3MJLA

Crystal structure of human arginase i in complex with 2-aminoimidazole. resolution 1.90 a.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
314
structure length
314
Chain Sequence
RTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-1
publication title Crystal structure of human arginase I in complex with 2-aminoimidazole. Resolution 1.90 A.
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 115
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2010-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 3mjlA00
4MYNA 4IXUA 1HQ5A 3GN0A 3F80A 1TBLA 1TA1A 2RLAA 1T5GA 5CEVA 4Q3UA 4IE1A 4Q40A 5HJ9A 4RHQA 4FCIA 1WVAA 3SJTA 1HQGA 3SL0A 4RHIA 1TBJA 2A0MA 3E9BA 4Q3PA 1T4TA 1D3VA 1P8SA 2ZAVA 4CEVA 2CEVA 2EIVA 3NIQA 4IE3A 1TBHA 4Q3RC 3MMRA 1T4PA 3CEVA 1P8OA 3THJA 1CEVA 3PZLA 4IE2A 1P8PA 1T4SA 3NIPA 1PQ3A 2EF4A 3MFWA 4RHKA 4MYLA 4GSVA 4IU5A 2AEBA 1P8MA 1P8QA 3NIOA 4IXVA 4MYKA 1ZPGA 3E8ZA 3LP7A 3GMZA 4Q41A 1GQ6A 1WOIA 2PHOA 3THEA 3LP4A 4G3HA 4GWDA 4ITYA 3SKKA 4RLAA 3TF3A 4GSZA 5RLAA 4MYFA 4DZ4A 4GSMA 3DJ8A 1RLAA 1WOGA 4RHMA 4Q3QA 4Q3TA 3TH7A 1XFKA 4HXQA 4Q3VA 1GQ7A 1HQHA 4IU0A 4Q3SA 4RHJA 2PLLA 1WVBA 4MXRA 3E8QA 3MJLA 1R1OA 2EF5A 3E6KA 3M1RA 3THHA 3LHLA 1T5FA 4RHLA 3MFVA 3KV2A 4I06A 1T4RA 4GWCA 1HQXA 4IU1A 4Q42A 4Q3RA 4HZEA 3SL1A 3RLAA 4HWWA 1WOHA 5HJAA 1P8NA 3E6VA 1HQFA 2PHAA 1P8RA 4IU4A 4FCKA 1ZPEA
chains in the Genus database with same CATH superfamily
4QA3A 5DC8A 4ZUOA 4MYNA 4RN0A 4ZURA 4IXUA 5THVA 1HQ5A 3MAXA 5EEFA 3GN0A 5IWGA 4LXZA 3F80A 5G0IA 4BZ9A 1TBLA 5EFGA 5G11A 1TA1A 2RLAA 1T5GA 3SFHA 3MZ3A 5CEVA 1C3PA 4Q3UA 4IE1A 4Q40A 5DC6A 5HJ9A 4BZ5A 1ZZ3A 4RHQA 4FCIA 4QA4A 2V5WA 1WVAA 5G0JA 3SJTA 5FUEA 4QA6A 1HQGA 3SL0A 2VQJA 4RN1A 1T64A 3ZNRA 4RHIA 1TBJA 4BZ6A 2A0MA 3E9BA 4Q3PA 1T4TA 5G1AA 5G3WA 5G0GA 5BWZA 1D3VA 1P8SA 2ZAVA 4RN2A 2VQMA 4CEVA 2CEVA 2EIVA 3NIQA 4IE3A 1TBHA 3MZ4A 4Q3RC 4BZ7A 3MMRA 3MZ7A 1T4PA 3CEVA 1P8OA 3EW8A 5DC7A 3C10A 5THUA 3THJA 1CEVA 3PZLA 4IE2A 4ZUNA 5G17A 1P8PA 5EFJD 5G13A 1T4SA 3NIPA 1PQ3A 5G1BA 2EF4A 3MFWA 4RHKA 4MYLA 4GSVA 4IU5A 5G12A 1VKGA 2AEBA 3Q9FA 3MENA 1P8MA 4CQFA 1P8QA 3NIOA 4ZUQA 4QA7A 4IXVA 4MYKA 1ZPGA 1C3SA 3E8ZA 3EZPA 3LP7A 5D1DA 3GMZA 5D1CA 1ZZ1A 3C0YA 5EENA 5G1CA 2VQQA 3EZTA 1GQ6A 3ZNSA 4Q41A 3MZ6A 1C3RA 5EFNA 1WOIA 4QA5A 2PHOA 5THTA 5G0XA 1ZZ0A 3THEA 4LY1A 4BKXB 3LP4A 4G3HA 4GWDA 4ITYA 5EF8A 4BZ8A 4ZUPA 5JI5A 3SKKA 4RLAA 2VQVA 3SFFA 4QA2A 1W22A 4QA1A 3TF3A 4GSZA 5RLAA 4MYFA 4DZ4A 5D1BA 4GSMA 5FCWA 3DJ8A 1RLAA 1WOGA 4QA0A 4RHMA 4Q3QA 4Q3TA 3TH7A 1XFKA 3F06A 4HXQA 5G10A 4Q3VA 1GQ7A 5DC5A 1HQHA 4IU0A 4Q3SA 4RHJA 5EEMA 2PLLA 1WVBA 2V5XA 4MXRA 3E8QA 3MJLA 5G0HA 5EF7A 1R1OA 2EF5A 3F0RA 5IX0A 4A69A 3E6KA 5LI3A 3M1RA 3THHA 2VQWG 5G0YA 3Q9BA 1T67A 5EFKB 3LHLA 4CBTA 1T5FA 4RHLA 5EFHA 3MFVA 3KV2A 3Q9EA 4I06A 5ICNB 1T4RA 4GWCA 1HQXA 4IU1A 4ZUMA 4Q42A 1T69A 4Q3RA 4HZEA 3SL1A 3Q9CA 3RLAA 4HWWA 3C0ZA 5EFBD 2VCGA 1WOHA 5HJAA 1P8NA 3E6VA 3RQDA 1HQFA 5EEKA 2PHAA 3EWFA 1P8RA 5A2SA 3F07A 5EEIA 2VQOA 5THSA 4CBYA 4IU4A 4FCKA 1ZPEA 2GH6A
chains in the Genus database with same CATH topology
4MYNA 4IXUA 1HQ5A 3GN0A 3F80A 1TBLA 1TA1A 2RLAA 1T5GA 5CEVA 4Q3UA 4IE1A 4Q40A 5HJ9A 4RHQA 4FCIA 1WVAA 3SJTA 1HQGA 3SL0A 4RHIA 1TBJA 2A0MA 3E9BA 4Q3PA 1T4TA 1D3VA 1P8SA 2ZAVA 4CEVA 2CEVA 2EIVA 3NIQA 4IE3A 1TBHA 4Q3RC 3MMRA 1T4PA 3CEVA 1P8OA 3THJA 1CEVA 3PZLA 4IE2A 1P8PA 1T4SA 3NIPA 1PQ3A 2EF4A 3MFWA 4RHKA 4MYLA 4GSVA 4IU5A 2AEBA 1P8MA 1P8QA 3NIOA 4IXVA 4MYKA 1ZPGA 3E8ZA 3LP7A 3GMZA 4Q41A 1GQ6A 1WOIA 2PHOA 3THEA 3LP4A 4G3HA 4GWDA 4ITYA 3SKKA 4RLAA 3TF3A 4GSZA 5RLAA 4MYFA 4DZ4A 4GSMA 3DJ8A 1RLAA 1WOGA 4RHMA 4Q3QA 4Q3TA 3TH7A 1XFKA 4HXQA 4Q3VA 1GQ7A 1HQHA 4IU0A 4Q3SA 4RHJA 2PLLA 1WVBA 4MXRA 3E8QA 3MJLA 1R1OA 2EF5A 3E6KA 3M1RA 3THHA 3LHLA 1T5FA 4RHLA 3MFVA 3KV2A 4I06A 1T4RA 4GWCA 1HQXA 4IU1A 4Q42A 4Q3RA 4HZEA 3SL1A 3RLAA 4HWWA 1WOHA 5HJAA 1P8NA 3E6VA 1HQFA 2PHAA 1P8RA 4IU4A 4FCKA 1ZPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MYN A;  4IXU A;  1HQ5 A;  3GN0 A;  3F80 A;  1TBL A;  1TA1 A;  2RLA A;  1T5G A;  5CEV A;  4Q3U A;  4IE1 A;  4Q40 A;  5HJ9 A;  4RHQ A;  4FCI A;  1WVA A;  3SJT A;  1HQG A;  3SL0 A;  4RHI A;  1TBJ A;  2A0M A;  3E9B A;  4Q3P A;  1T4T A;  1D3V A;  1P8S A;  2ZAV A;  4CEV A;  2CEV A;  2EIV A;  3NIQ A;  4IE3 A;  1TBH A;  4Q3R C;  3MMR A;  1T4P A;  3CEV A;  1P8O A;  3THJ A;  1CEV A;  3PZL A;  4IE2 A;  1P8P A;  1T4S A;  3NIP A;  1PQ3 A;  2EF4 A;  3MFW A;  4RHK A;  4MYL A;  4GSV A;  4IU5 A;  2AEB A;  1P8M A;  1P8Q A;  3NIO A;  4IXV A;  4MYK A;  1ZPG A;  3E8Z A;  3LP7 A;  3GMZ A;  4Q41 A;  1GQ6 A;  1WOI A;  2PHO A;  3THE A;  3LP4 A;  4G3H A;  4GWD A;  4ITY A;  3SKK A;  4RLA A;  3TF3 A;  4GSZ A;  5RLA A;  4MYF A;  4DZ4 A;  4GSM A;  3DJ8 A;  1RLA A;  1WOG A;  4RHM A;  4Q3Q A;  4Q3T A;  3TH7 A;  1XFK A;  4HXQ A;  4Q3V A;  1GQ7 A;  1HQH A;  4IU0 A;  4Q3S A;  4RHJ A;  2PLL A;  1WVB A;  4MXR A;  3E8Q A;  3MJL A;  1R1O A;  2EF5 A;  3E6K A;  3M1R A;  3THH A;  3LHL A;  1T5F A;  4RHL A;  3MFV A;  3KV2 A;  4I06 A;  1T4R A;  4GWC A;  1HQX A;  4IU1 A;  4Q42 A;  4Q3R A;  4HZE A;  3SL1 A;  3RLA A;  4HWW A;  1WOH A;  5HJA A;  1P8N A;  3E6V A;  1HQF A;  2PHA A;  1P8R A;  4IU4 A;  4FCK A;  1ZPE A; 
#chains in the Genus database with same CATH topology
 4QA3 A;  5DC8 A;  4ZUO A;  4MYN A;  4RN0 A;  4ZUR A;  4IXU A;  5THV A;  1HQ5 A;  3MAX A;  5EEF A;  3GN0 A;  5IWG A;  4LXZ A;  3F80 A;  5G0I A;  4BZ9 A;  1TBL A;  5EFG A;  5G11 A;  1TA1 A;  2RLA A;  1T5G A;  3SFH A;  3MZ3 A;  5CEV A;  1C3P A;  4Q3U A;  4IE1 A;  4Q40 A;  5DC6 A;  5HJ9 A;  4BZ5 A;  1ZZ3 A;  4RHQ A;  4FCI A;  4QA4 A;  2V5W A;  1WVA A;  5G0J A;  3SJT A;  5FUE A;  4QA6 A;  1HQG A;  3SL0 A;  2VQJ A;  4RN1 A;  1T64 A;  3ZNR A;  4RHI A;  1TBJ A;  4BZ6 A;  2A0M A;  3E9B A;  4Q3P A;  1T4T A;  5G1A A;  5G3W A;  5G0G A;  5BWZ A;  1D3V A;  1P8S A;  2ZAV A;  4RN2 A;  2VQM A;  4CEV A;  2CEV A;  2EIV A;  3NIQ A;  4IE3 A;  1TBH A;  3MZ4 A;  4Q3R C;  4BZ7 A;  3MMR A;  3MZ7 A;  1T4P A;  3CEV A;  1P8O A;  3EW8 A;  5DC7 A;  3C10 A;  5THU A;  3THJ A;  1CEV A;  3PZL A;  4IE2 A;  4ZUN A;  5G17 A;  1P8P A;  5EFJ D;  5G13 A;  1T4S A;  3NIP A;  1PQ3 A;  5G1B A;  2EF4 A;  3MFW A;  4RHK A;  4MYL A;  4GSV A;  4IU5 A;  5G12 A;  1VKG A;  2AEB A;  3Q9F A;  3MEN A;  1P8M A;  4CQF A;  1P8Q A;  3NIO A;  4ZUQ A;  4QA7 A;  4IXV A;  4MYK A;  1ZPG A;  1C3S A;  3E8Z A;  3EZP A;  3LP7 A;  5D1D A;  3GMZ A;  5D1C A;  1ZZ1 A;  3C0Y A;  5EEN A;  5G1C A;  2VQQ A;  3EZT A;  1GQ6 A;  3ZNS A;  4Q41 A;  3MZ6 A;  1C3R A;  5EFN A;  1WOI A;  4QA5 A;  2PHO A;  5THT A;  5G0X A;  1ZZ0 A;  3THE A;  4LY1 A;  4BKX B;  3LP4 A;  4G3H A;  4GWD A;  4ITY A;  5EF8 A;  4BZ8 A;  4ZUP A;  5JI5 A;  3SKK A;  4RLA A;  2VQV A;  3SFF A;  4QA2 A;  1W22 A;  4QA1 A;  3TF3 A;  4GSZ A;  5RLA A;  4MYF A;  4DZ4 A;  5D1B A;  4GSM A;  5FCW A;  3DJ8 A;  1RLA A;  1WOG A;  4QA0 A;  4RHM A;  4Q3Q A;  4Q3T A;  3TH7 A;  1XFK A;  3F06 A;  4HXQ A;  5G10 A;  4Q3V A;  1GQ7 A;  5DC5 A;  1HQH A;  4IU0 A;  4Q3S A;  4RHJ A;  5EEM A;  2PLL A;  1WVB A;  2V5X A;  4MXR A;  3E8Q A;  3MJL A;  5G0H A;  5EF7 A;  1R1O A;  2EF5 A;  3F0R A;  5IX0 A;  4A69 A;  3E6K A;  5LI3 A;  3M1R A;  3THH A;  2VQW G;  5G0Y A;  3Q9B A;  1T67 A;  5EFK B;  3LHL A;  4CBT A;  1T5F A;  4RHL A;  5EFH A;  3MFV A;  3KV2 A;  3Q9E A;  4I06 A;  5ICN B;  1T4R A;  4GWC A;  1HQX A;  4IU1 A;  4ZUM A;  4Q42 A;  1T69 A;  4Q3R A;  4HZE A;  3SL1 A;  3Q9C A;  3RLA A;  4HWW A;  3C0Z A;  5EFB D;  2VCG A;  1WOH A;  5HJA A;  1P8N A;  3E6V A;  3RQD A;  1HQF A;  5EEK A;  2PHA A;  3EWF A;  1P8R A;  5A2S A;  3F07 A;  5EEI A;  2VQO A;  5THS A;  4CBY A;  4IU4 A;  4FCK A;  1ZPE A;  2GH6 A; 
#chains in the Genus database with same CATH homology
 4MYN A;  4IXU A;  1HQ5 A;  3GN0 A;  3F80 A;  1TBL A;  1TA1 A;  2RLA A;  1T5G A;  5CEV A;  4Q3U A;  4IE1 A;  4Q40 A;  5HJ9 A;  4RHQ A;  4FCI A;  1WVA A;  3SJT A;  1HQG A;  3SL0 A;  4RHI A;  1TBJ A;  2A0M A;  3E9B A;  4Q3P A;  1T4T A;  1D3V A;  1P8S A;  2ZAV A;  4CEV A;  2CEV A;  2EIV A;  3NIQ A;  4IE3 A;  1TBH A;  4Q3R C;  3MMR A;  1T4P A;  3CEV A;  1P8O A;  3THJ A;  1CEV A;  3PZL A;  4IE2 A;  1P8P A;  1T4S A;  3NIP A;  1PQ3 A;  2EF4 A;  3MFW A;  4RHK A;  4MYL A;  4GSV A;  4IU5 A;  2AEB A;  1P8M A;  1P8Q A;  3NIO A;  4IXV A;  4MYK A;  1ZPG A;  3E8Z A;  3LP7 A;  3GMZ A;  4Q41 A;  1GQ6 A;  1WOI A;  2PHO A;  3THE A;  3LP4 A;  4G3H A;  4GWD A;  4ITY A;  3SKK A;  4RLA A;  3TF3 A;  4GSZ A;  5RLA A;  4MYF A;  4DZ4 A;  4GSM A;  3DJ8 A;  1RLA A;  1WOG A;  4RHM A;  4Q3Q A;  4Q3T A;  3TH7 A;  1XFK A;  4HXQ A;  4Q3V A;  1GQ7 A;  1HQH A;  4IU0 A;  4Q3S A;  4RHJ A;  2PLL A;  1WVB A;  4MXR A;  3E8Q A;  3MJL A;  1R1O A;  2EF5 A;  3E6K A;  3M1R A;  3THH A;  3LHL A;  1T5F A;  4RHL A;  3MFV A;  3KV2 A;  4I06 A;  1T4R A;  4GWC A;  1HQX A;  4IU1 A;  4Q42 A;  4Q3R A;  4HZE A;  3SL1 A;  3RLA A;  4HWW A;  1WOH A;  5HJA A;  1P8N A;  3E6V A;  1HQF A;  2PHA A;  1P8R A;  4IU4 A;  4FCK A;  1ZPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...