3MJLA

Crystal structure of human arginase i in complex with 2-aminoimidazole. resolution 1.90 a.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
314
structure length
314
Chain Sequence
b'RTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-1
publication title Crystal structure of human arginase I in complex with 2-aminoimidazole. Resolution 1.90 A.
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 115
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2010-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 3mjlA00
1P8MA 1R1OA 3E9BA 2A0MA 3LP4A 1T4PA 3E8QA 3E6KA 4FCKA 4Q3UA 3GN0A 4RHIA 3NIPA 1T4SA 2EF5A 4RLAA 3THEA 3TH7A 4IU5A 4Q42A 2PHOA 1WOIA 3NIOA 3DJ8A 4IE3A 3LHLA 3NIQA 1HQFA 3MFWA 4IU0A 4RHMA 2ZAVA 4Q3SA 3E6VA 2PHAA 1GQ6A 4DZ4A 1XFKA 1RLAA 4IXUA 4Q3RA 4GSMA 4IXVA 3THJA 4G3HA 3THHA 3CEVA 1CEVA 4HXQA 1HQXA 3SJTA 3E8ZA 4MYKA 1HQHA 1P8OA 4IE1A 4RHKA 3TF3A 1ZPEA 2AEBA 2EF4A 1WOHA 1WVBA 1T5FA 1T5GA 1T4TA 1P8NA 3M1RA 1HQGA 1P8PA 3LP7A 4MYLA 4Q40A 3SL0A 3SKKA 1T4RA 4Q3TA 1TBLA 3GMZA 1P8QA 1TA1A 5HJ9A 4Q3VA 3PZLA 1P8RA 4Q41A 4GSZA 3MMRA 1HQ5A 4IE2A 5CEVA 4FCIA 4HZEA 4GSVA 3MFVA 4MYFA 4CEVA 5HJAA 4RHJA 1WOGA 4GWCA 3RLAA 4I06A 4GWDA 1D3VA 4Q3QA 4ITYA 4IU4A 4HWWA 2PLLA 4RHQA 1ZPGA 2RLAA 4RHLA 3SL1A 3KV2A 3MJLA 2CEVA 5RLAA 1TBJA 1P8SA 4Q3PA 4Q3RC 1TBHA 1WVAA 1GQ7A 2EIVA 1PQ3A 4MXRA 4MYNA 4IU1A 3F80A
chains in the Genus database with same CATH superfamily
4CQFA 1P8MA 1VKGA 1R1OA 3E9BA 1ZZ3A 3ZNSA 2A0MA 3LP4A 1T4PA 3E8QA 3E6KA 5G0YA 4FCKA 5D1CA 4Q3UA 3GN0A 4RHIA 3NIPA 1T4SA 5G0GA 2EF5A 4RLAA 3MZ7A 3THEA 5EEKA 3TH7A 5G1AA 4IU5A 4LXZA 4QA3A 3F06A 4Q42A 2VQQA 2PHOA 1WOIA 3C10A 5LI3A 5EFGA 5G0XA 3NIOA 5DC5A 5ICNB 3DJ8A 5EEMA 5EFHA 5G10A 4IE3A 3C0ZA 3LHLA 5DC6A 5FUEA 3NIQA 1HQFA 5EENA 4BZ9A 3MFWA 4BZ8A 5EF7A 5EEFA 4BKXB 4IU0A 4RHMA 5EEIA 4ZUNA 4RN0A 2ZAVA 5G1BA 1ZZ1A 5G11A 4Q3SA 3E6VA 4QA7A 2PHAA 5EFNA 1C3SA 4QA5A 1GQ6A 4DZ4A 5G0IA 4QA1A 1XFKA 1RLAA 3EZPA 4IXUA 1ZZ0A 4Q3RA 4GSMA 2GH6A 4IXVA 3THJA 4G3HA 3THHA 3MZ6A 3CEVA 1CEVA 4HXQA 5EF8A 1HQXA 4CBTA 3SJTA 3E8ZA 3MZ3A 1HQHA 1P8OA 3EW8A 4MYKA 4BZ7A 4IE1A 4RHKA 3TF3A 1ZPEA 2AEBA 3Q9FA 2EF4A 1WOHA 3EWFA 3MZ4A 3RQDA 4RN2A 5JI5A 1WVBA 1T5FA 1T5GA 5THVA 1T4TA 1P8NA 3M1RA 1HQGA 4RN1A 5A2SA 4QA0A 1P8PA 3LP7A 4MYLA 1W22A 4Q40A 3SL0A 5BWZA 3SKKA 4QA2A 2VCGA 2VQVA 1T4RA 1C3RA 4Q3TA 1TBLA 3GMZA 1P8QA 1TA1A 5HJ9A 4Q3VA 3PZLA 1P8RA 4Q41A 5DC7A 2VQJA 4GSZA 4ZURA 5G12A 3MAXA 3Q9EA 1T67A 1HQ5A 3MMRA 4IE2A 5CEVA 4FCIA 4HZEA 3F07A 4GSVA 5FCWA 5THUA 3MFVA 5G13A 5THSA 4MYFA 5EFJD 3MENA 4CEVA 5HJAA 4QA6A 2V5XA 3SFHA 4RHJA 4ZUOA 3Q9BA 1WOGA 4GWCA 5THTA 4ZUMA 4QA4A 2VQWG 1T69A 3F0RA 3RLAA 4I06A 4GWDA 5G17A 4CBYA 1D3VA 4Q3QA 4A69A 4ITYA 3ZNRA 4LY1A 3C0YA 4IU4A 4HWWA 2VQOA 2PLLA 4RHQA 1ZPGA 2RLAA 5DC8A 4RHLA 5G0HA 3KV2A 3SL1A 3MJLA 5D1BA 5D1DA 5G1CA 4BZ5A 2CEVA 5EFKB 4BZ6A 5G0JA 5RLAA 5IWGA 1TBJA 5EFBD 1P8SA 5IX0A 4Q3PA 4Q3RC 3EZTA 1TBHA 1WVAA 1GQ7A 4ZUPA 2EIVA 1PQ3A 3Q9CA 2V5WA 2VQMA 1C3PA 4MXRA 4MYNA 4ZUQA 3SFFA 4IU1A 1T64A 5G3WA 3F80A
chains in the Genus database with same CATH topology
1P8MA 1R1OA 3E9BA 2A0MA 3LP4A 1T4PA 3E8QA 3E6KA 4FCKA 4Q3UA 3GN0A 4RHIA 3NIPA 1T4SA 2EF5A 4RLAA 3THEA 3TH7A 4IU5A 4Q42A 2PHOA 1WOIA 3NIOA 3DJ8A 4IE3A 3LHLA 3NIQA 1HQFA 3MFWA 4IU0A 4RHMA 2ZAVA 4Q3SA 3E6VA 2PHAA 1GQ6A 4DZ4A 1XFKA 1RLAA 4IXUA 4Q3RA 4GSMA 4IXVA 3THJA 4G3HA 3THHA 3CEVA 1CEVA 4HXQA 1HQXA 3SJTA 3E8ZA 4MYKA 1HQHA 1P8OA 4IE1A 4RHKA 3TF3A 1ZPEA 2AEBA 2EF4A 1WOHA 1WVBA 1T5FA 1T5GA 1T4TA 1P8NA 3M1RA 1HQGA 1P8PA 3LP7A 4MYLA 4Q40A 3SL0A 3SKKA 1T4RA 4Q3TA 1TBLA 3GMZA 1P8QA 1TA1A 5HJ9A 4Q3VA 3PZLA 1P8RA 4Q41A 4GSZA 3MMRA 1HQ5A 4IE2A 5CEVA 4FCIA 4HZEA 4GSVA 3MFVA 4MYFA 4CEVA 5HJAA 4RHJA 1WOGA 4GWCA 3RLAA 4I06A 4GWDA 1D3VA 4Q3QA 4ITYA 4IU4A 4HWWA 2PLLA 4RHQA 1ZPGA 2RLAA 4RHLA 3SL1A 3KV2A 3MJLA 2CEVA 5RLAA 1TBJA 1P8SA 4Q3PA 4Q3RC 1TBHA 1WVAA 1GQ7A 2EIVA 1PQ3A 4MXRA 4MYNA 4IU1A 3F80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P8M A;  1R1O A;  3E9B A;  2A0M A;  3LP4 A;  1T4P A;  3E8Q A;  3E6K A;  4FCK A;  4Q3U A;  3GN0 A;  4RHI A;  3NIP A;  1T4S A;  2EF5 A;  4RLA A;  3THE A;  3TH7 A;  4IU5 A;  4Q42 A;  2PHO A;  1WOI A;  3NIO A;  3DJ8 A;  4IE3 A;  3LHL A;  3NIQ A;  1HQF A;  3MFW A;  4IU0 A;  4RHM A;  2ZAV A;  4Q3S A;  3E6V A;  2PHA A;  1GQ6 A;  4DZ4 A;  1XFK A;  1RLA A;  4IXU A;  4Q3R A;  4GSM A;  4IXV A;  3THJ A;  4G3H A;  3THH A;  3CEV A;  1CEV A;  4HXQ A;  1HQX A;  3SJT A;  3E8Z A;  4MYK A;  1HQH A;  1P8O A;  4IE1 A;  4RHK A;  3TF3 A;  1ZPE A;  2AEB A;  2EF4 A;  1WOH A;  1WVB A;  1T5F A;  1T5G A;  1T4T A;  1P8N A;  3M1R A;  1HQG A;  1P8P A;  3LP7 A;  4MYL A;  4Q40 A;  3SL0 A;  3SKK A;  1T4R A;  4Q3T A;  1TBL A;  3GMZ A;  1P8Q A;  1TA1 A;  5HJ9 A;  4Q3V A;  3PZL A;  1P8R A;  4Q41 A;  4GSZ A;  3MMR A;  1HQ5 A;  4IE2 A;  5CEV A;  4FCI A;  4HZE A;  4GSV A;  3MFV A;  4MYF A;  4CEV A;  5HJA A;  4RHJ A;  1WOG A;  4GWC A;  3RLA A;  4I06 A;  4GWD A;  1D3V A;  4Q3Q A;  4ITY A;  4IU4 A;  4HWW A;  2PLL A;  4RHQ A;  1ZPG A;  2RLA A;  4RHL A;  3SL1 A;  3KV2 A;  3MJL A;  2CEV A;  5RLA A;  1TBJ A;  1P8S A;  4Q3P A;  4Q3R C;  1TBH A;  1WVA A;  1GQ7 A;  2EIV A;  1PQ3 A;  4MXR A;  4MYN A;  4IU1 A;  3F80 A; 
#chains in the Genus database with same CATH topology
 4CQF A;  1P8M A;  1VKG A;  1R1O A;  3E9B A;  1ZZ3 A;  3ZNS A;  2A0M A;  3LP4 A;  1T4P A;  3E8Q A;  3E6K A;  5G0Y A;  4FCK A;  5D1C A;  4Q3U A;  3GN0 A;  4RHI A;  3NIP A;  1T4S A;  5G0G A;  2EF5 A;  4RLA A;  3MZ7 A;  3THE A;  5EEK A;  3TH7 A;  5G1A A;  4IU5 A;  4LXZ A;  4QA3 A;  3F06 A;  4Q42 A;  2VQQ A;  2PHO A;  1WOI A;  3C10 A;  5LI3 A;  5EFG A;  5G0X A;  3NIO A;  5DC5 A;  5ICN B;  3DJ8 A;  5EEM A;  5EFH A;  5G10 A;  4IE3 A;  3C0Z A;  3LHL A;  5DC6 A;  5FUE A;  3NIQ A;  1HQF A;  5EEN A;  4BZ9 A;  3MFW A;  4BZ8 A;  5EF7 A;  5EEF A;  4BKX B;  4IU0 A;  4RHM A;  5EEI A;  4ZUN A;  4RN0 A;  2ZAV A;  5G1B A;  1ZZ1 A;  5G11 A;  4Q3S A;  3E6V A;  4QA7 A;  2PHA A;  5EFN A;  1C3S A;  4QA5 A;  1GQ6 A;  4DZ4 A;  5G0I A;  4QA1 A;  1XFK A;  1RLA A;  3EZP A;  4IXU A;  1ZZ0 A;  4Q3R A;  4GSM A;  2GH6 A;  4IXV A;  3THJ A;  4G3H A;  3THH A;  3MZ6 A;  3CEV A;  1CEV A;  4HXQ A;  5EF8 A;  1HQX A;  4CBT A;  3SJT A;  3E8Z A;  3MZ3 A;  1HQH A;  1P8O A;  3EW8 A;  4MYK A;  4BZ7 A;  4IE1 A;  4RHK A;  3TF3 A;  1ZPE A;  2AEB A;  3Q9F A;  2EF4 A;  1WOH A;  3EWF A;  3MZ4 A;  3RQD A;  4RN2 A;  5JI5 A;  1WVB A;  1T5F A;  1T5G A;  5THV A;  1T4T A;  1P8N A;  3M1R A;  1HQG A;  4RN1 A;  5A2S A;  4QA0 A;  1P8P A;  3LP7 A;  4MYL A;  1W22 A;  4Q40 A;  3SL0 A;  5BWZ A;  3SKK A;  4QA2 A;  2VCG A;  2VQV A;  1T4R A;  1C3R A;  4Q3T A;  1TBL A;  3GMZ A;  1P8Q A;  1TA1 A;  5HJ9 A;  4Q3V A;  3PZL A;  1P8R A;  4Q41 A;  5DC7 A;  2VQJ A;  4GSZ A;  4ZUR A;  5G12 A;  3MAX A;  3Q9E A;  1T67 A;  1HQ5 A;  3MMR A;  4IE2 A;  5CEV A;  4FCI A;  4HZE A;  3F07 A;  4GSV A;  5FCW A;  5THU A;  3MFV A;  5G13 A;  5THS A;  4MYF A;  5EFJ D;  3MEN A;  4CEV A;  5HJA A;  4QA6 A;  2V5X A;  3SFH A;  4RHJ A;  4ZUO A;  3Q9B A;  1WOG A;  4GWC A;  5THT A;  4ZUM A;  4QA4 A;  2VQW G;  1T69 A;  3F0R A;  3RLA A;  4I06 A;  4GWD A;  5G17 A;  4CBY A;  1D3V A;  4Q3Q A;  4A69 A;  4ITY A;  3ZNR A;  4LY1 A;  3C0Y A;  4IU4 A;  4HWW A;  2VQO A;  2PLL A;  4RHQ A;  1ZPG A;  2RLA A;  5DC8 A;  4RHL A;  5G0H A;  3KV2 A;  3SL1 A;  3MJL A;  5D1B A;  5D1D A;  5G1C A;  4BZ5 A;  2CEV A;  5EFK B;  4BZ6 A;  5G0J A;  5RLA A;  5IWG A;  1TBJ A;  5EFB D;  1P8S A;  5IX0 A;  4Q3P A;  4Q3R C;  3EZT A;  1TBH A;  1WVA A;  1GQ7 A;  4ZUP A;  2EIV A;  1PQ3 A;  3Q9C A;  2V5W A;  2VQM A;  1C3P A;  4MXR A;  4MYN A;  4ZUQ A;  3SFF A;  4IU1 A;  1T64 A;  5G3W A;  3F80 A; 
#chains in the Genus database with same CATH homology
 1P8M A;  1R1O A;  3E9B A;  2A0M A;  3LP4 A;  1T4P A;  3E8Q A;  3E6K A;  4FCK A;  4Q3U A;  3GN0 A;  4RHI A;  3NIP A;  1T4S A;  2EF5 A;  4RLA A;  3THE A;  3TH7 A;  4IU5 A;  4Q42 A;  2PHO A;  1WOI A;  3NIO A;  3DJ8 A;  4IE3 A;  3LHL A;  3NIQ A;  1HQF A;  3MFW A;  4IU0 A;  4RHM A;  2ZAV A;  4Q3S A;  3E6V A;  2PHA A;  1GQ6 A;  4DZ4 A;  1XFK A;  1RLA A;  4IXU A;  4Q3R A;  4GSM A;  4IXV A;  3THJ A;  4G3H A;  3THH A;  3CEV A;  1CEV A;  4HXQ A;  1HQX A;  3SJT A;  3E8Z A;  4MYK A;  1HQH A;  1P8O A;  4IE1 A;  4RHK A;  3TF3 A;  1ZPE A;  2AEB A;  2EF4 A;  1WOH A;  1WVB A;  1T5F A;  1T5G A;  1T4T A;  1P8N A;  3M1R A;  1HQG A;  1P8P A;  3LP7 A;  4MYL A;  4Q40 A;  3SL0 A;  3SKK A;  1T4R A;  4Q3T A;  1TBL A;  3GMZ A;  1P8Q A;  1TA1 A;  5HJ9 A;  4Q3V A;  3PZL A;  1P8R A;  4Q41 A;  4GSZ A;  3MMR A;  1HQ5 A;  4IE2 A;  5CEV A;  4FCI A;  4HZE A;  4GSV A;  3MFV A;  4MYF A;  4CEV A;  5HJA A;  4RHJ A;  1WOG A;  4GWC A;  3RLA A;  4I06 A;  4GWD A;  1D3V A;  4Q3Q A;  4ITY A;  4IU4 A;  4HWW A;  2PLL A;  4RHQ A;  1ZPG A;  2RLA A;  4RHL A;  3SL1 A;  3KV2 A;  3MJL A;  2CEV A;  5RLA A;  1TBJ A;  1P8S A;  4Q3P A;  4Q3R C;  1TBH A;  1WVA A;  1GQ7 A;  2EIV A;  1PQ3 A;  4MXR A;  4MYN A;  4IU1 A;  3F80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...