3MKQB

Crystal structure of yeast alpha/betaprime-cop subcomplex of the copi vesicular coat
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
177
structure length
177
Chain Sequence
ALQFVQDPHIRFDLALEYGNLDAALDEAKKLNDSITWERLIQEALAQGNASLAEMIYQTQHSFDKLSFLYLVTGDVNKLSKMQNIAQTREDFGSMLLNTFYNNSTKERSSIFAEGGSLPLAYAVAKANGDEAAASAFLEQAEVDEQDVTLPDQMDASNFVQRPVISKPLEKWPLKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Coatomer beta'-subunit
publication title Structure of coatomer cage proteins and the relationship among COPI, COPII, and clathrin vesicle coats.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 66
structure length 177
sequence length 177
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2010-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.470 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3mkqB00
3MKQB 3MKQA
chains in the Genus database with same CATH superfamily
1HXIA 4L1BA 2P9NG 5FQ4A 1KT0A 4YDEA 1KZOA 3FUJA 3HXFA 3JQ0A 4I1AA 1KZPA 3FUEA 1SA4A 3MZLB 4GB9A 5FZQA 5BXOA 1TN6A 2JLBA 2VTBB 4WWOA 1OXJA 4N39A 4U07A 3DSSA 3DSTA 1JCRA 1N94A 5ENOD 4G23A 1E8ZA 4HQDA 2HE0A 3SGHA 4OAVB 2V8SE 5JJ6A 1TEZA 2XQ0A 3L6AA 3CK8A 1TNUA 3L22A 4HNAD 2GROB 4N5CA 4ILGA 2X6HA 3UM1A 4DUIA 3UTMA 3KD7A 2XGOA 3AG4E 4KYOB 3CVVA 4F6RD 3SBSA 5A23A 2EIKE 4HXIA 5CCLA 3NB2A 3E4BA 5KNHD 3CVQA 5ENQD 3TWRA 3O4ZA 4HLEA 5BT1A 1DC2A 1TNZA 3TL5A 4GTQA 4TXPA 4K0RA 4Q96A 1N4PA 2XENA 3N71A 3GZSA 3CHMA 1HX8A 3CLJA 3CVUA 3PH0C 4P29A 5ENSD 3AU5A 2QC9A 2FO7A 2A5EA 4CEMA 4ZFHA 3FTSA 2IEJA 4LSZE 5JA4D 2DYSE 4JXTA 3R9MA 4ANWA 1IHGA 4YDWA 5LCWC 2VYIA 3MKRA 2MOWA 4RLYA 1OWMA 4XIFA 2OEVA 5HRYA 4GU5A 3QC1A 5CMYA 2X3MA 1N52A 2LUHA 5ITZF 2WXIA 4GYYA 4GTTA 4KT6B 3C3OA 1TJFA 2OVBA 4HOUA 2GRRB 2Q7FA 2L6JA 4DLOA 4CT0A 4XI0A 5AQ9A 2LSVA 4G25A 3BU8A 3KS2A 3FEYA 5A7DB 4KVMA 1D8DA 4C48B 2DVWA 5EX0A 2P9LG 4FA6A 1QYMA 2VQ2A 3D9LA 5LX8A 3QDNA 2GRQB 3QAQA 1TNOA 3SFYA 3IHVA 3ZHEB 4ANUA 2ZGDA 3CVYA 3HXEA 3Q78A 4GTRA 4IYPA 4X8QA 1DVPA 4HOSA 2DCPA 2IY0C 3HDXA 2VGXB 5G04J 1H2TC 3UMVA 4OVVA 1MHQA 4G26A 4N2QA 5D2MC 5FQ7A 4HB5A 2VTBA 1OCOE 4QFVA 1QNFA 3LY9A 4XKCA 3AAAC 5JHBA 4O1OA 4A55A 4B89A 3QWWA 5T4YA 2QY7A 2CG3A 1MQSA 3APCA 3UXGA 4LNBA 1TN8A 3T5VA 2LAHA 3ULYA 3QOUA 5FZSA 1OUVA 2WM9A 4IRUA 3PUJA 5ENRD 1Z5SC 3LXUX 3UIOC 2PQNA 2LAIA 2H6GA 3UM0A 3NOCD 3FTUA 1S70B 1NA3A 3E33A 3MX3A 3FU6A 4ANVA 4RQIA 2R2LA 4GPMA 3Q15A 4ANXA 2WQ6A 1A17A 3JCKC 2YNQA 1WM5A 2QYJA 3EU9A 5E75A 3ESKA 3GW4A 2HO1A 5KJKA 4YVQC 1HG2A 2CFZA 2OOEA 4J8EA 3ZN3A 2FO1E 2VGEA 3CHPA 4HORA 1MYOA 3SY2A 4LCTA 4AIFA 3GZ1A 3APDA 4U04A 4BEPA 2WB2A 1NFIE 3UT4A 1N54A 3B7UX 5AIJA 3DXMG 4U63A 2PQRA 2DBAA 2R05A 2P58C 3ENEA 4JC8A 3PZ1A 5EX3A 4BX9A 1X81A 2XEVA 3OTNA 2UY1B 3HXCA 4GA1A 3FH5A 2GRPB 2JEKA 1YA0A 4EBAG 4O6FA 2P9UG 2V4HC 3L17A 1N11A 1LTXA 5CMWA 4HBDA 1FPPA 2AVPA 5BW8C 2NSZA 3TGOA 3ZHEA 1PC2A 2CHXA 4AOFA 2IQCA 4BY6A 5FWQA 4XI9A 4DX6D 3NZUA 2VGXA 3Q5MA 2VSOE 2DZNA 3Q4AB 2ZGGA 1E8WA 2DWZA 3KEZA 1HO8A 4XE0A 2IOSA 2NXPA 4EPZA 5BXUA 1S64A 4G24A 4FLBA 2WVIA 1MX6A 2IONA 3RIBA 2Y1LE 1HFAA 5A6CA 4U95D 3AG1E 2WXPA 4F53A 3G2WA 2WXQA 3L08A 3HIZA 1E96B 1Q2ZA 4JHRA 2J08A 4GYOA 4V3IA 3SI5A 4FU3A 3FDHA 3KSLA 3CGHA 4ILHB 5JMND 3RRNB 2BUGA 3NOGD 3KEAA 2YQ8A 4XKBA 4PUCA 1D9SA 1ZU2A 2FBNA 5LFAA 1Y6IA 1IQUA 2CG2A 2Y4UA 4WNFA 2Y4TA 1H6PA 2OV8A 3MV2B 4EECA 2PNNA 1WAO1 3U9WA 3EDTB 2WXHA 3QNKA 4FJZA 5KBAA 5AN8A 3NF1A 4B8CB 3VLEA 4EZJA 1UN9A 4HOTA 3U4TA 4G2VA 5HS0A 3MJWA 4GZ6A 4APOA 3FUDA 2BKGA 2IJGX 4QQIA 3U66A 4JEUA 3ZYMA 2F8XK 2P2CP 4C9BB 3LEWA 3FTXA 2BF0X 2OVFA 5CEDB 4LUNU 4OVUA 2KZTB 4Q69A 4K5BA 2IF4A 4BETA 3R7QA 3IXEA 1HE8A 4G8LA 3PDNA 4KBQA 3J5PA 4CGWA 4I17A 3L82A 4TXQA 1EYHA 2I6HA 3G2VA 3DPDA 5LOZA 3B7BA 1U3DA 3BEEA 3TG5A 1MJ0A 5DIZA 1IQRA 4ZHBA 3I5PA 4LRZA 4ACKA 4PS8A 3BG0B 3D9MA 2UY1A 4Y6CA 3DPYA 4N3BA 3ESLA 3UX4A 5KWDA 3F6QA 3KSQA 3Q75A 1WG0A 1PAQA 3S7FA 2CFUA 4DRXE 2VSXE 1Y8MA 3RU0A 2EQXA 1G3NB 2EINE 4ILIA 3FU3A 1NL4A 3L54A 3C3RA 3D3MA 3D9OA 4AP2A 4J0UA 4J8SA 2ZISA 3VLFA 1N95A 2WXOA 5CEAA 1SA5A 4EZLA 3LJNA 1JWGA 3HHMA 1HS6A 1DCEA 3ZVVA 4CRWA 2R5SA 2V5FA 3JYSA 3G2SA 2C0LA 1UG3A 2WXJA 4GZ3A 2L0IA 1BPOA 1OCCE 5FJYA 3HRAA 3ZYQA 3T5XA 1NI1A 3P1UA 1JWFA 3CEQA 4NACA 3SQVA 1OWOA 5AARA 5KNGA 1QQEA 5H7PA 5ARFA 2MYOA 3FEXA 1E7VA 5KCMA 4WWPA 2LO6A 3I4GA 4TXRA 3V2XA 3SHFA 2HYZA 4Q94A 2GRMA 5G05C 3RKVA 1K3ZD 2H6FA 3ASNE 3FTVA 3PREA 2AXVA 2J8SD 3ZPJA 2VSYA 3FH7A 4LG6A 3URZA 2A5UA 1LD8A 3ZIMA 1YMPA 3IHYA 2X6JA 3LVQE 3RJVA 4B8AA 4KZ0A 3FU5A 3FFLA 4E85A 3WG7E 3FP3A 2IO3C 3LYAA 3ZW3A 2ONDA 2VJ8A 3S7DA 3ASDA 2KZTA 5EYLA 2BEDA 2WPVA 4U0UA 3JUEA 3RRUA 1OT8A 4TV3A 5G55A 1X5BA 2ZU6B 2EILE 4I1MA 4I9EA 3D9JA 5ENNA 4GTPA 2ETBA 3TWQA 4U8HA 2XPIA 5AAOA 1HU3A 2PM6A 4BESA 4G8KA 4JA7A 1Z3YA 4CDRA 1A5EA 3Q7AA 4JB8P 4LEUA 5BV0A 1NA0A 4GTOA 4AM9A 3DSXA 2RFMA 5C2YA 4BERA 5CBOA 1H6KA 3QK0A 3SNXA 4EQFA 2HR2A 4ATGA 2Y0BG 1D8EA 1TNYA 4HRNA 3LJ3A 3D9KA 1FT1A 3DSUA 3T8MA 5EILA 1N4QA 4WNGA 4AVXA 5ARGA 1TJCA 2X6IA 3L9TA 1BU9A 3TXMA 3QKYA 2GRNB 1S63A 5AJDA 4FHKA 3TWSA 4HI8A 1B89A 1HZ4A 5CRUA 3HXDA 2BTDA 3ABKE 3FTYA 5B1AE 1UJKA 4UI9C 5CBNA 1SZAA 2H6IA 5JHAA 4UUCA 1ELWA 1E90A 3DXKG 2HM8A 2WXGA 5JJTA 2X6KA 2DYRE 2R59A 4FHJA 4I6JA 5BNWA 1ELKA 2IO2C 2JABA 4RVBA 2XEHA 3UI2A 4HOQA 3ASHA 2P9SG 4U0SA 5EIBE 3V31A 3TAXA 3FUKA 4TUUA 2C0MA 5CERB 3CVLA 3CR3A 3I3NA 4N2SA 3UUXA 2RG8A 3Q7FA 4FJYA 1H19A 2KBXA 4UQZA 1OY3D 3UT8A 1L5JA 3EHQA 4U0ZA 3J5QB 1KT1A 2J49A 1OWPA 4L23A 3NZSA 4BTBA 3FTWA 4YDOA 3WXXA 3LDZA 1V54E 3LS8A 1JUQA 2DZOA 4L9PA 5AJLA 2B0OE 1Z6TA 2V4LA 2J4DA 3T9KA 3PZ2A 3SO8A 1UN8A 3CQGB 3OXFA 1FCHA 5CHEE 1DCQA 2AW6A 3FUMA 1H0AA 4A1SA 4NIKA 4ACLA 4O60A 3FUFA 4DPRA 5JJ7A 4GA2A 4F7AA 2E2EA 5M72A 2BKKB 3CHQA 2IU1A 3PNTB 3AS8A 4ABNA 3MEKA 4GTVA 4GZCA 1QZ2A 4TUMA 3ISMC 1HG5A 2I2OA 4I2WA 5ANRA 2E0IA 2J07A 2PM7A 3EHRA 3FTZA 4BSZB 3W9FA 4Z68A 2I1JA 2WMOA 4H7XA 2L6BA 3AJIA 3CK9A 2IOLA 4U8VD 4N3CA 4GMLA 1SQMA 3PEUB 4K03A 2WXMA 3HVEB 2XGMA 3CKCA 3CIAA 3ZU7B 5AQ7A 2F8YA 3HYMB 3CSTA 2LSUA 1XGWA 2QZAA 5T8IA 3E32A 2XPYA 5CRVA 2I9CA 5AQBA 2XPZA 2KCLA 3AG3E 3DEOA 5FIOA 2WQ7A 5B1BE 2OCCE 5EKQD 5DBKA 4JHKA 4L2LA 4HRLA 2OEWA 3CKBA 4GTMA 5LCWJ 1HH8A 3ABLE 3PNLB 3ASOE 2KCKA 3B13A 5G04C 4BT9A 3NQPA 1YYHA 4FP7A 4JPSA 5CECB 3ZYKA 2I1KA 4F3VA 1DNPA 1K1AA 3AS4A 1OCZE 2XRYA 3SBTB 4PS7A 4AY6A 1IHBA 3L13A 4XX5A 3B7TA 4W9RA 1JPLA 3MGBA 3LCAA 2FI7A 4GTSA 3TWTA 4BX8A 1MZCA 4JW1A 1UW4B 3Q9NC 4BT8A 4I2ZA 5EYPF 3CVNA 2GRLA 4I9CA 4NRHB 1FVHA 5EDSA 3ZFWA 3ML9A 4UQYA 5B3SE 3GYZA 5EIDA 4O1PA 4UWHA 1V55E 3C3QA 3W9GA 1IYGA 3PRZA 5IY5E 1TYQG 3Q79A 3IBEA 1U3CA 2WXNA 4CGVA 5KJMA 2IFUA 4I1OB 4Y6WA 4URKA 1ZB1A 2L9BA 1WDYA 3Q9UC 4NURA 3K9IA 3ZUVB 5BUZA 4AY5A 1SZ9A 3ASFA 2H6HA 4CZ2D 2XS1A 3EJNA 3R7RA 3JQ1A 2AXUA 4J8DA 4OAUC 3UPVA 4DX5D 3BUAA 5EN5D 3LVRE 5CCMA 4HS2A 3MKQB 4LNGA 3HVEA 5FZRA 4EHMA 4D10C 2VGYA 3QB2A 1S0PA 1YCSB 3OXLA 4HFGA 4UWFA 1BI7B 1RW2A 3CVXA 5D0QD 5FTPA 1N0RA 2EIJE 2KXPC 3LPZA 3SFXA 4M7CA 5D0OD 4I6GA 1AP7A 2WXRA 1IKND 3VTXA 4APFA 3P2BA 4MKTA 1HF8A 3C98A 2AXZA 3RRMB 3S7JA 1XNFA 2RD0A 1H6OA 5KJNA 5J90A 3TXNA 3MV3B 4R7LA 4OYSA 2EIME 4J8YA 1P5QA 5HKPA 5FQ6A 1Z3XA 3UT7A 3E37A 4J7WA 4MS6A 1WY6A 3R9AB 5ANLA 2ZIRA 3IKOB 2PZIA 1EDUA 1O1SA 4GMRA 4CT4A 3TWVA 2V0PA 1K1BA 5C1DA 3TG4A 4DJAA 1FVFA 4RSYA 4RG6A 1TNBA 3ZRHA 3LKUA 5BPPA 4L2YA 3C5RA 1LD7A 4GMJA 3ULQA 2P9PG 4JD2G 5ENTD 1PY1A 4GZ5A 4H7YA 2WXLA 2F0YA 4N3AA 2VSNA 4F1SA 1H2UA 2J09A 1ELRA 2XGSA 1KPSB 3RO2A 2AWIA 4HI9A 3U64A 3PE4A 1BD8A 1H2VC 2P9KG 3JUIA 3FY4A 4HVBA 3ZEFA 4BWRA 4I43A 4XEIG 2KC7A 5G2NA 3CSFA 3RAUA 4F1PA 4HRMB 3OAWA 2MRIA 3V30A 3QJZA 4I6EA 2FEZA 4TRQA 4CCAA 1KLXA 3QWPA 4GPKA 4CDNA 1N9AA 2Y3AA 2XCBA 2Y69E 5AYWD 1MX2A 3U3WA 2ILRA 3MKQA 3EIQC 4MBGA 4EZKA 4UQXA 1IXVA 3FUIA 3EUVA 4DLQA 4ATZD 2C2LA 5FT9A 3CHOA 1SVXA 1O5MA 4DX2A 4B0ZA 2P9IG 2R02A 2J4BA 1LF8A 4KXKB 4A1GA 3C72A 3ZNGA 4GYWA 3B7RL 2WXKA 3EHMA 3UQ3A 4UWLA 3Q73A 4GA0A 4GAAA 4EBAA 4N5QA 3UINC 3AG2E 4JZYA 2WXFA 4DI3A 1N4SA 2UWJG 5D66A 5FQ8A 3PEVB 4ME2A 4AV7A 3TWUA 4YDYA 4IULA 3PUKA 3MCXA 4FULA 2YHEA 3E34A 3V2OA 3QARA 1O1RA 3OXGA 3ZXSA 3NAWA 3PE3A 3CHRA 2QYUA 4YNDA 3EU5A 2AJAA 4BFRA 2A4ZA 3RO3A 4DI4A 4XZ4A 3PZDA 4RG9A 3DSVA 1VDYA 2FF4A 3APFA 1O1TA 4E6HA 1UOHA 3EIJA 4K5CA 2YINA 4FC8A 1QBQA 3LY7A 2R17C 3CVWA 3QWVA 3TWWA 3UM2A 1NP7A 3SF4A 2X38A 3CHSA 3FU0A 3GZ2A 4JVSA 2KATA 2RKKA 4C0EA 3S7BA 2RFAA 4PDXA 3D9PA 3AU4A 2B6CA 4NQ0A 4PS3A 1BLXB 3ASGA 3G2UA 2NYJA 3FWVA 3CK7A 4HLLA 4AXHA 3SFZA 4MLPA 4JA9A 3UKUG 3FULA 2NC9A 4DK5A 1MX4A 1U2VG 4KZCA 3FHEA 3VTYA 2ETCA 3Q49B 1JCQA 4KMOA 3AS5A 4WAFA 5KJLA 2LXLA 4A3VA 1OCRE 2XHEA 3ULEG 2XZDG 1EF1C 4BTAA 2WMNA 3FUNA 3FH8A 5T3RA 2CHWA 2PL2A 2LNIA 3FUHA 3JXIA 5AENA 3D9IA 4CDMA 4LERA 4AJWA 4C0MA 4U8YD 2R03A 5J08A 3TWXA 4GZDA 2QFCA 3X2QE 3ZGQA 4AEZC 4JEHA 1GW6A 3V79K 3ONKA 4YVOA 2XRZA 3SD5A 3IEGA 1E8XA 3D9HA 3LY8A 5E76A 4A3TA 4B94A 3DSWA 4K5AB 2KCVA 3D9NA 4WNDA 2X6FA 2V5QC 3NBNB 5BV1A 5G05J 3ONLA 1OWNA 4J8FA 3IV0A 1E8YA 3CVPA 5ENPD 3DEPA 1EPUA 3G2TA 3ZYLA 3PZ3A 4CYMD 4DX7D 3UIPC 5LP0A 3CQCB 3DBSA 4JL0A 3BQOA 1INZA 4IN3B 3HXBA 1ZBPA 4PH4B 1N4RA 3T8KA 2L0TB 5HI7A 4G1TA 2J9QA 5FINA 3E30A 3O48A 3RK6A 3B95A 2FULA 1N0QA 3DWLG 3L16A 3HG0D 2DIWA 3ZKJA 2XS8A 3ABME 1BI8B 5AQAA 1RZ4A 1SW6A 3CV0A 3EHNA 4LNUD 1E7UA 4KVOA 4J6IA 4L7TA 1TR4A 1TN7A 1NZNA 4FADA 3I4RB 2WQHA 4GCNA 3B7SA 2M63A 1OWLA 2F37A 3MA5A 4UWKA 3DRAA 3JXJA 2LXMA 2MHKA 1UJJA 2GW1A 4B93B 1JCSA 1K8KG 4UWGA 3MYVA 2YHCA 4U7EB 2XCCA 1W3BA 4WWNA 3KAEA 4UI9K 2ZXWE 4WUYA 4G11A 4MRUA 3ZXPA 3PZ4A 2CHZA 3Q47B 4A63B 2GGFA 3RSEG 1AWCB 5HQ8A 4DX1A 3BG1B 3UKRG 2XZTG 3S2AA 3TJPA 4WNEA 2KM4A 4M3OA 4FLHA 1FT2A 3UM3A 4BSXA 3PVLA 3VLDA 2XEEA 4UI9J 3ML8A 3PS6A 3SZ7A 2ETAA 4JHJA 4U96D 4GCOA
chains in the Genus database with same CATH topology
1HXIA 1H2VC 1L5JA 2WXPA 3UT8A 4F53A 3G2WA 4L1BA 4U0ZA 1KT1A 5FQ4A 1KT0A 2J49A 2WXQA 1OWPA 3L08A 4L23A 3FUJA 3NZSA 4BTBA 3HIZA 3FTWA 1E96B 3JQ0A 3WXXA 3LDZA 4I1AA 3JUIA 3FUEA 3LS8A 4JHRA 1JUQA 3FY4A 4HVBA 3MZLB 4GB9A 2J08A 4GYOA 4V3IA 3SI5A 3ZEFA 5FZQA 4BWRA 4FU3A 3FDHA 4I43A 3CGHA 2JLBA 2KC7A 3CSFA 4ILHB 5G2NA 2VTBB 3RRNB 2BUGA 5AJLA 4WWOA 3OAWA 2MRIA 1Z6TA 2YQ8A 2V4LA 4N39A 2J4DA 3QJZA 4I6EA 4U07A 4XKBA 4PUCA 2FEZA 1ZU2A 4TRQA 2FBNA 4CCAA 5LFAA 1KLXA 1Y6IA 1IQUA 3QWPA 2CG2A 1UN8A 4G23A 1E8ZA 2Y4UA 3CQGB 4WNFA 2Y4TA 4GPKA 4CDNA 3OXFA 1FCHA 2OV8A 2AW6A 2Y3AA 3MV2B 2XCBA 5CHEE 3FUMA 3SGHA 1H0AA 4EECA 4A1SA 5AYWD 1WAO1 2V8SE 4ACLA 5JJ6A 1TEZA 3FUFA 4DPRA 2XQ0A 3L6AA 5JJ7A 3CK8A 4GA2A 3U9WA 3EDTB 4F7AA 3L22A 2E2EA 3U3WA 2WXHA 2ILRA 3MKQA 4N5CA 3EIQC 4ILGA 2X6HA 3QNKA 4EZKA 4UQXA 4FJZA 5M72A 3FUIA 3CHQA 3NF1A 4B8CB 3VLEA 4DLQA 4EZJA 3KD7A 2C2LA 1UN9A 5FT9A 4HOTA 2IU1A 3CHOA 3PNTB 2XGOA 3AS8A 3U4TA 4G2VA 4ABNA 3MJWA 3MEKA 4GZ6A 4KYOB 4GZCA 3CVVA 4APOA 4B0ZA 1QZ2A 3FUDA 3SBSA 1HG5A 2I2OA 4I2WA 2IJGX 5ANRA 2E0IA 5A23A 2J07A 2PM7A 4HXIA 4JEUA 3ZYMA 5CCLA 3U66A 3FTZA 2J4BA 4C9BB 1LF8A 3LEWA 3FTXA 3E4BA 4KXKB 4A1GA 2BF0X 3CVQA 2I1JA 4GYWA 2WMOA 3O4ZA 4HLEA 2OVFA 3B7RL 2WXKA 5BT1A 3EHMA 4LUNU 4H7XA 3TL5A 4OVUA 2KZTB 4Q69A 3UQ3A 4UWLA 3CK9A 4K0RA 4Q96A 2IOLA 4GA0A 2IF4A 4N3CA 4GAAA 4GMLA 1SQMA 4EBAA 3R7QA 3PEUB 3N71A 3GZSA 1HE8A 4K03A 4JZYA 3PDNA 3CHMA 2WXMA 1HX8A 2WXFA 4KBQA 4DI3A 3HVEB 2UWJG 3CLJA 4CGWA 5FQ8A 3PEVB 3CVUA 4ME2A 3PH0C 4I17A 4AV7A 2XGMA 3CKCA 3CIAA 1EYHA 2I6HA 3G2VA 3DPDA 4P29A 5LOZA 3AU5A 4IULA 2FO7A 4CEMA 3PUKA 3MCXA 4FULA 2YHEA 1U3DA 3FTSA 3BEEA 3QARA 3TG5A 3OXGA 3ZXSA 3PE3A 5DIZA 1IQRA 3CHRA 3HYMB 3I5PA 4JXTA 4LRZA 4ACKA 3CSTA 4PS8A 3BG0B 3D9MA 2LSUA 2UY1A 4Y6CA 4YNDA 4ANWA 1IHGA 5LCWC 4N3BA 1XGWA 3ESLA 2VYIA 5T8IA 3UX4A 3MKRA 2XPYA 4BFRA 2MOWA 2A4ZA 4XIFA 1OWMA 3RO3A 4DI4A 2I9CA 4XZ4A 1PAQA 3S7FA 2CFUA 3PZDA 4GU5A 2VSXE 4RG9A 1Y8MA 2XPZA 1VDYA 2FF4A 3QC1A 5CMYA 2X3MA 1N52A 3APFA 2KCLA 3RU0A 2EQXA 2WQ7A 2WXIA 4E6HA 4ILIA 3FU3A 3EIJA 3L54A 2YINA 4FC8A 4GYYA 5DBKA 5EKQD 4KT6B 4JHKA 1TJFA 4L2LA 3LY7A 2OVBA 2R17C 3CVWA 3D3MA 3QWVA 3CKBA 3D9OA 4HOUA 5LCWJ 4AP2A 1HH8A 1NP7A 2Q7FA 2L6JA 4J8SA 3PNLB 4J0UA 3VLFA 2WXOA 2KCKA 4CT0A 3SF4A 4DLOA 4XI0A 3B13A 4EZLA 2LSVA 5G04C 1JWGA 3HHMA 4G25A 1HS6A 3KS2A 2X38A 3CHSA 3FU0A 3FEYA 3GZ2A 3NQPA 4JVSA 5A7DB 3ZVVA 4BT9A 4KVMA 2KATA 4FP7A 4JPSA 3ZYKA 4C0EA 2I1KA 3S7BA 4F3VA 1DNPA 4CRWA 4PDXA 5EX0A 3D9PA 3AS4A 2R5SA 4FA6A 2XRYA 3AU4A 2V5FA 3JYSA 3SBTB 4NQ0A 4PS3A 2VQ2A 2C0LA 3D9LA 3G2SA 1UG3A 2WXJA 4GZ3A 3ASGA 3G2UA 3QDNA 4PS7A 5LX8A 2L0IA 3QAQA 4AY6A 3FWVA 3CK7A 3L13A 3SFZA 4AXHA 3IHVA 1BPOA 3ZHEB 4MLPA 4XX5A 4ANUA 5FJYA 3ZYQA 3B7TA 3T5XA 4JA9A 4W9RA 3CVYA 1JPLA 3FULA 2NC9A 3P1UA 1JWFA 4IYPA 3CEQA 4DK5A 3MGBA 4NACA 1DVPA 3LCAA 4HOSA 1OWOA 2DCPA 2FI7A 4KZCA 3HDXA 2VGXB 1QQEA 5ARFA 5G04J 3FHEA 1H2TC 3UMVA 3VTYA 4OVVA 3Q49B 1MHQA 4G26A 4BX8A 4KMOA 4N2QA 3AS5A 4WAFA 5FQ7A 3FEXA 4JW1A 5KJLA 1E7VA 4A3VA 5KCMA 2XHEA 4WWPA 1UW4B 2VTBA 4BT8A 2LO6A 4I2ZA 4QFVA 1QNFA 3I4GA 1EF1C 3CVNA 3LY9A 2WMNA 3FUNA 4BTAA 2GRLA 4I9CA 4NRHB 3SHFA 1FVHA 3FH8A 2CHWA 2PL2A 5T3RA 2HYZA 2LNIA 3ZFWA 4XKCA 5EDSA 3FUHA 3ML9A 5AENA 3D9IA 4CDMA 4UQYA 4LERA 4Q94A 4AJWA 2GRMA 4C0MA 3GYZA 5JHBA 5G05C 4A55A 3RKVA 4B89A 3QWWA 4UWHA 5T4YA 5J08A 2QY7A 4GZDA 2QFCA 2CG3A 3ZGQA 1MQSA 3FTVA 4AEZC 3PREA 3APCA 4JEHA 2AXVA 1GW6A 1IYGA 3ONKA 3PRZA 3ZPJA 2VSYA 4YVOA 2XRZA 3SD5A 3IEGA 2LAHA 1E8XA 3FH7A 3URZA 3T5VA 4B94A 2A5UA 3LY8A 5E76A 4A3TA 3QOUA 3IBEA 3ZIMA 1U3CA 5FZSA 1OUVA 2WM9A 4IRUA 2WXNA 3PUJA 4CGVA 5KJMA 3IHYA 2IFUA 2KCVA 3D9NA 4WNDA 3LXUX 4I1OB 4Y6WA 4URKA 2X6JA 3LVQE 3RJVA 4B8AA 4KZ0A 3FU5A 2X6FA 2PQNA 2LAIA 2L9BA 3FFLA 5BV1A 4E85A 5G05J 4NURA 3FTUA 3FP3A 1OWNA 3K9IA 3ONLA 5BUZA 4J8FA 4AY5A 3IV0A 1E8YA 3CVPA 1NA3A 3LYAA 1SZ9A 3ASFA 1EPUA 3MX3A 3FU6A 2ONDA 2VJ8A 3S7DA 3ZW3A 3EJNA 3ASDA 4ANVA 3G2TA 3ZYLA 2KZTA 3R7RA 3JQ1A 2AXUA 4J8DA 3UPVA 3Q15A 2WPVA 5LP0A 4U0UA 3CQCB 3DBSA 4ANXA 2WQ6A 4JL0A 3RRUA 3LVRE 5CCMA 4HS2A 1A17A 1INZA 3JCKC 1X5BA 3MKQB 2ZU6B 1ZBPA 4IN3B 3HVEA 4PH4B 4TV3A 5FZRA 5G55A 2YNQA 1WM5A 4D10C 2VGYA 2L0TB 3QB2A 1S0PA 5HI7A 4G1TA 5E75A 2J9QA 3O48A 3OXLA 4I1MA 3ESKA 3GW4A 4I9EA 4HFGA 2HO1A 3RK6A 3D9JA 5KJKA 4UWFA 5ENNA 4YVQC 1HG2A 2CFZA 2FULA 3CVXA 5D0QD 3L16A 2OOEA 4J8EA 2DIWA 3ZN3A 4U8HA 5FTPA 3CHPA 2XPIA 4HORA 1HU3A 2PM6A 4LCTA 3CV0A 3EHNA 4AIFA 3LPZA 3GZ1A 3APDA 4JA7A 4U04A 1E7UA 5D0OD 2WB2A 1Z3YA 4I6GA 4KVOA 4J6IA 2WXRA 4L7TA 3UT4A 3VTXA 4CDRA 1N54A 4LEUA 5BV0A 1NA0A 4APFA 1NZNA 3P2BA 4AM9A 4FADA 3B7UX 5C2YA 4MKTA 5AIJA 1HF8A 3C98A 3I4RB 1H6KA 2WQHA 2AXZA 3RRMB 3QK0A 4U63A 3SNXA 4EQFA 2HR2A 3S7JA 1XNFA 4ATGA 4GCNA 2RD0A 5KJNA 2PQRA 5J90A 3TXNA 3B7SA 2DBAA 3MV3B 2M63A 2P58C 3ENEA 4OYSA 4JC8A 1OWLA 3LJ3A 3MA5A 4R7LA 4UWKA 3D9KA 5EX3A 1P5QA 3T8MA 4BX9A 5FQ6A 2XEVA 1Z3XA 3OTNA 4WNGA 4AVXA 3UT7A 2UY1B 5ARGA 4MS6A 2MHKA 1WY6A 4GA1A 1TJCA 1UJJA 2X6IA 3R9AB 5ANLA 3FH5A 2GW1A 2JEKA 3IKOB 2PZIA 3TXMA 1YA0A 4EBAG 1EDUA 4O6FA 4UWGA 3QKYA 3L17A 3MYVA 5AJDA 2YHCA 4FHKA 5CMWA 2XCCA 4CT4A 1W3BA 4WWNA 1B89A 3KAEA 1HZ4A 2V0PA 2AVPA 4UI9K 5BW8C 2BTDA 2NSZA 3TGOA 3ZHEA 5C1DA 3FTYA 4WUYA 1PC2A 4G11A 4MRUA 3TG4A 1UJKA 4UI9C 1SZAA 2CHXA 4DJAA 4AOFA 2IQCA 4BY6A 1FVFA 4RSYA 5FWQA 5JHAA 4RG6A 2CHZA 1ELWA 1E90A 3Q47B 4XI9A 3ZRHA 3LKUA 5BPPA 2GGFA 3NZUA 2VGXA 2HM8A 4L2YA 5HQ8A 2WXGA 4GMJA 5JJTA 3Q5MA 3ULQA 4UQZA 2VSOE 2X6KA 2R59A 4FHJA 4I6JA 5BNWA 1ELKA 1PY1A 3Q4AB 1E8WA 3KEZA 1HO8A 3BG1B 4GZ5A 4XE0A 4H7YA 2IOSA 4RVBA 3S2AA 4HOQA 3TJPA 2WXLA 2KM4A 4M3OA 4WNEA 3ASHA 2NXPA 4FLHA 4N3AA 4EPZA 4U0SA 2VSNA 4G24A 4F1SA 3TAXA 1H2UA 3FUKA 4TUUA 2C0MA 4BSXA 3PVLA 2J09A 4FLBA 3CVLA 3CR3A 2WVIA 3I3NA 1ELRA 2XGSA 3VLDA 4UI9J 4N2SA 3ML8A 3UUXA 2IONA 2RG8A 3RIBA 3RO2A 3PS6A 1HFAA 2AWIA 5A6CA 3SZ7A 4FJYA 4JHJA 1H19A 3U64A 4GCOA 3PE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MKQ B;  3MKQ A; 
#chains in the Genus database with same CATH topology
 1HXI A;  4L1B A;  2P9N G;  5FQ4 A;  1KT0 A;  4YDE A;  1KZO A;  3FUJ A;  3HXF A;  3JQ0 A;  4I1A A;  1KZP A;  3FUE A;  1SA4 A;  3MZL B;  4GB9 A;  5FZQ A;  5BXO A;  1TN6 A;  2JLB A;  2VTB B;  4WWO A;  1OXJ A;  4N39 A;  4U07 A;  3DSS A;  3DST A;  1JCR A;  1N94 A;  5ENO D;  4G23 A;  1E8Z A;  4HQD A;  2HE0 A;  3SGH A;  4OAV B;  2V8S E;  5JJ6 A;  1TEZ A;  2XQ0 A;  3L6A A;  3CK8 A;  1TNU A;  3L22 A;  4HNA D;  2GRO B;  4N5C A;  4ILG A;  2X6H A;  3UM1 A;  4DUI A;  3UTM A;  3KD7 A;  2XGO A;  3AG4 E;  4KYO B;  3CVV A;  4F6R D;  3SBS A;  5A23 A;  2EIK E;  4HXI A;  5CCL A;  3NB2 A;  3E4B A;  5KNH D;  3CVQ A;  5ENQ D;  3TWR A;  3O4Z A;  4HLE A;  5BT1 A;  1DC2 A;  1TNZ A;  3TL5 A;  4GTQ A;  4TXP A;  4K0R A;  4Q96 A;  1N4P A;  2XEN A;  3N71 A;  3GZS A;  3CHM A;  1HX8 A;  3CLJ A;  3CVU A;  3PH0 C;  4P29 A;  5ENS D;  3AU5 A;  2QC9 A;  2FO7 A;  2A5E A;  4CEM A;  4ZFH A;  3FTS A;  2IEJ A;  4LSZ E;  5JA4 D;  2DYS E;  4JXT A;  3R9M A;  4ANW A;  1IHG A;  4YDW A;  5LCW C;  2VYI A;  3MKR A;  2MOW A;  4RLY A;  1OWM A;  4XIF A;  2OEV A;  5HRY A;  4GU5 A;  3QC1 A;  5CMY A;  2X3M A;  1N52 A;  2LUH A;  5ITZ F;  2WXI A;  4GYY A;  4GTT A;  4KT6 B;  3C3O A;  1TJF A;  2OVB A;  4HOU A;  2GRR B;  2Q7F A;  2L6J A;  4DLO A;  4CT0 A;  4XI0 A;  5AQ9 A;  2LSV A;  4G25 A;  3BU8 A;  3KS2 A;  3FEY A;  5A7D B;  4KVM A;  1D8D A;  4C48 B;  2DVW A;  5EX0 A;  2P9L G;  4FA6 A;  1QYM A;  2VQ2 A;  3D9L A;  5LX8 A;  3QDN A;  2GRQ B;  3QAQ A;  1TNO A;  3SFY A;  3IHV A;  3ZHE B;  4ANU A;  2ZGD A;  3CVY A;  3HXE A;  3Q78 A;  4GTR A;  4IYP A;  4X8Q A;  1DVP A;  4HOS A;  2DCP A;  2IY0 C;  3HDX A;  2VGX B;  5G04 J;  1H2T C;  3UMV A;  4OVV A;  1MHQ A;  4G26 A;  4N2Q A;  5D2M C;  5FQ7 A;  4HB5 A;  2VTB A;  1OCO E;  4QFV A;  1QNF A;  3LY9 A;  4XKC A;  3AAA C;  5JHB A;  4O1O A;  4A55 A;  4B89 A;  3QWW A;  5T4Y A;  2QY7 A;  2CG3 A;  1MQS A;  3APC A;  3UXG A;  4LNB A;  1TN8 A;  3T5V A;  2LAH A;  3ULY A;  3QOU A;  5FZS A;  1OUV A;  2WM9 A;  4IRU A;  3PUJ A;  5ENR D;  1Z5S C;  3LXU X;  3UIO C;  2PQN A;  2LAI A;  2H6G A;  3UM0 A;  3NOC D;  3FTU A;  1S70 B;  1NA3 A;  3E33 A;  3MX3 A;  3FU6 A;  4ANV A;  4RQI A;  2R2L A;  4GPM A;  3Q15 A;  4ANX A;  2WQ6 A;  1A17 A;  3JCK C;  2YNQ A;  1WM5 A;  2QYJ A;  3EU9 A;  5E75 A;  3ESK A;  3GW4 A;  2HO1 A;  5KJK A;  4YVQ C;  1HG2 A;  2CFZ A;  2OOE A;  4J8E A;  3ZN3 A;  2FO1 E;  2VGE A;  3CHP A;  4HOR A;  1MYO A;  3SY2 A;  4LCT A;  4AIF A;  3GZ1 A;  3APD A;  4U04 A;  4BEP A;  2WB2 A;  1NFI E;  3UT4 A;  1N54 A;  3B7U X;  5AIJ A;  3DXM G;  4U63 A;  2PQR A;  2DBA A;  2R05 A;  2P58 C;  3ENE A;  4JC8 A;  3PZ1 A;  5EX3 A;  4BX9 A;  1X81 A;  2XEV A;  3OTN A;  2UY1 B;  3HXC A;  4GA1 A;  3FH5 A;  2GRP B;  2JEK A;  1YA0 A;  4EBA G;  4O6F A;  2P9U G;  2V4H C;  3L17 A;  1N11 A;  1LTX A;  5CMW A;  4HBD A;  1FPP A;  2AVP A;  5BW8 C;  2NSZ A;  3TGO A;  3ZHE A;  1PC2 A;  2CHX A;  4AOF A;  2IQC A;  4BY6 A;  5FWQ A;  4XI9 A;  4DX6 D;  3NZU A;  2VGX A;  3Q5M A;  2VSO E;  2DZN A;  3Q4A B;  2ZGG A;  1E8W A;  2DWZ A;  3KEZ A;  1HO8 A;  4XE0 A;  2IOS A;  2NXP A;  4EPZ A;  5BXU A;  1S64 A;  4G24 A;  4FLB A;  2WVI A;  1MX6 A;  2ION A;  3RIB A;  2Y1L E;  1HFA A;  5A6C A;  4U95 D;  3AG1 E;  2WXP A;  4F53 A;  3G2W A;  2WXQ A;  3L08 A;  3HIZ A;  1E96 B;  1Q2Z A;  4JHR A;  2J08 A;  4GYO A;  4V3I A;  3SI5 A;  4FU3 A;  3FDH A;  3KSL A;  3CGH A;  4ILH B;  5JMN D;  3RRN B;  2BUG A;  3NOG D;  3KEA A;  2YQ8 A;  4XKB A;  4PUC A;  1D9S A;  1ZU2 A;  2FBN A;  5LFA A;  1Y6I A;  1IQU A;  2CG2 A;  2Y4U A;  4WNF A;  2Y4T A;  1H6P A;  2OV8 A;  3MV2 B;  4EEC A;  2PNN A;  1WAO 1;  3U9W A;  3EDT B;  2WXH A;  3QNK A;  4FJZ A;  5KBA A;  5AN8 A;  3NF1 A;  4B8C B;  3VLE A;  4EZJ A;  1UN9 A;  4HOT A;  3U4T A;  4G2V A;  5HS0 A;  3MJW A;  4GZ6 A;  4APO A;  3FUD A;  2BKG A;  2IJG X;  4QQI A;  3U66 A;  4JEU A;  3ZYM A;  2F8X K;  2P2C P;  4C9B B;  3LEW A;  3FTX A;  2BF0 X;  2OVF A;  5CED B;  4LUN U;  4OVU A;  2KZT B;  4Q69 A;  4K5B A;  2IF4 A;  4BET A;  3R7Q A;  3IXE A;  1HE8 A;  4G8L A;  3PDN A;  4KBQ A;  3J5P A;  4CGW A;  4I17 A;  3L82 A;  4TXQ A;  1EYH A;  2I6H A;  3G2V A;  3DPD A;  5LOZ A;  3B7B A;  1U3D A;  3BEE A;  3TG5 A;  1MJ0 A;  5DIZ A;  1IQR A;  4ZHB A;  3I5P A;  4LRZ A;  4ACK A;  4PS8 A;  3BG0 B;  3D9M A;  2UY1 A;  4Y6C A;  3DPY A;  4N3B A;  3ESL A;  3UX4 A;  5KWD A;  3F6Q A;  3KSQ A;  3Q75 A;  1WG0 A;  1PAQ A;  3S7F A;  2CFU A;  4DRX E;  2VSX E;  1Y8M A;  3RU0 A;  2EQX A;  1G3N B;  2EIN E;  4ILI A;  3FU3 A;  1NL4 A;  3L54 A;  3C3R A;  3D3M A;  3D9O A;  4AP2 A;  4J0U A;  4J8S A;  2ZIS A;  3VLF A;  1N95 A;  2WXO A;  5CEA A;  1SA5 A;  4EZL A;  3LJN A;  1JWG A;  3HHM A;  1HS6 A;  1DCE A;  3ZVV A;  4CRW A;  2R5S A;  2V5F A;  3JYS A;  3G2S A;  2C0L A;  1UG3 A;  2WXJ A;  4GZ3 A;  2L0I A;  1BPO A;  1OCC E;  5FJY A;  3HRA A;  3ZYQ A;  3T5X A;  1NI1 A;  3P1U A;  1JWF A;  3CEQ A;  4NAC A;  3SQV A;  1OWO A;  5AAR A;  5KNG A;  1QQE A;  5H7P A;  5ARF A;  2MYO A;  3FEX A;  1E7V A;  5KCM A;  4WWP A;  2LO6 A;  3I4G A;  4TXR A;  3V2X A;  3SHF A;  2HYZ A;  4Q94 A;  2GRM A;  5G05 C;  3RKV A;  1K3Z D;  2H6F A;  3ASN E;  3FTV A;  3PRE A;  2AXV A;  2J8S D;  3ZPJ A;  2VSY A;  3FH7 A;  4LG6 A;  3URZ A;  2A5U A;  1LD8 A;  3ZIM A;  1YMP A;  3IHY A;  2X6J A;  3LVQ E;  3RJV A;  4B8A A;  4KZ0 A;  3FU5 A;  3FFL A;  4E85 A;  3WG7 E;  3FP3 A;  2IO3 C;  3LYA A;  3ZW3 A;  2OND A;  2VJ8 A;  3S7D A;  3ASD A;  2KZT A;  5EYL A;  2BED A;  2WPV A;  4U0U A;  3JUE A;  3RRU A;  1OT8 A;  4TV3 A;  5G55 A;  1X5B A;  2ZU6 B;  2EIL E;  4I1M A;  4I9E A;  3D9J A;  5ENN A;  4GTP A;  2ETB A;  3TWQ A;  4U8H A;  2XPI A;  5AAO A;  1HU3 A;  2PM6 A;  4BES A;  4G8K A;  4JA7 A;  1Z3Y A;  4CDR A;  1A5E A;  3Q7A A;  4JB8 P;  4LEU A;  5BV0 A;  1NA0 A;  4GTO A;  4AM9 A;  3DSX A;  2RFM A;  5C2Y A;  4BER A;  5CBO A;  1H6K A;  3QK0 A;  3SNX A;  4EQF A;  2HR2 A;  4ATG A;  2Y0B G;  1D8E A;  1TNY A;  4HRN A;  3LJ3 A;  3D9K A;  1FT1 A;  3DSU A;  3T8M A;  5EIL A;  1N4Q A;  4WNG A;  4AVX A;  5ARG A;  1TJC A;  2X6I A;  3L9T A;  1BU9 A;  3TXM A;  3QKY A;  2GRN B;  1S63 A;  5AJD A;  4FHK A;  3TWS A;  4HI8 A;  1B89 A;  1HZ4 A;  5CRU A;  3HXD A;  2BTD A;  3ABK E;  3FTY A;  5B1A E;  1UJK A;  4UI9 C;  5CBN A;  1SZA A;  2H6I A;  5JHA A;  4UUC A;  1ELW A;  1E90 A;  3DXK G;  2HM8 A;  2WXG A;  5JJT A;  2X6K A;  2DYR E;  2R59 A;  4FHJ A;  4I6J A;  5BNW A;  1ELK A;  2IO2 C;  2JAB A;  4RVB A;  2XEH A;  3UI2 A;  4HOQ A;  3ASH A;  2P9S G;  4U0S A;  5EIB E;  3V31 A;  3TAX A;  3FUK A;  4TUU A;  2C0M A;  5CER B;  3CVL A;  3CR3 A;  3I3N A;  4N2S A;  3UUX A;  2RG8 A;  3Q7F A;  4FJY A;  1H19 A;  2KBX A;  4UQZ A;  1OY3 D;  3UT8 A;  1L5J A;  3EHQ A;  4U0Z A;  3J5Q B;  1KT1 A;  2J49 A;  1OWP A;  4L23 A;  3NZS A;  4BTB A;  3FTW A;  4YDO A;  3WXX A;  3LDZ A;  1V54 E;  3LS8 A;  1JUQ A;  2DZO A;  4L9P A;  5AJL A;  2B0O E;  1Z6T A;  2V4L A;  2J4D A;  3T9K A;  3PZ2 A;  3SO8 A;  1UN8 A;  3CQG B;  3OXF A;  1FCH A;  5CHE E;  1DCQ A;  2AW6 A;  3FUM A;  1H0A A;  4A1S A;  4NIK A;  4ACL A;  4O60 A;  3FUF A;  4DPR A;  5JJ7 A;  4GA2 A;  4F7A A;  2E2E A;  5M72 A;  2BKK B;  3CHQ A;  2IU1 A;  3PNT B;  3AS8 A;  4ABN A;  3MEK A;  4GTV A;  4GZC A;  1QZ2 A;  4TUM A;  3ISM C;  1HG5 A;  2I2O A;  4I2W A;  5ANR A;  2E0I A;  2J07 A;  2PM7 A;  3EHR A;  3FTZ A;  4BSZ B;  3W9F A;  4Z68 A;  2I1J A;  2WMO A;  4H7X A;  2L6B A;  3AJI A;  3CK9 A;  2IOL A;  4U8V D;  4N3C A;  4GML A;  1SQM A;  3PEU B;  4K03 A;  2WXM A;  3HVE B;  2XGM A;  3CKC A;  3CIA A;  3ZU7 B;  5AQ7 A;  2F8Y A;  3HYM B;  3CST A;  2LSU A;  1XGW A;  2QZA A;  5T8I A;  3E32 A;  2XPY A;  5CRV A;  2I9C A;  5AQB A;  2XPZ A;  2KCL A;  3AG3 E;  3DEO A;  5FIO A;  2WQ7 A;  5B1B E;  2OCC E;  5EKQ D;  5DBK A;  4JHK A;  4L2L A;  4HRL A;  2OEW A;  3CKB A;  4GTM A;  5LCW J;  1HH8 A;  3ABL E;  3PNL B;  3ASO E;  2KCK A;  3B13 A;  5G04 C;  4BT9 A;  3NQP A;  1YYH A;  4FP7 A;  4JPS A;  5CEC B;  3ZYK A;  2I1K A;  4F3V A;  1DNP A;  1K1A A;  3AS4 A;  1OCZ E;  2XRY A;  3SBT B;  4PS7 A;  4AY6 A;  1IHB A;  3L13 A;  4XX5 A;  3B7T A;  4W9R A;  1JPL A;  3MGB A;  3LCA A;  2FI7 A;  4GTS A;  3TWT A;  4BX8 A;  1MZC A;  4JW1 A;  1UW4 B;  3Q9N C;  4BT8 A;  4I2Z A;  5EYP F;  3CVN A;  2GRL A;  4I9C A;  4NRH B;  1FVH A;  5EDS A;  3ZFW A;  3ML9 A;  4UQY A;  5B3S E;  3GYZ A;  5EID A;  4O1P A;  4UWH A;  1V55 E;  3C3Q A;  3W9G A;  1IYG A;  3PRZ A;  5IY5 E;  1TYQ G;  3Q79 A;  3IBE A;  1U3C A;  2WXN A;  4CGV A;  5KJM A;  2IFU A;  4I1O B;  4Y6W A;  4URK A;  1ZB1 A;  2L9B A;  1WDY A;  3Q9U C;  4NUR A;  3K9I A;  3ZUV B;  5BUZ A;  4AY5 A;  1SZ9 A;  3ASF A;  2H6H A;  4CZ2 D;  2XS1 A;  3EJN A;  3R7R A;  3JQ1 A;  2AXU A;  4J8D A;  4OAU C;  3UPV A;  4DX5 D;  3BUA A;  5EN5 D;  3LVR E;  5CCM A;  4HS2 A;  3MKQ B;  4LNG A;  3HVE A;  5FZR A;  4EHM A;  4D10 C;  2VGY A;  3QB2 A;  1S0P A;  1YCS B;  3OXL A;  4HFG A;  4UWF A;  1BI7 B;  1RW2 A;  3CVX A;  5D0Q D;  5FTP A;  1N0R A;  2EIJ E;  2KXP C;  3LPZ A;  3SFX A;  4M7C A;  5D0O D;  4I6G A;  1AP7 A;  2WXR A;  1IKN D;  3VTX A;  4APF A;  3P2B A;  4MKT A;  1HF8 A;  3C98 A;  2AXZ A;  3RRM B;  3S7J A;  1XNF A;  2RD0 A;  1H6O A;  5KJN A;  5J90 A;  3TXN A;  3MV3 B;  4R7L A;  4OYS A;  2EIM E;  4J8Y A;  1P5Q A;  5HKP A;  5FQ6 A;  1Z3X A;  3UT7 A;  3E37 A;  4J7W A;  4MS6 A;  1WY6 A;  3R9A B;  5ANL A;  2ZIR A;  3IKO B;  2PZI A;  1EDU A;  1O1S A;  4GMR A;  4CT4 A;  3TWV A;  2V0P A;  1K1B A;  5C1D A;  3TG4 A;  4DJA A;  1FVF A;  4RSY A;  4RG6 A;  1TNB A;  3ZRH A;  3LKU A;  5BPP A;  4L2Y A;  3C5R A;  1LD7 A;  4GMJ A;  3ULQ A;  2P9P G;  4JD2 G;  5ENT D;  1PY1 A;  4GZ5 A;  4H7Y A;  2WXL A;  2F0Y A;  4N3A A;  2VSN A;  4F1S A;  1H2U A;  2J09 A;  1ELR A;  2XGS A;  1KPS B;  3RO2 A;  2AWI A;  4HI9 A;  3U64 A;  3PE4 A;  1BD8 A;  1H2V C;  2P9K G;  3JUI A;  3FY4 A;  4HVB A;  3ZEF A;  4BWR A;  4I43 A;  4XEI G;  2KC7 A;  5G2N A;  3CSF A;  3RAU A;  4F1P A;  4HRM B;  3OAW A;  2MRI A;  3V30 A;  3QJZ A;  4I6E A;  2FEZ A;  4TRQ A;  4CCA A;  1KLX A;  3QWP A;  4GPK A;  4CDN A;  1N9A A;  2Y3A A;  2XCB A;  2Y69 E;  5AYW D;  1MX2 A;  3U3W A;  2ILR A;  3MKQ A;  3EIQ C;  4MBG A;  4EZK A;  4UQX A;  1IXV A;  3FUI A;  3EUV A;  4DLQ A;  4ATZ D;  2C2L A;  5FT9 A;  3CHO A;  1SVX A;  1O5M A;  4DX2 A;  4B0Z A;  2P9I G;  2R02 A;  2J4B A;  1LF8 A;  4KXK B;  4A1G A;  3C72 A;  3ZNG A;  4GYW A;  3B7R L;  2WXK A;  3EHM A;  3UQ3 A;  4UWL A;  3Q73 A;  4GA0 A;  4GAA A;  4EBA A;  4N5Q A;  3UIN C;  3AG2 E;  4JZY A;  2WXF A;  4DI3 A;  1N4S A;  2UWJ G;  5D66 A;  5FQ8 A;  3PEV B;  4ME2 A;  4AV7 A;  3TWU A;  4YDY A;  4IUL A;  3PUK A;  3MCX A;  4FUL A;  2YHE A;  3E34 A;  3V2O A;  3QAR A;  1O1R A;  3OXG A;  3ZXS A;  3NAW A;  3PE3 A;  3CHR A;  2QYU A;  4YND A;  3EU5 A;  2AJA A;  4BFR A;  2A4Z A;  3RO3 A;  4DI4 A;  4XZ4 A;  3PZD A;  4RG9 A;  3DSV A;  1VDY A;  2FF4 A;  3APF A;  1O1T A;  4E6H A;  1UOH A;  3EIJ A;  4K5C A;  2YIN A;  4FC8 A;  1QBQ A;  3LY7 A;  2R17 C;  3CVW A;  3QWV A;  3TWW A;  3UM2 A;  1NP7 A;  3SF4 A;  2X38 A;  3CHS A;  3FU0 A;  3GZ2 A;  4JVS A;  2KAT A;  2RKK A;  4C0E A;  3S7B A;  2RFA A;  4PDX A;  3D9P A;  3AU4 A;  2B6C A;  4NQ0 A;  4PS3 A;  1BLX B;  3ASG A;  3G2U A;  2NYJ A;  3FWV A;  3CK7 A;  4HLL A;  4AXH A;  3SFZ A;  4MLP A;  4JA9 A;  3UKU G;  3FUL A;  2NC9 A;  4DK5 A;  1MX4 A;  1U2V G;  4KZC A;  3FHE A;  3VTY A;  2ETC A;  3Q49 B;  1JCQ A;  4KMO A;  3AS5 A;  4WAF A;  5KJL A;  2LXL A;  4A3V A;  1OCR E;  2XHE A;  3ULE G;  2XZD G;  1EF1 C;  4BTA A;  2WMN A;  3FUN A;  3FH8 A;  5T3R A;  2CHW A;  2PL2 A;  2LNI A;  3FUH A;  3JXI A;  5AEN A;  3D9I A;  4CDM A;  4LER A;  4AJW A;  4C0M A;  4U8Y D;  2R03 A;  5J08 A;  3TWX A;  4GZD A;  2QFC A;  3X2Q E;  3ZGQ A;  4AEZ C;  4JEH A;  1GW6 A;  3V79 K;  3ONK A;  4YVO A;  2XRZ A;  3SD5 A;  3IEG A;  1E8X A;  3D9H A;  3LY8 A;  5E76 A;  4A3T A;  4B94 A;  3DSW A;  4K5A B;  2KCV A;  3D9N A;  4WND A;  2X6F A;  2V5Q C;  3NBN B;  5BV1 A;  5G05 J;  3ONL A;  1OWN A;  4J8F A;  3IV0 A;  1E8Y A;  3CVP A;  5ENP D;  3DEP A;  1EPU A;  3G2T A;  3ZYL A;  3PZ3 A;  4CYM D;  4DX7 D;  3UIP C;  5LP0 A;  3CQC B;  3DBS A;  4JL0 A;  3BQO A;  1INZ A;  4IN3 B;  3HXB A;  1ZBP A;  4PH4 B;  1N4R A;  3T8K A;  2L0T B;  5HI7 A;  4G1T A;  2J9Q A;  5FIN A;  3E30 A;  3O48 A;  3RK6 A;  3B95 A;  2FUL A;  1N0Q A;  3DWL G;  3L16 A;  3HG0 D;  2DIW A;  3ZKJ A;  2XS8 A;  3ABM E;  1BI8 B;  5AQA A;  1RZ4 A;  1SW6 A;  3CV0 A;  3EHN A;  4LNU D;  1E7U A;  4KVO A;  4J6I A;  4L7T A;  1TR4 A;  1TN7 A;  1NZN A;  4FAD A;  3I4R B;  2WQH A;  4GCN A;  3B7S A;  2M63 A;  1OWL A;  2F37 A;  3MA5 A;  4UWK A;  3DRA A;  3JXJ A;  2LXM A;  2MHK A;  1UJJ A;  2GW1 A;  4B93 B;  1JCS A;  1K8K G;  4UWG A;  3MYV A;  2YHC A;  4U7E B;  2XCC A;  1W3B A;  4WWN A;  3KAE A;  4UI9 K;  2ZXW E;  4WUY A;  4G11 A;  4MRU A;  3ZXP A;  3PZ4 A;  2CHZ A;  3Q47 B;  4A63 B;  2GGF A;  3RSE G;  1AWC B;  5HQ8 A;  4DX1 A;  3BG1 B;  3UKR G;  2XZT G;  3S2A A;  3TJP A;  4WNE A;  2KM4 A;  4M3O A;  4FLH A;  1FT2 A;  3UM3 A;  4BSX A;  3PVL A;  3VLD A;  2XEE A;  4UI9 J;  3ML8 A;  3PS6 A;  3SZ7 A;  2ETA A;  4JHJ A;  4U96 D;  4GCO A; 
#chains in the Genus database with same CATH homology
 1HXI A;  1H2V C;  1L5J A;  2WXP A;  3UT8 A;  4F53 A;  3G2W A;  4L1B A;  4U0Z A;  1KT1 A;  5FQ4 A;  1KT0 A;  2J49 A;  2WXQ A;  1OWP A;  3L08 A;  4L23 A;  3FUJ A;  3NZS A;  4BTB A;  3HIZ A;  3FTW A;  1E96 B;  3JQ0 A;  3WXX A;  3LDZ A;  4I1A A;  3JUI A;  3FUE A;  3LS8 A;  4JHR A;  1JUQ A;  3FY4 A;  4HVB A;  3MZL B;  4GB9 A;  2J08 A;  4GYO A;  4V3I A;  3SI5 A;  3ZEF A;  5FZQ A;  4BWR A;  4FU3 A;  3FDH A;  4I43 A;  3CGH A;  2JLB A;  2KC7 A;  3CSF A;  4ILH B;  5G2N A;  2VTB B;  3RRN B;  2BUG A;  5AJL A;  4WWO A;  3OAW A;  2MRI A;  1Z6T A;  2YQ8 A;  2V4L A;  4N39 A;  2J4D A;  3QJZ A;  4I6E A;  4U07 A;  4XKB A;  4PUC A;  2FEZ A;  1ZU2 A;  4TRQ A;  2FBN A;  4CCA A;  5LFA A;  1KLX A;  1Y6I A;  1IQU A;  3QWP A;  2CG2 A;  1UN8 A;  4G23 A;  1E8Z A;  2Y4U A;  3CQG B;  4WNF A;  2Y4T A;  4GPK A;  4CDN A;  3OXF A;  1FCH A;  2OV8 A;  2AW6 A;  2Y3A A;  3MV2 B;  2XCB A;  5CHE E;  3FUM A;  3SGH A;  1H0A A;  4EEC A;  4A1S A;  5AYW D;  1WAO 1;  2V8S E;  4ACL A;  5JJ6 A;  1TEZ A;  3FUF A;  4DPR A;  2XQ0 A;  3L6A A;  5JJ7 A;  3CK8 A;  4GA2 A;  3U9W A;  3EDT B;  4F7A A;  3L22 A;  2E2E A;  3U3W A;  2WXH A;  2ILR A;  3MKQ A;  4N5C A;  3EIQ C;  4ILG A;  2X6H A;  3QNK A;  4EZK A;  4UQX A;  4FJZ A;  5M72 A;  3FUI A;  3CHQ A;  3NF1 A;  4B8C B;  3VLE A;  4DLQ A;  4EZJ A;  3KD7 A;  2C2L A;  1UN9 A;  5FT9 A;  4HOT A;  2IU1 A;  3CHO A;  3PNT B;  2XGO A;  3AS8 A;  3U4T A;  4G2V A;  4ABN A;  3MJW A;  3MEK A;  4GZ6 A;  4KYO B;  4GZC A;  3CVV A;  4APO A;  4B0Z A;  1QZ2 A;  3FUD A;  3SBS A;  1HG5 A;  2I2O A;  4I2W A;  2IJG X;  5ANR A;  2E0I A;  5A23 A;  2J07 A;  2PM7 A;  4HXI A;  4JEU A;  3ZYM A;  5CCL A;  3U66 A;  3FTZ A;  2J4B A;  4C9B B;  1LF8 A;  3LEW A;  3FTX A;  3E4B A;  4KXK B;  4A1G A;  2BF0 X;  3CVQ A;  2I1J A;  4GYW A;  2WMO A;  3O4Z A;  4HLE A;  2OVF A;  3B7R L;  2WXK A;  5BT1 A;  3EHM A;  4LUN U;  4H7X A;  3TL5 A;  4OVU A;  2KZT B;  4Q69 A;  3UQ3 A;  4UWL A;  3CK9 A;  4K0R A;  4Q96 A;  2IOL A;  4GA0 A;  2IF4 A;  4N3C A;  4GAA A;  4GML A;  1SQM A;  4EBA A;  3R7Q A;  3PEU B;  3N71 A;  3GZS A;  1HE8 A;  4K03 A;  4JZY A;  3PDN A;  3CHM A;  2WXM A;  1HX8 A;  2WXF A;  4KBQ A;  4DI3 A;  3HVE B;  2UWJ G;  3CLJ A;  4CGW A;  5FQ8 A;  3PEV B;  3CVU A;  4ME2 A;  3PH0 C;  4I17 A;  4AV7 A;  2XGM A;  3CKC A;  3CIA A;  1EYH A;  2I6H A;  3G2V A;  3DPD A;  4P29 A;  5LOZ A;  3AU5 A;  4IUL A;  2FO7 A;  4CEM A;  3PUK A;  3MCX A;  4FUL A;  2YHE A;  1U3D A;  3FTS A;  3BEE A;  3QAR A;  3TG5 A;  3OXG A;  3ZXS A;  3PE3 A;  5DIZ A;  1IQR A;  3CHR A;  3HYM B;  3I5P A;  4JXT A;  4LRZ A;  4ACK A;  3CST A;  4PS8 A;  3BG0 B;  3D9M A;  2LSU A;  2UY1 A;  4Y6C A;  4YND A;  4ANW A;  1IHG A;  5LCW C;  4N3B A;  1XGW A;  3ESL A;  2VYI A;  5T8I A;  3UX4 A;  3MKR A;  2XPY A;  4BFR A;  2MOW A;  2A4Z A;  4XIF A;  1OWM A;  3RO3 A;  4DI4 A;  2I9C A;  4XZ4 A;  1PAQ A;  3S7F A;  2CFU A;  3PZD A;  4GU5 A;  2VSX E;  4RG9 A;  1Y8M A;  2XPZ A;  1VDY A;  2FF4 A;  3QC1 A;  5CMY A;  2X3M A;  1N52 A;  3APF A;  2KCL A;  3RU0 A;  2EQX A;  2WQ7 A;  2WXI A;  4E6H A;  4ILI A;  3FU3 A;  3EIJ A;  3L54 A;  2YIN A;  4FC8 A;  4GYY A;  5DBK A;  5EKQ D;  4KT6 B;  4JHK A;  1TJF A;  4L2L A;  3LY7 A;  2OVB A;  2R17 C;  3CVW A;  3D3M A;  3QWV A;  3CKB A;  3D9O A;  4HOU A;  5LCW J;  4AP2 A;  1HH8 A;  1NP7 A;  2Q7F A;  2L6J A;  4J8S A;  3PNL B;  4J0U A;  3VLF A;  2WXO A;  2KCK A;  4CT0 A;  3SF4 A;  4DLO A;  4XI0 A;  3B13 A;  4EZL A;  2LSV A;  5G04 C;  1JWG A;  3HHM A;  4G25 A;  1HS6 A;  3KS2 A;  2X38 A;  3CHS A;  3FU0 A;  3FEY A;  3GZ2 A;  3NQP A;  4JVS A;  5A7D B;  3ZVV A;  4BT9 A;  4KVM A;  2KAT A;  4FP7 A;  4JPS A;  3ZYK A;  4C0E A;  2I1K A;  3S7B A;  4F3V A;  1DNP A;  4CRW A;  4PDX A;  5EX0 A;  3D9P A;  3AS4 A;  2R5S A;  4FA6 A;  2XRY A;  3AU4 A;  2V5F A;  3JYS A;  3SBT B;  4NQ0 A;  4PS3 A;  2VQ2 A;  2C0L A;  3D9L A;  3G2S A;  1UG3 A;  2WXJ A;  4GZ3 A;  3ASG A;  3G2U A;  3QDN A;  4PS7 A;  5LX8 A;  2L0I A;  3QAQ A;  4AY6 A;  3FWV A;  3CK7 A;  3L13 A;  3SFZ A;  4AXH A;  3IHV A;  1BPO A;  3ZHE B;  4MLP A;  4XX5 A;  4ANU A;  5FJY A;  3ZYQ A;  3B7T A;  3T5X A;  4JA9 A;  4W9R A;  3CVY A;  1JPL A;  3FUL A;  2NC9 A;  3P1U A;  1JWF A;  4IYP A;  3CEQ A;  4DK5 A;  3MGB A;  4NAC A;  1DVP A;  3LCA A;  4HOS A;  1OWO A;  2DCP A;  2FI7 A;  4KZC A;  3HDX A;  2VGX B;  1QQE A;  5ARF A;  5G04 J;  3FHE A;  1H2T C;  3UMV A;  3VTY A;  4OVV A;  3Q49 B;  1MHQ A;  4G26 A;  4BX8 A;  4KMO A;  4N2Q A;  3AS5 A;  4WAF A;  5FQ7 A;  3FEX A;  4JW1 A;  5KJL A;  1E7V A;  4A3V A;  5KCM A;  2XHE A;  4WWP A;  1UW4 B;  2VTB A;  4BT8 A;  2LO6 A;  4I2Z A;  4QFV A;  1QNF A;  3I4G A;  1EF1 C;  3CVN A;  3LY9 A;  2WMN A;  3FUN A;  4BTA A;  2GRL A;  4I9C A;  4NRH B;  3SHF A;  1FVH A;  3FH8 A;  2CHW A;  2PL2 A;  5T3R A;  2HYZ A;  2LNI A;  3ZFW A;  4XKC A;  5EDS A;  3FUH A;  3ML9 A;  5AEN A;  3D9I A;  4CDM A;  4UQY A;  4LER A;  4Q94 A;  4AJW A;  2GRM A;  4C0M A;  3GYZ A;  5JHB A;  5G05 C;  4A55 A;  3RKV A;  4B89 A;  3QWW A;  4UWH A;  5T4Y A;  5J08 A;  2QY7 A;  4GZD A;  2QFC A;  2CG3 A;  3ZGQ A;  1MQS A;  3FTV A;  4AEZ C;  3PRE A;  3APC A;  4JEH A;  2AXV A;  1GW6 A;  1IYG A;  3ONK A;  3PRZ A;  3ZPJ A;  2VSY A;  4YVO A;  2XRZ A;  3SD5 A;  3IEG A;  2LAH A;  1E8X A;  3FH7 A;  3URZ A;  3T5V A;  4B94 A;  2A5U A;  3LY8 A;  5E76 A;  4A3T A;  3QOU A;  3IBE A;  3ZIM A;  1U3C A;  5FZS A;  1OUV A;  2WM9 A;  4IRU A;  2WXN A;  3PUJ A;  4CGV A;  5KJM A;  3IHY A;  2IFU A;  2KCV A;  3D9N A;  4WND A;  3LXU X;  4I1O B;  4Y6W A;  4URK A;  2X6J A;  3LVQ E;  3RJV A;  4B8A A;  4KZ0 A;  3FU5 A;  2X6F A;  2PQN A;  2LAI A;  2L9B A;  3FFL A;  5BV1 A;  4E85 A;  5G05 J;  4NUR A;  3FTU A;  3FP3 A;  1OWN A;  3K9I A;  3ONL A;  5BUZ A;  4J8F A;  4AY5 A;  3IV0 A;  1E8Y A;  3CVP A;  1NA3 A;  3LYA A;  1SZ9 A;  3ASF A;  1EPU A;  3MX3 A;  3FU6 A;  2OND A;  2VJ8 A;  3S7D A;  3ZW3 A;  3EJN A;  3ASD A;  4ANV A;  3G2T A;  3ZYL A;  2KZT A;  3R7R A;  3JQ1 A;  2AXU A;  4J8D A;  3UPV A;  3Q15 A;  2WPV A;  5LP0 A;  4U0U A;  3CQC B;  3DBS A;  4ANX A;  2WQ6 A;  4JL0 A;  3RRU A;  3LVR E;  5CCM A;  4HS2 A;  1A17 A;  1INZ A;  3JCK C;  1X5B A;  3MKQ B;  2ZU6 B;  1ZBP A;  4IN3 B;  3HVE A;  4PH4 B;  4TV3 A;  5FZR A;  5G55 A;  2YNQ A;  1WM5 A;  4D10 C;  2VGY A;  2L0T B;  3QB2 A;  1S0P A;  5HI7 A;  4G1T A;  5E75 A;  2J9Q A;  3O48 A;  3OXL A;  4I1M A;  3ESK A;  3GW4 A;  4I9E A;  4HFG A;  2HO1 A;  3RK6 A;  3D9J A;  5KJK A;  4UWF A;  5ENN A;  4YVQ C;  1HG2 A;  2CFZ A;  2FUL A;  3CVX A;  5D0Q D;  3L16 A;  2OOE A;  4J8E A;  2DIW A;  3ZN3 A;  4U8H A;  5FTP A;  3CHP A;  2XPI A;  4HOR A;  1HU3 A;  2PM6 A;  4LCT A;  3CV0 A;  3EHN A;  4AIF A;  3LPZ A;  3GZ1 A;  3APD A;  4JA7 A;  4U04 A;  1E7U A;  5D0O D;  2WB2 A;  1Z3Y A;  4I6G A;  4KVO A;  4J6I A;  2WXR A;  4L7T A;  3UT4 A;  3VTX A;  4CDR A;  1N54 A;  4LEU A;  5BV0 A;  1NA0 A;  4APF A;  1NZN A;  3P2B A;  4AM9 A;  4FAD A;  3B7U X;  5C2Y A;  4MKT A;  5AIJ A;  1HF8 A;  3C98 A;  3I4R B;  1H6K A;  2WQH A;  2AXZ A;  3RRM B;  3QK0 A;  4U63 A;  3SNX A;  4EQF A;  2HR2 A;  3S7J A;  1XNF A;  4ATG A;  4GCN A;  2RD0 A;  5KJN A;  2PQR A;  5J90 A;  3TXN A;  3B7S A;  2DBA A;  3MV3 B;  2M63 A;  2P58 C;  3ENE A;  4OYS A;  4JC8 A;  1OWL A;  3LJ3 A;  3MA5 A;  4R7L A;  4UWK A;  3D9K A;  5EX3 A;  1P5Q A;  3T8M A;  4BX9 A;  5FQ6 A;  2XEV A;  1Z3X A;  3OTN A;  4WNG A;  4AVX A;  3UT7 A;  2UY1 B;  5ARG A;  4MS6 A;  2MHK A;  1WY6 A;  4GA1 A;  1TJC A;  1UJJ A;  2X6I A;  3R9A B;  5ANL A;  3FH5 A;  2GW1 A;  2JEK A;  3IKO B;  2PZI A;  3TXM A;  1YA0 A;  4EBA G;  1EDU A;  4O6F A;  4UWG A;  3QKY A;  3L17 A;  3MYV A;  5AJD A;  2YHC A;  4FHK A;  5CMW A;  2XCC A;  4CT4 A;  1W3B A;  4WWN A;  1B89 A;  3KAE A;  1HZ4 A;  2V0P A;  2AVP A;  4UI9 K;  5BW8 C;  2BTD A;  2NSZ A;  3TGO A;  3ZHE A;  5C1D A;  3FTY A;  4WUY A;  1PC2 A;  4G11 A;  4MRU A;  3TG4 A;  1UJK A;  4UI9 C;  1SZA A;  2CHX A;  4DJA A;  4AOF A;  2IQC A;  4BY6 A;  1FVF A;  4RSY A;  5FWQ A;  5JHA A;  4RG6 A;  2CHZ A;  1ELW A;  1E90 A;  3Q47 B;  4XI9 A;  3ZRH A;  3LKU A;  5BPP A;  2GGF A;  3NZU A;  2VGX A;  2HM8 A;  4L2Y A;  5HQ8 A;  2WXG A;  4GMJ A;  5JJT A;  3Q5M A;  3ULQ A;  4UQZ A;  2VSO E;  2X6K A;  2R59 A;  4FHJ A;  4I6J A;  5BNW A;  1ELK A;  1PY1 A;  3Q4A B;  1E8W A;  3KEZ A;  1HO8 A;  3BG1 B;  4GZ5 A;  4XE0 A;  4H7Y A;  2IOS A;  4RVB A;  3S2A A;  4HOQ A;  3TJP A;  2WXL A;  2KM4 A;  4M3O A;  4WNE A;  3ASH A;  2NXP A;  4FLH A;  4N3A A;  4EPZ A;  4U0S A;  2VSN A;  4G24 A;  4F1S A;  3TAX A;  1H2U A;  3FUK A;  4TUU A;  2C0M A;  4BSX A;  3PVL A;  2J09 A;  4FLB A;  3CVL A;  3CR3 A;  2WVI A;  3I3N A;  1ELR A;  2XGS A;  3VLD A;  4UI9 J;  4N2S A;  3ML8 A;  3UUX A;  2ION A;  2RG8 A;  3RIB A;  3RO2 A;  3PS6 A;  1HFA A;  2AWI A;  5A6C A;  3SZ7 A;  4FJY A;  4JHJ A;  1H19 A;  3U64 A;  4GCO A;  3PE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...