YHZH 5HGBA 4IRZL 1FFQA 2B5IB 4JLRB 5I8EB 3FQWA 3QSKB 4OUOA 5CILL 5C86A 4WFFD 3CFJB 4R8WH 1F4HA 1EO5A 1YA5A 2HVJB 3MJ9A 1HCVA 2A6JB 4KK8C 3O4LE 3GSNH 4L4VD 1ZT1B 3LKOA 2HA1A 4G6KH 1ZLSL 5D2LA 2VDML 1P4IL 1H3UA 2OTWB 5AG9A 3CCHB 1XR9A 2VWEC 5EZOL 4DOHB 4PRNB 4EN3A 1MRFH 4P59H 3RAJL 2HMID 5JW4N 1T21B 2GJ6D 4KKAD 5IEKA 3O6FD 2XZCL 1NCWL 4QY8B 5A43C 4ZS7H 1KTDA 5JORB 1K4CB 5E8EB 1KN2H 4KHTL 1MI5A 3IRPX 3BOVA 1BEYH 5TJWK 1QSEA 2YEZB 3DLQR 4PJ9D 3QCUL 5FGBC 2NY1D 3GB7B 4XPGH 1QSZA 2ZUVA 2GCYA 3F7VB 1EUTA 1AO7A 3VW3L 3JWNC 1J0HA 3MMEB 1HCFX 1EHLL 2X4OA 4JN1H 5ICZB 3BUTA 3S35H 1MQ8A 2HT3D 4NRZA 2P5EB 3VXPB 4NKIH 4JVUA 3HE7A 4M61B 4RFNC 1EAPB 4MD4A 5C92A 3H42L 5D71H 1I7UA 1IFHL 2Z8WC 2F8XC 4YHLL 3V4UH 2GITB 4G8FA 1LE9A 3EDDA 4DKAA 2ATPB 3UTSE 5E8NA 3V7AE 2EXWD 4ODWB 1JGLL 1ND0A 3RZCC 1HQ4A 3KPOA 2P8PA 2A9MH 4OZFH 3I6GA 1ZLVK 2FH8A 5CEZD 2BVPA 1FNHA 5E5RB 1KLGB 4IEFB 3BT2L 4LSUH 3DX9A 3SJVA 1F4XL 1R3HB 1ZHLB 2IALA 1VHPA 3KYAA 2JJTC 4PRPE 1ZS8B 3MLUH 3VG9C 5JPNA 1CXKA 3EOTH 1EERB 1U8LA 1DFBL 3LRSB 3WN5A 3P4OB 2VH5L 5DVMA 4AIOA 4YBHA 3CFCL 2VXUL 1BZQK 5C0NC 4YHIB 2W60A 2N56A 4PJ8A 1U58B 5I74B 3T77A 4WY7H 3HMWL 3ARUA 2VLMD 3ULVC 1HKLH 2DKMA 3VFGL 3U0TA 1U91A 3D9AL 5FFLA 5JPMA 3IRZA 4KUZH 5I66B 4BZYA 4BKLA 5INDB 2A6IB 1K5NB 4CW1B 3NIDE 2B2XL 1XGYL 1DQTA 3MV8A 1FL5A 2DLIA 2R0ZL 3O6LH 4HWEL 5JHDB 5F7NC 1WBXA 1AGEA 1G0DA 4L3AA 4IJ3B 4W4NA 4H0GA 2H9GB 1VACB 1QA9B 3NIFE 2J2ZA 3BP6B 4HQQL 4RMTA 1B2WL 5F89B 3VXRB 1I8IB 1U8QB 3O2DL 3L3HA 4WW1A 3J7HA 5IMMA 1YJDH 3MLYH 1RZFH 3MQIA 1FVCB 1JN6A 3O6KL 4ISVB 3VGGA 5D7IE 5J3HD 2X4UA 4IOSD 3TPUA 5FDWA 1ZVSA 1U3HD 4CU8A 4PRHB 5H35A 1KG0A 4JFHD 5F9JB 3OHXB 3PNWB 1L7TH 4N1HB 1CGUA 5DSCA 4ZXBD 2R2BA 4MJIE 5IFAH 1I85A 1TPXC 4NSKB 2X89A 1J0ZA 3S37X 3NVQA 1IEAB 3FB7A 1N6QL 3NIGE 2F58L 4JO4L 4HUUB 4UDUB 4U0RC 1A64A 3BP7A 1SJEA 3TWCH 4QRPD 3UPRA 2Q87A 4JFYB 3R06B 4CN4A 3SO5A 1ZHBA 4IIQA 5I1EH 2DM4A 3VD5A 3L3IB 4KUCD 3HZMB 2DQCL 5B38B 3QUXC 4DCQA 3CXHK 1NCNA 3HNTH 1S5IL 3O3DB 2IAMD 3PHSA 3OJDB 4PPTA 1MHPH 3D87B 3P9MA 3PIQA 3QHZL 4RMVA 3MO1A 1A6WH 3EFFB 5E1AB 4RFOL 3C6LD 4E5XA 5JA8B 1IQDB 4MNQD 1LP9A 3IFPB 3PWVA 4D3CH 2YK1L 5DZLA 5E6IA 2P46B 5FECB 5IM7A 3JV4B 1NMAH 1X5LA 1A9BA 1HHGB 2DD8L 4P4RB 5I6XC 2BP3A 1Y18A 3EFDL 4ONOA 1BVKA 2EDNA 1PVHA 3X3GL 2DQJL 3T3ME 2WINA 4OSUL 2P8MB 5FYKD 5JQ6H 1PSKH 3U4BH 3QUZD 1YEDA 3D3VD 4FQ1H 2HH0L 3JWOL 4JLRA 3FQRB 5I8EA 5TE4L 4FFVD 4XBEL 4P2RE 4K9EL 4R90H 1A6UH 4URTB 5GRJH 5HI3D 3P2TA 3CFJA 4HC1H 3FN0H 5I1DB 4P4KC 2W0LA 4RFNB 2HVJA 3LKSB 2FB4H 2A6JA 4KY1H 1ZT1A 4I77L 4YHPB 5C0BD 3UJJH 2OL3L 4FQLH 4UNUA 8CGTA 2OTWA 1MCWW 3K4AA 1EJOL 3VFPB 3CCHA 5F96L 3RZCB 5EN2B 4PRNA 5M94B 5AWNL 3F62A 4Y1AE 1R5WA 2ZG3A 4C83B 1T21A 5IVXF 5TE6L 3TBWB 4XP9L 1EHNA 1PDKA 4QY8A 3RVUC 1MCLA 1DN2A 3OJMB 4U1MB 5JORA 1K4CA 5E8EA 5JW3H 5GSVB 5DUBB 1A3RL 1B4JL 2HLFC 3VG9B 5JXEC 3MV9B 2A83B 2ATKB 5SWZE 4UU9B 4ZUSB 2YEZA 2P4AB 5EIVA 4O9HH 3WKMH 3QFJB 4OIBA 1QFWL 1KPRB 3GB7A 4MJ4A 4Q97A 4LLWB 4R9HA 3Q5YA 4IRJC 2EEDA 3F7VA 2AK4D 2LE9A 4OZGB 3MMEA 4QCIB 3SHSA 3GM8A 3L3DB 4GXVH 5K9QI 1S9WB 5ICZA 5AZEH 4Y4KC 3KPMB 2P5EA 2V7HB 3VXPA 4AY0A 4O5LL 1ZKAA 4M61A 3VFNB 1J1XL 1EAPA 4HPYH 3GSQB 1AJ7L 2GITA 3W0WB 2ATPA 1QBLL 1UWGL 4ODWA 2HT4D 4JFXB 4LPXA 5E5UB 1ZLVH 4FQ2H 3VXUE 3D1MC 4S0TD 4KQ3L 1UKTA 1KLGA 5ESVB 3T8XB 5E6ZA 2DDQL 3G9VA 3GEWB 5CGYC 5ITBH 1R3HA 1ZHLA 1WJ3A 1OAQL 1ZS8A 4I9WE 2HTKD 1OAYL 1J11A 1GSMA 4LU5L 1A9EB 5DRXB 3MOAL 5D8JH 3SBWA 4KAQH 1KEML 3LRSA 5BVPH 4M5YL 3P4OA 1KCVH 1QTYT 4U4BA 1V7MH 3Q6FB 4NFCA 4YHIA 5LG1A 4OCLC 4YE4L 4N1EA 1EHXA 3WD5H 1SYSB 1TPXB 4HLJA 3O11B 5KSUB 1DBBL 4H1LB 5F3BB 4ODTL 4U0RB 4G3YH 1T83A 5I66A 5KSAC 5E99H 3DSFH 1P7QD 5INDA 1KFAL 2A6IA 2QADD 5DD5H 1K5NA 4HCRH 5CJOL 4CW1A 4I8DA 4F58L 4LBEB 3AS2A 4B41A 1BQLL 2VZSA 1KPUB 1ZAGA 4LAQH 4RA0C 4NJAH 5I1CH 5JHDA 4TQEL 3QUXB 1T7WA 4PP1D 1TTUA 4GQ9H 4RFEB 4ODHL 2ICWJ 2H9GA 1VACA 1MAMH 1QA9A 1DJSA 3UYRH 1OWRM 4JGMA 1RK1B 3CDCA 5J57B 3BP6A 2FWOB 4UQ3B 5T3ZE 5F89A 3VXRA 4Z78B 5I1KL 2AABH 1I8IA 1U8QA 2NY3D 3QCVH 5EOCJ 1AD0B 1FDLL 3PP4L 5I9QC 3G5VB 3BKJL 3RWGB 5JZ7C 3MYZA 2R29L 3MXVL 1FVCA 3JVGC 1MJ7H 3LRHA 4ISVA 2C5DC 1F8TH 1I9IH 4OF6A 5I6XB 3B6SB 4LVEA 5ANMB 4F9LC 1D3CA 2P48B 1IJ9A 1LDPH 3IDYC 4YBQD 4MNHB 2Y06L 5IVZB 1J05B 5JIHA 4NBYB 4PRHA 1W72H 3V8CA 2W0KA 4OCSL 5F9JA 1IM9B 1CGYA 3OHXA 5LBSH 3MLZL 4Y19B 5T3ZH 3PNWA 1AFVL 1KJ3H 2HRPH 2Z0BA 1Q0YH 4GMSH 4NSKA 4YEFA 4TVSa 3K8LA 5IFHH 3SDAB 4N5ED 1IEAA 2BY1A 2EC9T 3Q6GL 2LAGB 4HUUA 4UDUA 2CLRB 4P4KB 4ZAKC 2FJGB 4N0UB 4JFYA 4UAOC 3R06A 4YH6A 3RWFB 3L3IA 5ILTL 2VDLL 1UCTA 5B38G 3HZMA 5B38A 3OAZK 5JXAH 4FQXD 1D7FA 3O3DA 3OJDA 3RU8H 5FGSA 1NDMB 2CUMA 1CD8A 1A21A 5DQDH 2EXYD 2UWEE 4XHJD 3EFFA 5E1AA 1IQDA 1UWEL 1CDIA 4ODUB 3IFPA 5MEPB 3W9EB 1ETZB 1F4WH 2GUOB 4Z8FL 3WEXB 1SBSH 4RAVB 3CVIL 3TFKD 5FECA 5A1AA 3JV4A 3MCKB 5SWSE 1HHGA 2CIIB 5GISL 5I15H 4P4RA 1G9EA 2AEPL 5KVEH 3OZ9L 1DVFC 5FGBA 1RK0B 1YYLL 3DROB 3HC3H 4G7YH 4IRJB 2P8MA 1VEOA 1FSKC 3TBTB 3DV6B 1N26A 1CXHA 1Q0XL 4JQVC 3FQRA 4RDQG 4XMPH 3B83A 2WIIB 4Y4KB 5ABDE 5I1DA 4M00A 1D5ZB 1NLBH 2OX5A 4NFDA 3LKSA 3JXAA 5LCVL 4GAGH 4YHPA 3GSVB 4HUNB 1QG3A 3MBXH 4Z7NE 1U95B 3SDXB 2R0WL 4P2YA 3VFPA 4WWKD 3RZCA 3G08B 5EN2A 1HYSD 3GO1H 2BX5A 3RRQA 2GEEA 4ONFL 4UIKH 3C9NB 4C83A 1FH5H 3RHWF 3TBWA 3ARBD 3RQ3A 4ALAL 1J8KA 1F3DJ 3SDDD 3N1GC 4JEGB 1S5HB 3HAEH 5JOPD 5KAQF 2ZKHH 3DBXB 4L8DB 2P44B 4U1MA 5B3NA 2JJTA 5GSVA 2BVEA 5DUBA 2GIYA 1I8LC 4JGUA 3MV9A 3UTPE 4KJQC 3WYRA 2A83A 2ATKA 2Z9TA 4BSJA 4UU9A 4ZUSA 1GYAA 1UCBL 4ZFGH 2Y36H 3DYOA 3B9AA 3QFJA 4I2XE 1KPRA 4LLWA 4NO2B 5A2FA 1EUUA 2YN3A 1L7IH 4O02H 4OZGA 4IRZH 3PHQB 4QCIA 3L3DA 3V4PH 1S9WA 3MRMB 2ITCB 1MJJB 5CILH 5TDOB 3KPMA 2V7HA 4ELMF 2MSPA 5KSAB 1QR1B 2DMBA 3ZDXE 5D96C 5FHBL 3VFNA 2BJML 4QOKD 1KJ2L 3GSQA 1MVUB 3CH1B 4WHYG 1HSBB 3SGDH 3W0WA 1KELH 2D0GA 4MDIB 3S37L 4JFXA 3VXSE 1NMCC 2XZZA 4Y2DC 5EU6E 1OPGL 3LN9A 1TJGL 1WAAA 1MRDL 4JJ5B 5ESVA 3T8XA 5I9QB 2AKRB 1WZ1L 3OKKB 3OKLB 2EDYA 2YXMA 1N64H 1K8DB 2BSSB 1DTUA 1JK8B 4LCUB 4M7KL 2L7JA 4LEXL 4KKBC 1QHOA 5TE7L 1A9EA 5DRXA 4NFBA 1U8IB 5IT2L 3IDYB 3N1MC 1S9KC 3Q6FA 5E70A 2Y23A 4IS6B 5C0AD 3VFRB 1JZ8A 2XKUA 3P4MB 2A0LD 1EHLH 1SYSA 5KSUA 3O11A 2APBA 3K0WA 3S97C 4H1LA 5EWIH 3U83A 5F3BA 4ZTPH 1YQ2A 3RP1A 3IFLH 5AD0B 3VXMD 4ZAKB 1C16B 2Z31C 4Y8DC 1WGOA 4UAOB 1XF1A 4OQTH 4LBEA 1IFHH 4O2FB 4YHLH 4DN4H 1KPUA 1JNLL 2VXTL 1E4WH 1KCSL 1QRNB 1U8OB 3ARFD 3QUXA 1YMMB 1IT9L 4LSPL 4CDGC 4RFEA 2GFBB 2X1OA 4CDHA 3ZSSA 2XTJC 1FE8H 1RK1A 4HUVB 2E7HA 2FWOA 4UQ3A 3Q1SH 4G9FB 4L3ED 4XPHL 1AXTH 1R3IL 4Z78A 1GPOL 1MFNA 1AD0A 2E3VA 3G5VA 3RWGA 4AIZB 5DJAB 3HCVB 4C56B 4ZO6A 3ULUF 4R26L 3D39E 1FV1B 1B6UA 1DFBH 4JVPA 3B6SA 5ANMA 4R6UA 4OM0L 4BH8B 4XVUC 1DVFB 1KGCD 4FTVB 4HJ0C 2VXUH 4MNHA 1J05A 4Z7WE 5IVZA 5EB9A 1IM9A 4Y19A 1HINH 1FORL 1I9RH 4UT6L 1FSKB 5F72S 1RIHL 3TA3C 4FFZL 4Z6AT 4ZDHB 2XQYK 5CIPB 4F7TB 2JJSC 3VFGH 4N0CD 2YRZA 3SDAA 4BQBA 3MUHL 1QFWI 4FQJH 1F02I 3QEQB 2CLRA 4P4KA 1PW3A 4Y5XC 2FJGA 4N0UA 5LGJB 3ARED 4P2OD 4Z7UF 3C5JB 3OKDB 2DICA 2ENYA 5KZCD 4HWEH 2VABB 3MBED 1IGMH 1MAJA 1EZVY 1IAIL 4LHJB 4TNVF 4BZ2H 1BP3B 4HQQH 4Y4FD 5DDHB 2COQA 1NDMA 1O7SA 2V9QA 1B2WH 4JHBA 3O2DH 5EO0B 4HIIB 1UG9A 3ARZA 3SE8H 4ODUA 3W9EA 4LASL 5MEPA 1ETZA 3RUGB 1BFOB 2GUOA 3WEXA 4RAVA 3O6KH 1A6VH 2AJSL 4H20L 5JXEA 1JZ4A 1V3MA 1B90A 3MCKA 2O26U 3KS0H 2CIIA 1T6VN 4P2QE 1XF4B 4OFIA 2WW8A 1RK0A 1CGSH 5D93C 3D18B 3S88L 3DROA 1W0VB 1OTUC 4IRJA 2V2XB 3TBTA 1WWWX 4MXVE 3DV6A 2EDXA 1GZQB 3QPXL 5FKPB 4JO4H 2WIIA 4JQXC 4Y4KA 3QWQB 4LLQB 4KK6C 2NNAB 3T4YB 5D96B 1D5ZA 4PJGF 3QQNA 5FUCC 1RPQA 5C7XL 5F70A 3IF1B 4X7TB 1BIIB 4OGYL 3HC4H 3GSVA 3H9SD 4QGTA 5J7CC 1U95A 3SDXA 2DQCH 1YEHL 4Z0BL 4GXUN 5DO2D 1S5IH 4XPBH 3MXWH 3G08A 1NMCB 5T33H 4GSDL 5BO1H 1WWBX 4X9HA 4ZNCD 4Y2DB 1MFBH 1GC1H 4RFOH 4OI7A 2ZPKL 4TUOB 1S5HA 3MRRB 1BJ8A 3PXHA 4WO4D 3DBXA 4L8DA 3ORJA 4M6NL 1YC8A 3B8YA 2IWGA 1XGRB 3T0AA 5IB1B 4I3SL 3CDFA 1G1CA 2OXGA 3DIFB 4XHQA 2R15A 1KC5L 1LDSA 3MRPB 2A1WH 2HN7B 2VSCA 3EZ8A 2DQJH 1CQYA 2KL6A 3PG2A 5D7KE 4NHCL 4NO2A 3UBXI 1TITA 3RTQD 2HH0H 5DFTA 3N85H 4YXHL 3PHQA 1CXLA 1SYVA 3MRMA 2ITCA 1MJJA 5TDOA 1G7JB 3D0LB 3QUMB 2QQKH 5KSAA 1QR1A 1MFAL 2I27N 2Z31B 5CINH 1BD2D 2IPKB 3O9WC 2CH8A 4CJ1A 1T2JA 4PGBB 1I1AC 4K8RH 1MVUA 4BJLA 3CH1A 1AGDB 1HSBA 3PWJB 3LH2H 1EJOH 4MDIA 4MNGE 4EOWH 4HMEA 5ACMA 2XTJB 3ARXA 1JI1A 2Y9RT 2XWBB 1YEGH 3CXDH 3B5TA 1WEJL 2BK8A 4JJ5A 1OOAA 4PLNC 5KS9B 2AKRA 2YRPA 3FL7A 3OKLA 3OKKA 1K8DA 4WUUD 5F1SA 2BSSA 4YHNB 3PWPB 1JK8A 2X44D 4LCUA 4TUJB 4OLYL 3JVGA 4OZIF 5ELIA 3VRLF 4ENEC 1U8IA 4F9LA 4JFED 3S3JA 1FC1A 4R4FH 1XIWD 2DM2A 4KUCF 1VFBB 4S0SD 1C08B 5HGHB 3S36X 4IS6A 3VFRA 4HS3B 3TA3B 2NXZC 3P4MA 3ES6B 4J3VA 1TJHL 3BD3A 5DEFB 3ZKXC 4LCCC 4ZFFB 1RULL 3DI3B 3MUJA 3UTTE 2J8HA 1UVQB 4JPKH 4G6MH 5AD0A 4IMLB 4O5LH 4Y5XB 4ZAKA 5ID1B 5E24E 5F7YC 1C16A 3OKNB 1AE6L 5F7EL 4K2UL 1X5HA 4M9PA 3I84A 1ZLUK 2EC9U 4O2FA 3BAEL 2NY6C 2D4DA 1QRNA 4N9GB 1U8OA 5F97E 1CD9B 2J7LA 1YMMA 4WUKH 2GFBA 1IKFH 2IBZX 4X98B 3NH7L 4HUVA 2WIMA 4G9FA 1NC2D 2R4RH 2GTZB 2DDQH 2OJEB 1MY5A 4HUKB 4K94H 4OD3L 1BJ1H 2DL9A 3IDGB 2EECA 5DJAA 4NQEB 4AIZA 3HCVA 5LQBL 1VADB 5ISZE 4C56A 4Y5VC 5D72L 5DMGC 1FV1A 3JWDL 4E41E 4D9QE 4BH8A 3D5OF 1DVFA 4FTVA 3HI5L 5D93B 1FIGL 1RIUL 2WANA 3WCYA 2CDEB 1FFOB 4RX4A 1BFVH 3KJ6L 3ZO0A 3H3PL 3UCRA 2UYLB 3X14B 3RVVC 4ZDHA 3L5IA 4ODTH 5CIPA 4CNIB 4F7TA 2C26A 4Q6IC 3BPOC 3HNVL 3UTSB 3QEQA 4F58H 5F88A 5GZND 5IBTL 3KPRD 5LGJA 5EG6C 3C5JA 1U6AH 1ADQA 1BQLH 2DTSA 3OKDA 4JRYE 1CWVA 2CIKB 3MSPA 3SQBA 3MFFB 2VABA 1JPTL 3MLSL 4TQEH 1BGXL 1W0YT 2ADGB 3ROLB 3WIHH 1ZV5A 1DANT 1S78C 4ODHH 3MUZ1 1U8KB 3QIUC 5C07D 3CSYB 3T0DA 4JDVB 5DDHA 1F11B 4PRPB 5I76B 5KG9B 4JFPB 5CP3A 3DSNA 5IR1B 5EO0A 4HIIA 2P8LB 4W4OC 1FDLH 5FYJE 2NX5D 4KI5C 1J7VR 3RUGA 1KN4L 1BFOA 1KNOB 4KU1A 1I8LA 4LGSB 3OWEA 2OMNA 3HMXA 3U46B 1XF4A 3SKJH 1G0YR 4PJXB 3IXTB 3JZ7A 4OCSH 3D18A 1X5KA 2VDQL 1W0VA 2B4CH 1AFVH 4L4TB 4JM2C 2AP2A 1RIVH 2V2XA 4UB0H 4TOYH 5FYJH 1ZEAL 1YEIL 4JO2L 4K3JH 1ZHNB 2P24B 1GZQA 3Q6GH 5MENE 1U36A 5FKPA 1KV3A 5F7LB 3VXTB 2V5SA 4LLQA 1NFDF 2NNAA 1H3VA 3T4YA 3O9WB 4U1IB 1YN6B 4F57L 4LGPB 1JL8A 2ZUSA 3IF1A 1I1AB 4X7TA 1BIIA 1QBMH 3KHOA 2F53E 5ILTH 4Z5RB 3QJFB 4LSRL 3ME0A 5DF0A 5GIRB 5IF0B 5HHOD 4DVRL 1T04B 4Y2DA 3FO1B 3QCTH 4MSWB 3QDGD 4HWBL 2FL5B 4KMTH 4B7LA 3RBSA 4GKOA 4F7EB 4TUOA 3MRRA 3QIWC 4Z7QF 3C2AL 1XGRA 4IDLA 1BAFH 5IB1A 2EDEA 1L6XA 2EKSB 3DIFA 2ESVE 4XI5C 4PJ7F 3MRPA 2HN7A 3IJSB 3HFML 3MRHB 1Q94B 4LPUA 2XKSA 1YY8B 1DBAL 1MEXH 1MFEL 2NXZB 5I0DA 3QT2A 1Q0XH 2FO1A 1T2QH 5J8OA 3ZKXB 4LCCB 1G7JA 3D0LA 4P2CG 3QUMA 2G5BB 2Z31A 5BW7C 2IPKA 1MFCH 2EH8L 5EULV 2UUDK 2CKBH 2X9YA 2N4IA 4PGBA 2NY6B 4FABH 2OS7A 1M4KA 1AGDA 2BY2A 3PWJA 5FGCB 2R0WH 4OF3A 4YGVB 1KEGH 4DKFL 1RUPH 1AD9B 1JRHL 3WS3B 1KCKA 4ONFH 3L3GB 5CEZL 1G9NC 4H8WC 2BFVH 3TV3H 2XWBA 3V6ZB 3O8XC 3QNZB 3B2UD 2IGFL 3B4NA 5KS9A 1IAII 3QDME 4PJ5E 4YHNA 4LPWA 2ADIB 3PWPA 7FABH 4Y5VB 4TUJA 4JRXE 4LHUB 3VWKC 5EOCL 1MI5D 1EZVX 1A7RH 1RURL 5KVFL 4HGMA 5C0CD 3DWTA 1WZLA 3G6JB 1VFBA 4P2RB 3TO4C 1C08A 5HGHA 4TSCH 4PG2C 2MQ0A 4L8BB 4HS3A 2OQJB 1NGQL 3TA3A 3V6FB 3VG0H 3ES6A 4PLJD 5DEFA 5FO8B 4X7SL 1JPST 4ZFFA 2DQDL 4TRPH 4Q6IB 3BPOB 4HF5L 2UVEA 4GG6B 1UVQA 1CGVA 4IMLA 4Y5XA 5ID1A 3QRFM 1PZ5B 3OKNA 1ZLUH 3REVB 1KJ2H 4F7CB 5HD8D 3HE7D 2VZ1A 1RU9H 2DQHH 5I75C 4U1KB 5ESAB 1A1NB 4HKBB 2XPGB 3VMOA 4X8JB 4XPAH 1YEKH 3LDBC 4U7SA 4N9GA 4LHQB 3S37H 1JHKL 1B3JA 1N6VA 3QIUB 1AIFB 2GT9B 4X98A 1YNKH 4LCWE 3CVHL 4BSWB 5HYIA 1P2CB 2J3SA 5B8CC 2XWTB 2GTZA 2OJEA 5IVXE 1CFNB 3PE9A 3IDGA 4NQEA 1CG9B 1VADA 3GIVB 1LO0H 3SJVD 5TE7H 3QZWB 5BCAA 1EEUA 2FHBA 3VFUB 2AI0H 2VLKB 4LCIL 5IT2H 5L0QC 4TULH 4M7LH 1NMBL 1X44A 3MC0A 2OYPA 1MCKA 1WF5A 2CDEA 1FFOA 1BHGA 1TETL 2VSDA 4F2MB 2VXSH 4JM2B 3N9GH 4IOFC 4I3GA 4AG4L 4ZO9A 3NA9L 2UYLA 3M07A 3X14A 3RVTC 2W9DH 1FLTX 4LP4A 4CNIA 2AGJH 4JQXA 3UTSA 5EUKB 4NBXB 1E6OL 2EKJA 1Y6NR 1UQSB 2W0PA 3E1F1 5JOFB 1BM3H 3TBVA 5L7XL 2FATL 1JNLH 2CIKA 2YKLL 2VXTH 3MFFA 1KCSH 2XG4A 1JMZA 4N0YL 2VZ3A 2ADGA 3ROLA 1IT9H 2UZIH 4LSPH 4KDVA 3BKMH 3UJTH 5TQ2L 5C2BH 3CSYA 2AEIT 2QJDA 4JDVA 1F11A 4PRPA 4TYUA 5I76A 5KG9A 4JFPA 3BGFC 1I3GL 1GPOH 5IR1A 3U2SB 2P8LA 2FLRT 1MIEH 2PXYC 5GS1C 3QIWB 2ZWLT 4PJHF 4D9LH 1H3GA 3OB0K 1KNOA 2Z8VC 2R23B 2RIKA 3C5ZB 1C7TA 3U46A 5C0EB 4PGEB 1ACYH 5DD3L 2F8OA 4PJXA 3IXTA 4KH2A 4FG6D 5FYKL 1KENL 3OF6D 4L4TA 3IU4H 4FFZH 1I1CA 4YX2L 2HKHL 5CZXC 3TLRA 5I1JL 1ZHNA 2P24A 5MP6H 4NN7C 3CLFH 4YPGB 1P4BL 3VXTA 3P73B 4M6OL 3KPLB 1X5XA 1L0XA 4H25B 3AU1B 3O9WA 3FOLB 4U1IA 4IHOB 1YN6A 1SMAA 1I1AA 3U7WL 1EPFA 2M2DA 2A9NL 3DJ9A 4Z5RA 3QJFA 2MJWA 1YECH 2FHFA 5GIRA 2K3TA 3ZKSD 4MGXA 5IF0A 5AAMA 1EK3A 2WQ8A 5GRVK 1T04A 3FO1A 3O8XB 3QEGL 1JWMB 4MSWA 2FL5A 1P6FA 1SJXA 1OCWL 1LHZA 2V5RA 4F7EA 4Y16C 4LASH 2EYRB 1BQHB 3DO3A 4MS8C 4ZD3L 4OFKA 2A77L 5CD3B 4OTXH 3VWKB 5MEOB 1SQ2N 2B1AL 5E6ID 2EKSA 3UMTA 4GMTL 1U8JB 2BNQB 1NKRA 3S88H 4N90D 3IJSA 3NABH 3MRHA 3TO4B 1Q94A 1YY8A 1EEZB 4XNUL 5SX4I 1OTTC 4LCCA 4D94A 4MJID 6CGTA 3MRFB 4G6FD 2UUDH 2G5BA 2IADB 1FFRA 1FAIL 1DBMH 4OGYH 4DZ8B 5I75B 2E27H 2BVOB 2XWJB 2JTDA 3LDBB 2DKSA 4FHBD 5DFVC 4I0KA 5GJSH 4YGVA 4HKZB 1AD9A 2ORBL 3WS3A 4RGMC 3SEPA 1A3LH 3L3GA 1QFWM 4QWWD 4G5ZL 3V6ZA 2YD3A 3F7PC 3M1BB 2ENSA 3VE0B 3HR6A 5B8CB 3QNZA 1X6LA 5SWSB 5FUZL 3WHE0 3LSOB 2ADIA 1NCBH 3D0VB 2JLLA 4Y5VA 1RZ7H 4LHUG 4JFFE 4LHUA 3TYGL 3QP3A 1CK0L 4LP5A 5L0QB 3BIKB 1FO0B 5F7MC 5CHNB 4PJAF 3S7GA 3G6JA 4QXGH 4P2RA 1R0AL 5JTWA 4TNVK 4L8BA 1AQDB 2BHYA 3GK8L 2OQJA 2QHLA 3V6FA 4Z7OE 4LPVA 5FO8A 4H5SB 1C5CH 4WIQA 4G43B 1NH6A 4JKKA 5L9DH 1RJCA 4X4MA 4HK3J 4K3EH 4GG6A 4G6AC 1MFDL 1PZ5A 4MVBC 4UTBH 3REVA 4F7CA 4XPTH 1NCDL 4U1KA 5ESAA 1A1NA 4HKBA 5HDQL 5FM8A 2XPGA 1WIOA 4X8JA 2XN9B 3BMWA 4FN0A 4PR5B 1WC7B 3QIUA 1AIFA 2GT9A 2F54E 1JWSB 3FMGL 4XBGB 4BSWA 4HG4K 4U0QB 1P2CA 4G8GE 4JFDE 3IFNH 2N7BA 3BGFB 1T3FB 1J12A 2R0KL 1WEJH 1JV5B 3GBMH 4W4OA 2PXYB 2XWTA 5F7WC 5CGMA 1CFNA 4WTXA 5GS1B 1AC6A 3MNVB 1GGCH 4DEPB 1CG9A 1S7UB 5DMKB 3MA9L 1MCQA 3BKYL 1G9ML 3GIVA 4OLYH 1UZ8B 3QZWG 1RUKH 3QZWA 4DN3L 2ICES 3VFUA 1LD9B 2VLKA 2DQUL 2EE3A 3EOYG 3FFCE 4OD2B 5SWZD 1PG7H 3QQ9D 3BH8B 2YMXL 4NO0B 1FIEA 4F2MA 1CDCA 4JM2A 1HHKB 4JPWH 1TJHH 1A3QA 1GL4B 4NN7B 4WI7A 4OGXH 3DPBA 5F7EH 1AE6H 4PJFF 5EUKA 2NZ9D 4ELME 3O0RH 4PJEB 3QEHB 2PTUA 5BRZB 1UQSA 3MLVH 3VXSB 2IJ0C 5JOFA 1FVEB 3BAEH 3U0PB 4ELKB 5E94B 4KKLD 5EU6B 3BJ91 5I18L 1KT2B 2X4RB 3JWOC 5IESH 5JHDD 4XP4L 1F4YL 5JIPA 2J8UB 1UZ6F 4K3DL 4K9EC 1F2XK 4QRRE 3UYPA 2AJVH 3U2SA 4WNQB 4Y16B 3QIWA 3OB0H 5LQBH 5E00B 1JRHI 4OF8A 4KZEH 5D72H 3KPTA 2R23A 3JWDH 1CGTA 3QA3B 4FFWD 3C5ZA 2YN5A 4K3HA 5C0EA 1RZJH 2DQGL 4PGEA 1B4RA 2C3VB 2EDHA 2DIBA 1Q72L 1RHFA 2APFA 5CJXC 3KJ6H 5EU7E 3OG6B 3H3PH 4N0RA 3GSRB 1YC7A 3CPLB 1OGTB 1SHMA 3B5HA 3FONB 2YD5A 2VLRD 4YPGA 3P73A 4YFLF 4IRSC 4HMDA 3KPLA 4XNQB 5IBTH 3VI3F 3CX2A 4H25A 3AU1A 4AMKL 3FOLA 1A7QH 4IHOA 1UA6L 2FRGP 2VR9A 3MGAA 2CLZB 3HNSH 3F58L 1YEJL 3QG6B 1FCCA 1NUGA 3HB3D 1P1ZB 4XAWH 1F5WA 2WP3T 5DUPL 4HLZH 1HDMB 3HI6H 1XGTB 1NL0H 5DD0L 2E8ZA 1FJ1B 4RGMB 1FYTE 3O6MH 3O8XA 3CD4A 4PG9B 5TF1L 3D39B 1JWMA 3TC9A 5I71C 5DT1L 2YD4A 2ZCHL 4P0DA 4A6YB 1BQHG 2EYRA 1BQHA 4NQSB 4CVUA 4K55A 5CD3A 1AXSB 2D9CA 3VWKA 1H9VA 5MEOA 2WBKA 5D6CB 3O41B 4L4VE 1U8JA 2BNQA 4P5KB 4ZPTB 4ZUUB 3DARA 1AGFB 3B3IB 3TO4A 3GMPB 1P4LB 5CAYB 3RY6C 4HHAB 1YNLL 4JFZL 3MODH 4YHOL 3THMH 1EEZA 1ZEAH 3CC5B 4CVZB 4JO2H 1QYGH 3C08L 4I4WB 2BOCB 1AY1H 4U7KA 3L5WB 2GJ6E 3MRFA 5FEBA 1EIBA 3ULUH 1T7ZA 4U31A 5K9QG 5FCSH 2IADA 2ZUWA 2EDTA 1J5OH 2UZXB 5E95B 4DZ8A 4Z7UE 2BVOA 2XWJA 5I1IL 4P46D 3GBNL 4LSRH 2R56L 1UM5H 3EDJA 1REIA 1NBYB 4HKZA 4KVNL 3NBNA 1BWMA 1ES0B 3M1BA 4HWBH 3VE0A 2APXA 3NN8B 4YWGL 3VWJD 3D25B 5SWSA 5B8CA 1J0KA 4P2QB 1QNZH 4NQCE 1R3KB 2X7LB 2Z91B 3LHPH 3LSOA 1OQXA 2X2YA 5FIEA 3D0VA 1UB5B 2VMFA 1NCTA 4WRLA 1II4E 3BIKA 1FO0A 5CHNA 1F6LL 3CMOH 1DBAH 4AL8H 1EO8H 1BBJB 1MFEH 1R6VA 2YRLA 4HWZB 4DKEH 1AQDA 5C0ND 2YD9A 4H5SA 3DVFA 3G6DL 4X6CB 5CEZE 4G43A 4GBXC 4WCYL 2NY2C 3WLBB 5DZOA 2X1QA 3ZTJG 5BMFL 3BIAX 4PJGE 2Q76B 5IWLC 2XN9A 3CGTA 4PR5A 3ZKMD 1WC7A 3V4VH 2H1PH 2RR3A 5CEZH 1UH4A 2RGSA 1KCUL 1JWSA 2CD0A 1JNNL 4XBGA 3EJJX 3L3KB 5DRWB 4AM0A 5F9AC 1T3FA 5KBNC 1JV5A 4KDTA 2PXYA 2VLME 2XZQH 4A2LA 5GS1A 3MNVA 2OR8A 2OL3B 1S7UA 5DMKA 3FQUB 1UZ8A 3DVNB 3MYJB 4ODVH 5EOCH 4AEHH 4HPOL 1DZBA 4JG0L 1LD9A 3CFDB 4XNXH 4ZMAT 3JUYA 2CDFB 5F7KC 4OD2A 3G04B 1HXYB 2J4WH 4PJBF 4GKSB 4QNPF 5IKCB 1G6RL 3W5NA 2YD2A 5HVWA 3BH8A 4NO0A 3KXFE 3RY5A 1HHKA 3MLTB 3MGTB 1DLHB 5L2JB 5JDJA 3GI8H 2NLJB 5MEQB 4X7SH 2LU3A 3VDCA 2DQDH 1FNSH 1K9TA 4HF5H 4BFBD 4IRSB 3OAYK 3QIBC 2DBLH 2Z92B 4NC0B 3HUJB 4PJEA 3HZYB 3QEHA 5BRZA 4JB9L 3VXSA 1FVEA