3MKQB

Crystal structure of yeast alpha/betaprime-cop subcomplex of the copi vesicular coat
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
177
structure length
177
Chain Sequence
b'ALQFVQDPHIRFDLALEYGNLDAALDEAKKLNDSITWERLIQEALAQGNASLAEMIYQTQHSFDKLSFLYLVTGDVNKLSKMQNIAQTREDFGSMLLNTFYNNSTKERSSIFAEGGSLPLAYAVAKANGDEAAASAFLEQAEVDEQDVTLPDQMDASNFVQRPVISKPLEKWPLKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Coatomer beta'-subunit
publication title Structure of coatomer cage proteins and the relationship among COPI, COPII, and clathrin vesicle coats.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 66
structure length 177
sequence length 177
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2010-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.470 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3mkqB00
3MKQA 3MKQB
chains in the Genus database with same CATH superfamily
1SA5A 5LCWJ 4I6GA 4LERA 1OCRE 1JWGA 3ZYLA 3Q15A 3JUIA 3IHVA 3NBNB 3B7UX 4OVUA 1D9SA 3GW4A 1P5QA 4XI9A 1K8KG 4F1SA 5FWQA 5B1BE 3RK6A 3APCA 1FCHA 5C2YA 5ANRA 4GPKA 2WPVA 1Z3YA 4AJWA 2PM7A 3QDNA 2CFUA 2Y4UA 4FC8A 4BSXA 1OWLA 4I1AA 1KLXA 5CMYA 4ACLA 4XEIG 2HM8A 1L5JA 1TNBA 5LX8A 3QWVA 4CDRA 2ZGDA 2EIJE 3JXIA 3MKRA 1N54A 3HDXA 4LCTA 3HIZA 4EZKA 1JWFA 2WXFA 3FUDA 1E7UA 3MKQA 4FADA 4HLEA 4H7XA 3APFA 3EDTB 2XRZA 3TWRA 2WXKA 3V30A 1EDUA 1IHGA 4BX9A 3T9KA 3ZXPA 4IN3B 2ETBA 3UI2A 3O48A 4TV3A 2OEWA 1XGWA 2PNNA 4RLYA 3NOCD 4A1SA 1K3ZD 3ZW3A 1MHQA 4G2VA 2YHCA 3ABME 2B6CA 1WAO1 3PVLA 4B8CB 4WNEA 3UIPC 3HXFA 5BW8C 3QC1A 3ZFWA 2R17C 1DCEA 2VYIA 4ATGA 2PQRA 4JA7A 3TWXA 3E30A 1HE8A 3QWPA 2BUGA 3V31A 5J90A 2KATA 4GCNA 4N3BA 2LSVA 5B1AE 3VLFA 3UM0A 3MZLB 2ZGGA 1SA4A 1BLXB 2GRPB 4U8YD 1NI1A 3ULEG 2X6IA 4DI3A 4F53A 4PUCA 1SZAA 3HYMB 4B89A 4JW1A 3UKRG 2XEVA 4CRWA 2VGYA 2QC9A 1HZ4A 4U0ZA 4G23A 3RKVA 4EPZA 3JUEA 4XZ4A 4L2YA 4MRUA 4YVQC 3CV0A 4HS2A 4A63B 4TXRA 3FUJA 3BEEA 2AW6A 4DX6D 3ASFA 4GTVA 3L9TA 5FQ4A 3PEVB 2GRRB 2DYSE 3LY9A 2RKKA 3QNKA 5G05C 2YNQA 1NL4A 3L13A 3D9MA 4BFRA 2XZTG 2WXGA 2FI7A 5CRUA 4Y6CA 3Q4AB 3CK7A 3CVWA 1X81A 1QNFA 2XRYA 5ARFA 1HX8A 3UMVA 3D9OA 3OTNA 2ETAA 5CEDB 4YNDA 2IEJA 5CBOA 2HO1A 5T3RA 1FVHA 1WDYA 2V8SE 3NB2A 3E33A 3IXEA 5BNWA 3L16A 3DBSA 5KCMA 4CGWA 4K0RA 3SI5A 3EHRA 3KAEA 4JXTA 3D9HA 4DUIA 5FQ8A 4QQIA 3T5XA 1JCSA 4G8KA 4GPMA 5BT1A 5ENSD 4KZCA 3U4TA 3ESLA 4J8YA 5D66A 4CZ2D 1X5BA 4HOTA 5CBNA 3FUHA 3MKQB 2CG3A 4GA1A 4JPSA 3DSSA 3C98A 1S0PA 3ASHA 1N52A 4J7WA 2WXRA 4N39A 4B94A 2DCPA 5H7PA 2AXVA 3FWVA 1N4RA 5EIDA 3ZYQA 3S7FA 2L6BA 1YYHA 2QY7A 4ZHBA 1Z6TA 4JC8A 2L6JA 3Q7AA 2GROB 3TWVA 4LEUA 1QYMA 4C0MA 2OEVA 3CHSA 4DX2A 3PZ4A 2DZNA 3Q7FA 4FHJA 1E7VA 3FU3A 1UG3A 1QBQA 3T8MA 1A5EA 3V2OA 1U2VG 5T8IA 2FO7A 2EQXA 5JJTA 4GTTA 5AQBA 5KNGA 4HORA 4HRNA 3GZSA 5AQAA 3LDZA 3ONLA 2WXOA 3JXJA 1IHBA 2M63A 1Q2ZA 2BTDA 2AXUA 1VDYA 1KT0A 3NZUA 4CDMA 3UXGA 3DXKG 3QKYA 5ENQD 1NFIE 2KM4A 2EIKE 3K9IA 5BUZA 3DRAA 3SZ7A 2FF4A 1UJKA 2WXHA 3OXFA 5J08A 4GYOA 4HLLA 4Y6WA 2NSZA 3ZU7B 3AS5A 5BXOA 4FU3A 2VGXA 4ANVA 4BT9A 1YCSB 4N5CA 4AY5A 4G25A 3ABLE 2GRNB 3TAXA 2DWZA 4GZ3A 2GRLA 3AJIA 1MQSA 4W9RA 5JHBA 1INZA 1N95A 1HS6A 2XCBA 4I2ZA 1NA0A 3HXDA 3JCKC 2GW1A 3TWQA 4UI9C 3B7SA 5KNHD 3SBSA 1OXJA 1TJFA 4G8LA 3VLDA 4RSYA 4A3VA 3ZVVA 3AG4E 3FUMA 3ML8A 5KJMA 1E8WA 4NACA 4FJZA 2L0IA 3PNTB 3EU9A 3GYZA 4I9CA 2WXNA 4O1PA 4BEPA 1B89A 4MKTA 1HO8A 1MX4A 4XKCA 3CVUA 3LJNA 4GMJA 1TR4A 2F37A 3L6AA 2X6HA 3SFYA 1V54E 3ZEFA 4HRLA 4ME2A 1DNPA 1TNZA 4BY6A 2J49A 2C2LA 3FTSA 4YDEA 5LCWC 3RO2A 2LAHA 1H0AA 3BUAA 2WMNA 2YINA 2H6FA 3ULYA 4ILHB 1UOHA 4DLOA 3S7DA 1BI7B 3Q75A 2FO1E 4DJAA 4F3VA 4IRUA 2CHWA 5ENTD 3TWWA 1HFAA 2IY0C 2C0LA 4GA0A 4ILGA 5HI7A 4GTOA 2RD0A 5JMND 2IU1A 4O60A 1S64A 2IONA 4UWKA 4GCOA 5CRVA 3PRZA 3SHFA 4E85A 4JEHA 2J8SD 4U04A 1OCCE 3MJWA 2YQ8A 4I6JA 2DYRE 2MYOA 1UW4B 3C72A 3FEXA 4N5QA 2OV8A 3FFLA 4I1OB 4F7AA 2MHKA 3TWSA 4JEUA 4CT0A 3GZ1A 3ML9A 3UIOC 3AU5A 5BXUA 2AVPA 4CEMA 4U7EB 3UT8A 1W3BA 2CHXA 4M3OA 1PC2A 2KC7A 4QFVA 4F1PA 1TNUA 2CG2A 3LYAA 3DPDA 5KJNA 1V55E 4GZ6A 4BESA 4GMRA 1MYOA 2KZTA 3PZ2A 3EHQA 3NOGD 4EQFA 1KZPA 4BT8A 3KD7A 3IKOB 4U8HA 2Y69E 3SD5A 3QARA 1RW2A 2P2CP 3P1UA 3AU4A 4BTBA 3DXMG 4LNGA 4HI8A 2OCCE 2Y3AA 3Q73A 5FQ7A 2VGXB 4UQZA 4J8FA 5BV1A 4L9PA 4HB5A 4ZFHA 4ANWA 4LNUD 4IULA 3C3QA 1HH8A 2J09A 3PE3A 2Y1LE 1AWCB 4KMOA 3CK8A 2YHEA 4J0UA 4HRMB 3Q79A 1H2VC 3CEQA 2Y0BG 4RG9A 3D9KA 3PE4A 3UPVA 1N0QA 3HXEA 1IQUA 1OCZE 1N0RA 4PH4B 2F8XK 1E8ZA 3ASDA 1S70B 1N94A 4XI0A 4GZCA 3S7JA 3DSTA 1H6KA 5AQ7A 2V5FA 4HQDA 5BPPA 4RVBA 5EYLA 4ATZD 4H7YA 1OUVA 1HF8A 4F6RD 2ZU6B 5FIOA 4FLBA 3L82A 1TYQG 2IF4A 3FUKA 4AM9A 3V2XA 3G2SA 3DSWA 1WY6A 5EILA 1DVPA 2LNIA 2XGMA 3CHQA 5EIBE 3QAQA 3LY7A 5D0OD 3LKUA 5BV0A 2RFAA 1HU3A 4J8DA 4PS7A 4EBAG 1H2UA 5AENA 4MS6A 4U8VD 4KXKB 3ESKA 4G26A 2IQCA 4G1TA 3U9WA 3HXCA 3LXUX 3L17A 3LS8A 3RJVA 5CECB 3IEGA 1MZCA 2VGEA 2KBXA 3FU6A 4KBQA 3BQOA 4GYWA 1MX6A 3EIJA 4L1BA 3U3WA 3ENEA 2RG8A 1OWOA 4WUYA 3EJNA 2JABA 3R7QA 2XPYA 2J4BA 5A23A 3BU8A 2LXMA 3B7RL 3MA5A 5AYWD 3KS2A 3IHYA 5A6CA 1TN8A 3FTXA 3PS6A 1FVFA 3B7TA 3QB2A 3LCAA 4B93B 3URZA 4PS3A 2OOEA 4HOQA 2QYUA 4AVXA 4AP2A 3E32A 3UM3A 1Z3XA 1HXIA 2EINE 3CKBA 2P9PG 3NQPA 2IJGX 3AG1E 2MOWA 3S7BA 4Q96A 4N2SA 2ILRA 3Q78A 4GYYA 3TG5A 4JZYA 3LVRE 3FH7A 2WQ6A 1PAQA 2LXLA 4U63A 4AEZC 2HE0A 4J6IA 2KZTB 4UQXA 2XGSA 2P58C 4B0ZA 4XIFA 1UN8A 4XKBA 1FT1A 2ETCA 3LPZA 2EIME 3FTVA 4UI9K 3ZN3A 1PY1A 3FHEA 1H19A 3MX3A 4TUUA 2LUHA 3CVQA 3VTYA 3MYVA 5G05J 4YVOA 3D9IA 1OWPA 4FHKA 4G11A 1U3DA 3FP3A 3C5RA 5G04J 4KYOB 4JA9A 5KJLA 1BI8B 2XZDG 3D9JA 3PREA 3UQ3A 3N71A 4JVSA 2WXLA 4RG6A 2HR2A 1ELWA 3TWTA 5KJKA 4L2LA 2EILE 4GZ5A 3SFXA 2IOLA 3BG0B 1NP7A 1H6OA 1NZNA 3FUEA 1U3CA 3HRAA 4UUCA 2VJ8A 5ENNA 2R05A 1HG2A 3PUKA 4APFA 3SQVA 4WAFA 1WM5A 4HNAD 2LSUA 4DX5D 3UM1A 2V4HC 3QK0A 3MCXA 4J8EA 3DSVA 1O1TA 1K1AA 2R03A 4V3IA 3ZXSA 5FQ6A 2WXIA 2P9LG 2KCLA 2P9KG 3FU0A 4LNBA 1YA0A 3D9NA 5D2MC 2B0OE 1JCRA 2WXPA 4GTQA 2XS1A 4N3CA 4B8AA 3B95A 5FJYA 2VSNA 3TL5A 3J5PA 5AARA 1TNOA 3W9FA 1OWNA 5HS0A 4NQ0A 4JHRA 3OXLA 1OT8A 2VSOE 3E37A 5FT9A 4PDXA 3QOUA 1BPOA 5ENRD 5T4YA 3LJ3A 3AG3E 4JD2G 5EX3A 3WG7E 4BETA 4ILIA 3CSTA 3TG4A 4I43A 3DPYA 3FTUA 3I5PA 3ZHEA 2H6GA 2A4ZA 3CKCA 2AXZA 4TUMA 4DLQA 3FEYA 4U0UA 4OAUC 3CVVA 3HHMA 3EHMA 4C0EA 5EDSA 4FA6A 1ZU2A 2XPIA 2X38A 3I4GA 2X6JA 1IKND 2BEDA 3SF4A 2WQHA 4DX7D 5FZQA 1EYHA 2XEHA 2WQ7A 1E90A 5ENOD 2MRIA 4BSZB 1G3NB 2KCKA 4I6EA 5LOZA 3DSUA 1ELKA 4BX8A 1SW6A 2FEZA 1ELRA 5AN8A 1O5MA 3TGOA 4OAVB 1QZ2A 3MV2B 1LF8A 4HI9A 2H6HA 4GMLA 4MBGA 3JYSA 2VSYA 1IYGA 1HG5A 3FULA 2P9SG 3ZKJA 2L0TB 2V4LA 3PEUB 1SVXA 5A7DB 3Q47B 3SFZA 4ANXA 5ENPD 4URKA 2OVBA 4AY6A 1KT1A 4I9EA 4ACKA 2KXPC 3CHOA 2P9UG 3ZIMA 2J4DA 3TWUA 4UQYA 4ANUA 1KPSB 5CHEE 4GAAA 4FP7A 4GTMA 5M72A 1D8DA 2JLBA 3FUFA 4GZDA 1DCQA 3PUJA 3ZNGA 2WXQA 3L22A 1JPLA 3UT4A 4CDNA 5JHAA 4CYMD 3JQ1A 3QWWA 5HRYA 2P9IG 3ABKE 3RRMB 4NIKA 3Q5MA 5DIZA 5D0QD 2GRQB 1AP7A 3DSXA 4GB9A 3MV3B 5E75A 4JHJA 4KVMA 1JUQA 4E6HA 2R59A 2XCCA 1E96B 3FUNA 3CQCB 4Z68A 2XEEA 3JQ0A 3ZYMA 3ASNE 1Y8MA 4CCAA 1WG0A 3UKUG 2VSXE 3D3MA 3J5QB 4IYPA 2I2OA 3EUVA 5FZRA 3HG0D 3CK9A 5CMWA 3AS8A 4KZ0A 4ABNA 2KCVA 1UJJA 3CVPA 2GRMA 4FLHA 3DEOA 4AIFA 3B13A 4C48B 2CFZA 4NRHB 3QJZA 3ASOE 3TXNA 2R5SA 4TXPA 2ZIRA 4RQIA 3RU0A 3D9LA 3EHNA 3RRUA 3ZHEB 3I3NA 2AJAA 5IY5E 5FZSA 4BWRA 1TJCA 1EPUA 4PS8A 2VTBA 4D10C 5CCMA 1LD8A 1IQRA 3FTWA 2PZIA 4LRZA 1TN7A 5C1DA 3O4ZA 2X3MA 5CERB 3B7BA 4HBDA 1YMPA 4BTAA 2XENA 3RAUA 4DI4A 1N9AA 2FBNA 4WWOA 1N11A 4K5BA 5HQ8A 1O1RA 4YDYA 1XNFA 1S63A 1ZB1A 3CR3A 3Q9NC 3UT7A 2ONDA 3VTXA 3LEWA 3NAWA 3CHPA 3IV0A 4GU5A 3SY2A 4P29A 2LO6A 5AAOA 5ITZF 1NA3A 5KBAA 3ULQA 3R9MA 4LUNU 4EZLA 4MLPA 1TN6A 2X6FA 1E8YA 1H2TC 4K03A 2V5QC 5JA4D 2UWJG 2WM9A 1TNYA 3HVEB 5CCLA 2X6KA 4DK5A 4WNGA 3PDNA 4N3AA 4DRXE 5LP0A 3Q49B 2I1JA 3RO3A 5AJLA 3SBTB 4EZJA 2JEKA 3AG2E 3FU5A 3DWLG 2UY1B 3EU5A 3KEAA 3UUXA 4WWNA 5AIJA 3UM2A 3ZGQA 5G04C 3P2BA 1FT2A 2Y4TA 3ISMC 1OCOE 4OYSA 5JJ7A 5EN5D 2CHZA 3T5VA 4A55A 1LD7A 3BG1B 3D9PA 2A5UA 4YDOA 4L7TA 4EBAA 3ZRHA 3FY4A 3CVXA 3HXBA 2R02A 1Z5SC 2WVIA 2FULA 2XPZA 3NZSA 3UTMA 4HOUA 1OWMA 3KSQA 2P9NG 4O6FA 4AXHA 3SO8A 2XS8A 2E0IA 4XX5A 4YDWA 4G24A 2WB2A 1BD8A 4NURA 1A17A 3CIAA 1RZ4A 2RFMA 3L08A 2IO3C 5DBKA 2I9CA 2OVFA 4AV7A 1JCQA 4I1MA 3E34A 3PZ1A 2VTBB 3LY8A 3U64A 3G2UA 3AS4A 4JL0A 1BU9A 2LAIA 1LTXA 1Y6IA 2J08A 1N4QA 5G55A 3L54A 4JHKA 4HXIA 5ARGA 4OVVA 4K5CA 4LG6A 4UWGA 3CVNA 4Q94A 2QYJA 2L9BA 3FH8A 5LFAA 2ZISA 3ZUVB 3RIBA 4LSZE 1O1SA 4XE0A 2WXMA 5ANLA 4J8SA 2PQNA 1N4SA 3MEKA 4U95D 3S2AA 3PZ3A 3CHRA 4DX1A 2WXJA 3WXXA 3CQGB 4CGVA 2ZXWE 2IOSA 3FUIA 2DIWA 5G2NA 5HKPA 2QZAA 3X2QE 1MX2A 5EX0A 3FH5A 4TRQA 1EF1C 3TXMA 3CGHA 3GZ2A 4APOA 5JJ6A 4KT6B 3IBEA 2DZOA 3F6QA 3ASGA 2R2LA 4UWLA 4L23A 2GGFA 2WMOA 3U66A 3G2TA 4FULA 3RSEG 3PZDA 4O1OA 4UWHA 4KVOA 4U07A 2NYJA 5EKQD 1H6PA 3R9AB 4A1GA 1SQMA 2VQ2A 4A3TA 3PH0C 1GW6A 1K1BA 4UWFA 5B3SE 1UN9A 4BERA 3UINC 4AOFA 1FPPA 5FINA 3MGBA 4GTRA 4CT4A 2BKKB 4EHMA 4GA2A 2IO2C 3KEZA 4HVBA 4X8QA 3I4RB 5E76A 2F8YA 4WNFA 1KZOA 3PNLB 4I17A 4TXQA 1TEZA 3C3RA 2PM6A 3LVQE 3OAWA 4WNDA 2HYZA 3NF1A 2I1KA 4FJYA 4R7LA 1ZBPA 2DBAA 2XQ0A 4K5AB 1MJ0A 1D8EA 5AJDA 2J9QA 5KWDA 1DC2A 3EIQC 4WWPA 5EYPF 3T8KA 2F0YA 3FDHA 3SNXA 3C3OA 2J07A 2NC9A 3FTZA 1SZ9A 3G2WA 4I2WA 3CVYA 2BKGA 3ZYKA 3W9GA 2V0PA 4JB8P 3DEPA 3SGHA 2NXPA 4M7CA 4GTSA 5AQ9A 5FTPA 3APDA 3CVLA 2A5EA 1E8XA 2E2EA 3ONKA 3FTYA 1N4PA 2H6IA 3CLJA 3V79K 2DVWA 2BF0X 3AAAC 3HVEA 3UX4A 4U0SA 4HOSA 3G2VA 3TJPA 3R7RA 2AWIA 2I6HA 2IFUA 4EECA 3CSFA 4GTPA 2XGOA 4UI9J 4HFGA 2XHEA 1IXVA 2PL2A 2UY1A 4U96D 3OXGA 2C0MA 1QQEA 2QFCA 2Q7FA 4C9BB 5CEAA 3E4BA 1OY3D 3Q9UC 3VLEA 4DPRA 4N2QA 4Q69A 3ZPJA 3CHMA 3RRNB 3KSLA
chains in the Genus database with same CATH topology
5JHBA 1OWPA 2LO6A 1INZA 4FHKA 4G11A 1U3DA 5LCWJ 4I6GA 4LERA 3FP3A 1NA3A 1HS6A 2XCBA 4I2ZA 5G04J 4KYOB 1JWGA 3ZYLA 3Q15A 1NA0A 3JUIA 3ULQA 4JA9A 3IHVA 5KJLA 4LUNU 3B7UX 3JCKC 4EZLA 2GW1A 4OVUA 3D9JA 3GW4A 3PREA 3UQ3A 1P5QA 4MLPA 3N71A 4XI9A 4JVSA 2X6FA 1E8YA 4UI9C 2WXLA 4F1SA 1H2TC 3B7SA 4RG6A 5FWQA 4K03A 2HR2A 1ELWA 3RK6A 3APCA 1FCHA 3SBSA 5C2YA 2UWJG 5KJKA 4L2LA 2WM9A 5ANRA 4GPKA 2WPVA 1Z3YA 4GZ5A 4AJWA 1TJFA 2PM7A 3QDNA 3VLDA 3HVEB 2IOLA 4RSYA 4A3VA 2X6KA 5CCLA 3ZVVA 2CFUA 2Y4UA 4FC8A 4DK5A 3BG0B 4BSXA 1OWLA 1NP7A 3FUEA 1NZNA 3FUMA 1U3CA 3ML8A 4I1AA 5KJMA 2VJ8A 1KLXA 5ENNA 4WNGA 5CMYA 4ACLA 1E8WA 2HM8A 3PDNA 4NACA 4FJZA 2L0IA 3PNTB 4N3AA 1L5JA 3GYZA 4I9CA 2WXNA 3Q49B 2I1JA 3QWVA 4CDRA 5LP0A 5LX8A 1B89A 3RO3A 1HG2A 3PUKA 3MKRA 1HO8A 4MKTA 2JEKA 5AJLA 3SBTB 1N54A 3HDXA 4LCTA 4APFA 4XKCA 3HIZA 3CVUA 4EZKA 1JWFA 2WXFA 3FU5A 3FUDA 4GMJA 1E7UA 2UY1B 4WAFA 1WM5A 3MKQA 4FADA 3L6AA 2LSUA 4H7XA 4HLEA 3APFA 2X6HA 3EDTB 3UUXA 2XRZA 3ZEFA 3QK0A 4ME2A 1DNPA 4BY6A 2WXKA 2J49A 4WWNA 2C2LA 3FTSA 3MCXA 5AIJA 4J8EA 1EDUA 3ZGQA 1IHGA 3RO2A 5LCWC 2LAHA 1H0AA 4BX9A 5G04C 2WMNA 3P2BA 2YINA 4IN3B 4ILHB 4DLOA 3O48A 2Y4TA 4V3IA 3ZXSA 4TV3A 3S7DA 1XGWA 5FQ6A 2WXIA 4YVOA 4A1SA 4DJAA 4F3VA 4OYSA 4IRUA 2CHWA 2KCLA 1MHQA 3ZW3A 4G2VA 2YHCA 5JJ7A 1WAO1 3PVLA 2CHZA 3FU0A 3T5VA 4B8CB 4WNEA 4A55A 1HFAA 1YA0A 3BG1B 3D9PA 3D9NA 2C0LA 2WXPA 2A5UA 4GA0A 5BW8C 4N3CA 4L7TA 4ILGA 4EBAA 4B8AA 5FJYA 2VSNA 5HI7A 3ZRHA 3QC1A 2RD0A 3ZFWA 2R17C 2IU1A 3TL5A 3FY4A 2VYIA 4ATGA 3CVXA 2PQRA 2IONA 4UWKA 2WVIA 4GCOA 3PRZA 2FULA 4JA7A 3SHFA 4E85A 1OWNA 4JEHA 4EZJA 2XPZA 1HE8A 4NQ0A 4JHRA 3NZSA 4U04A 3OXLA 2VSOE 3MJWA 3QWPA 5FT9A 2BUGA 4HOUA 1OWMA 2YQ8A 4PDXA 4I6JA 5J90A 3QOUA 1BPOA 4O6FA 4AXHA 5T4YA 3LJ3A 1UW4B 5EX3A 2KATA 4GCNA 2E0IA 4N3BA 4XX5A 2LSVA 4ILIA 3FEXA 4G24A 3CSTA 2OV8A 3FFLA 3TG4A 3VLFA 2WB2A 4I43A 3FTUA 3I5PA 3MZLB 4I1OB 3ZHEA 4F7AA 2MHKA 4JEUA 4CT0A 2A4ZA 3GZ1A 3ML9A 4NURA 3AU5A 3CKCA 2AXZA 1A17A 3CIAA 4DLQA 3FEYA 3L08A 4U0UA 2AVPA 4DI3A 2X6IA 5DBKA 4CEMA 2I9CA 2OVFA 4F53A 4AV7A 3UT8A 4PUCA 3CVVA 1W3BA 1SZAA 2CHXA 3HYMB 3HHMA 4M3OA 4B89A 4JW1A 3EHMA 4C0EA 5EDSA 2XEVA 4FA6A 4I1MA 1PC2A 2VTBB 2KC7A 4QFVA 3LY8A 3U64A 1ZU2A 4CRWA 2VGYA 2XPIA 2CG2A 3G2UA 2X38A 3I4GA 3LYAA 2X6JA 1HZ4A 3DPDA 4U0ZA 5KJNA 3AS4A 4GZ6A 4JL0A 3SF4A 4G23A 2WQHA 3RKVA 2LAIA 4EPZA 1Y6IA 5FZQA 2KZTA 1EYHA 2J08A 4EQFA 4XZ4A 4L2YA 5G55A 3L54A 2WQ7A 1E90A 4MRUA 4YVQC 3KD7A 3CV0A 3IKOB 4BT8A 4HS2A 4JHKA 2MRIA 3BEEA 3FUJA 2AW6A 4U8HA 4HXIA 3ASFA 3SD5A 2KCKA 5FQ4A 3QARA 4I6EA 3PEVB 5ARGA 4OVVA 5LOZA 1ELKA 4BX8A 3P1UA 3AU4A 4BTBA 2FEZA 1ELRA 4UWGA 3LY9A 3CVNA 3QNKA 5G05C 2Y3AA 2YNQA 4Q94A 3TGOA 1QZ2A 2L9BA 3L13A 3D9MA 5FQ7A 4BFRA 3MV2B 2VGXB 3FH8A 4UQZA 5LFAA 3RIBA 4J8FA 5BV1A 1LF8A 4XE0A 2WXGA 2FI7A 4ANWA 2WXMA 4IULA 4J8SA 5ANLA 2PQNA 1HH8A 2J09A 4GMLA 3JYSA 4Y6CA 3MEKA 2VSYA 3Q4AB 1IYGA 3PE3A 1HG5A 3CK7A 3S2AA 3CVWA 1QNFA 3FULA 4KMOA 2XRYA 3CK8A 5ARFA 2YHEA 4J0UA 2L0TB 3CHRA 2V4LA 2WXJA 1HX8A 3UMVA 3WXXA 3PEUB 4A1GA 3D9OA 3CQGB 1H2VC 3CEQA 3OTNA 5A7DB 4CGVA 3Q47B 3SFZA 4ANXA 4YNDA 2IOSA 3FUIA 4RG9A 2OVBA 4URKA 2DIWA 3D9KA 3PE4A 5G2NA 3UPVA 4AY6A 2HO1A 1KT1A 1IQUA 4I9EA 3CHOA 4ACKA 5EX0A 4PH4B 5T3RA 3ZIMA 2J4DA 1E8ZA 1FVHA 2V8SE 3ASDA 3FH5A 4TRQA 1EF1C 4XI0A 3CGHA 3GZ2A 4GZCA 3TXMA 4APOA 5BNWA 3L16A 4UQYA 3S7JA 1H6KA 4ANUA 3DBSA 5JJ6A 2V5FA 4KT6B 5BPPA 3IBEA 5CHEE 4GAAA 4FP7A 4RVBA 5M72A 2JLBA 3ASGA 5KCMA 3FUFA 4CGWA 4GZDA 4K0RA 3SI5A 3PUJA 4H7YA 4UWLA 3KAEA 4L23A 1OUVA 2GGFA 2WMOA 4JXTA 5FQ8A 2WXQA 3U66A 3L22A 1JPLA 1HF8A 3T5XA 3UT4A 4CDNA 5JHAA 3G2TA 2ZU6B 4FULA 5BT1A 3JQ1A 3PZDA 4KZCA 3QWWA 3U4TA 3ESLA 4UWHA 4KVOA 4FLBA 3RRMB 4U07A 1X5BA 4HOTA 5EKQD 3FUHA 1SQMA 2IF4A 2VQ2A 3MKQB 3Q5MA 3PH0C 1GW6A 5DIZA 3R9AB 3FUKA 4A3TA 4UWFA 4AM9A 2CG3A 1UN9A 3G2SA 1WY6A 1DVPA 2LNIA 4GA1A 4AOFA 4JPSA 2XGMA 5D0QD 3CHQA 4GB9A 3QAQA 3MV3B 3C98A 3MGBA 3LY7A 5D0OD 1S0PA 4CT4A 3ASHA 3LKUA 4JHJA 5E75A 5BV0A 1N52A 1HU3A 4J8DA 4KVMA 1JUQA 4PS7A 4E6HA 2R59A 2WXRA 4GA2A 2XCCA 4N39A 4EBAG 4B94A 2DCPA 1E96B 3FUNA 3KEZA 1H2UA 3CQCB 4HVBA 5AENA 4MS6A 3JQ0A 2AXVA 3FWVA 3ZYMA 3I4RB 1Y8MA 4KXKB 3ESKA 4G26A 5E76A 3ZYQA 3S7FA 2IQCA 4CCAA 4G1TA 3U9WA 4WNFA 3LXUX 2VSXE 3D3MA 3PNLB 2QY7A 4I17A 4P29A 4IYPA 1Z6TA 3L17A 1TEZA 2PM6A 3LS8A 2I2OA 3LVQE 4JC8A 2L6JA 3RJVA 3IEGA 3OAWA 4WNDA 5FZRA 2HYZA 3NF1A 2I1KA 3CK9A 3FU6A 4FJYA 4R7LA 5CMWA 1ZBPA 3AS8A 4LEUA 2DBAA 4KBQA 4KZ0A 4GYWA 4C0MA 2XQ0A 5AJDA 4ABNA 3EIJA 2J9QA 4L1BA 2KCVA 1UJJA 3CHSA 3CVPA 2GRMA 3EIQC 3U3WA 3ENEA 4FLHA 2RG8A 4WWPA 1OWOA 4WUYA 3EJNA 3R7QA 4FHJA 2XPYA 4AIFA 3FDHA 3SNXA 1E7VA 3FU3A 2J07A 2NC9A 3FTZA 3B13A 1UG3A 3T8MA 2J4BA 5A23A 2CFZA 1SZ9A 3G2WA 3MA5A 3B7RL 5T8IA 4I2WA 2FO7A 3CVYA 5AYWD 2EQXA 3KS2A 3QJZA 4NRHB 5JJTA 3IHYA 5A6CA 3TXNA 3FTXA 2R5SA 3PS6A 1FVFA 3ZYKA 2V0PA 4HORA 3B7TA 3RU0A 3QB2A 3LCAA 3GZSA 3D9LA 3EHNA 2NXPA 3RRUA 3SGHA 3URZA 3ZHEB 3LDZA 4PS3A 2OOEA 3I3NA 3ONLA 5FTPA 2WXOA 3APDA 3CVLA 4HOQA 5FZSA 4AP2A 1E8XA 2E2EA 3ONKA 3FTYA 4AVXA 4BWRA 1TJCA 1Z3XA 1EPUA 4PS8A 2M63A 2VTBA 2BTDA 1HXIA 4D10C 3CKBA 3CLJA 2AXUA 5CCMA 2BF0X 3NQPA 1VDYA 2IJGX 2MOWA 3S7BA 1KT0A 4Q96A 4N2SA 1IQRA 2ILRA 3HVEA 3UX4A 4U0SA 4GYYA 4HOSA 3G2VA 3TJPA 3NZUA 3R7RA 3TG5A 4CDMA 4JZYA 3FTWA 2AWIA 2I6HA 3LVRE 2IFUA 4EECA 3QKYA 2PZIA 4LRZA 3FH7A 2WQ6A 1PAQA 3CSFA 4U63A 4AEZC 4UI9J 2KM4A 2XGOA 4HFGA 5C1DA 2XHEA 3K9IA 3O4ZA 5BUZA 3SZ7A 4J6IA 2KZTB 2FF4A 2X3MA 1UJKA 2PL2A 4UQXA 2XGSA 2P58C 2UY1A 2WXHA 4B0ZA 4XIFA 1UN8A 4BTAA 3OXFA 5J08A 4GYOA 4Y6WA 3OXGA 2NSZA 4XKBA 4DI4A 2FBNA 3AS5A 2C0MA 4WWOA 1QQEA 3LPZA 2QFCA 4FU3A 5HQ8A 2Q7FA 4C9BB 2VGXA 3FTVA 4UI9K 3ZN3A 3E4BA 4ANVA 4BT9A 1XNFA 1PY1A 3CR3A 4N5CA 3FHEA 3UT7A 4AY5A 4G25A 1H19A 3MX3A 4TUUA 2ONDA 3VTXA 3CVQA 3TAXA 3VTYA 3VLEA 4DPRA 3LEWA 4N2QA 4Q69A 4GZ3A 3MYVA 3ZPJA 5G05J 2GRLA 3CHPA 3IV0A 4GU5A 4W9RA 1MQSA 3CHMA 3RRNB 3D9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MKQ A;  3MKQ B; 
#chains in the Genus database with same CATH topology
 1SA5 A;  5LCW J;  4I6G A;  4LER A;  1OCR E;  1JWG A;  3ZYL A;  3Q15 A;  3JUI A;  3IHV A;  3NBN B;  3B7U X;  4OVU A;  1D9S A;  3GW4 A;  1P5Q A;  4XI9 A;  1K8K G;  4F1S A;  5FWQ A;  5B1B E;  3RK6 A;  3APC A;  1FCH A;  5C2Y A;  5ANR A;  4GPK A;  2WPV A;  1Z3Y A;  4AJW A;  2PM7 A;  3QDN A;  2CFU A;  2Y4U A;  4FC8 A;  4BSX A;  1OWL A;  4I1A A;  1KLX A;  5CMY A;  4ACL A;  4XEI G;  2HM8 A;  1L5J A;  1TNB A;  5LX8 A;  3QWV A;  4CDR A;  2ZGD A;  2EIJ E;  3JXI A;  3MKR A;  1N54 A;  3HDX A;  4LCT A;  3HIZ A;  4EZK A;  1JWF A;  2WXF A;  3FUD A;  1E7U A;  3MKQ A;  4FAD A;  4HLE A;  4H7X A;  3APF A;  3EDT B;  2XRZ A;  3TWR A;  2WXK A;  3V30 A;  1EDU A;  1IHG A;  4BX9 A;  3T9K A;  3ZXP A;  4IN3 B;  2ETB A;  3UI2 A;  3O48 A;  4TV3 A;  2OEW A;  1XGW A;  2PNN A;  4RLY A;  3NOC D;  4A1S A;  1K3Z D;  3ZW3 A;  1MHQ A;  4G2V A;  2YHC A;  3ABM E;  2B6C A;  1WAO 1;  3PVL A;  4B8C B;  4WNE A;  3UIP C;  3HXF A;  5BW8 C;  3QC1 A;  3ZFW A;  2R17 C;  1DCE A;  2VYI A;  4ATG A;  2PQR A;  4JA7 A;  3TWX A;  3E30 A;  1HE8 A;  3QWP A;  2BUG A;  3V31 A;  5J90 A;  2KAT A;  4GCN A;  4N3B A;  2LSV A;  5B1A E;  3VLF A;  3UM0 A;  3MZL B;  2ZGG A;  1SA4 A;  1BLX B;  2GRP B;  4U8Y D;  1NI1 A;  3ULE G;  2X6I A;  4DI3 A;  4F53 A;  4PUC A;  1SZA A;  3HYM B;  4B89 A;  4JW1 A;  3UKR G;  2XEV A;  4CRW A;  2VGY A;  2QC9 A;  1HZ4 A;  4U0Z A;  4G23 A;  3RKV A;  4EPZ A;  3JUE A;  4XZ4 A;  4L2Y A;  4MRU A;  4YVQ C;  3CV0 A;  4HS2 A;  4A63 B;  4TXR A;  3FUJ A;  3BEE A;  2AW6 A;  4DX6 D;  3ASF A;  4GTV A;  3L9T A;  5FQ4 A;  3PEV B;  2GRR B;  2DYS E;  3LY9 A;  2RKK A;  3QNK A;  5G05 C;  2YNQ A;  1NL4 A;  3L13 A;  3D9M A;  4BFR A;  2XZT G;  2WXG A;  2FI7 A;  5CRU A;  4Y6C A;  3Q4A B;  3CK7 A;  3CVW A;  1X81 A;  1QNF A;  2XRY A;  5ARF A;  1HX8 A;  3UMV A;  3D9O A;  3OTN A;  2ETA A;  5CED B;  4YND A;  2IEJ A;  5CBO A;  2HO1 A;  5T3R A;  1FVH A;  1WDY A;  2V8S E;  3NB2 A;  3E33 A;  3IXE A;  5BNW A;  3L16 A;  3DBS A;  5KCM A;  4CGW A;  4K0R A;  3SI5 A;  3EHR A;  3KAE A;  4JXT A;  3D9H A;  4DUI A;  5FQ8 A;  4QQI A;  3T5X A;  1JCS A;  4G8K A;  4GPM A;  5BT1 A;  5ENS D;  4KZC A;  3U4T A;  3ESL A;  4J8Y A;  5D66 A;  4CZ2 D;  1X5B A;  4HOT A;  5CBN A;  3FUH A;  3MKQ B;  2CG3 A;  4GA1 A;  4JPS A;  3DSS A;  3C98 A;  1S0P A;  3ASH A;  1N52 A;  4J7W A;  2WXR A;  4N39 A;  4B94 A;  2DCP A;  5H7P A;  2AXV A;  3FWV A;  1N4R A;  5EID A;  3ZYQ A;  3S7F A;  2L6B A;  1YYH A;  2QY7 A;  4ZHB A;  1Z6T A;  4JC8 A;  2L6J A;  3Q7A A;  2GRO B;  3TWV A;  4LEU A;  1QYM A;  4C0M A;  2OEV A;  3CHS A;  4DX2 A;  3PZ4 A;  2DZN A;  3Q7F A;  4FHJ A;  1E7V A;  3FU3 A;  1UG3 A;  1QBQ A;  3T8M A;  1A5E A;  3V2O A;  1U2V G;  5T8I A;  2FO7 A;  2EQX A;  5JJT A;  4GTT A;  5AQB A;  5KNG A;  4HOR A;  4HRN A;  3GZS A;  5AQA A;  3LDZ A;  3ONL A;  2WXO A;  3JXJ A;  1IHB A;  2M63 A;  1Q2Z A;  2BTD A;  2AXU A;  1VDY A;  1KT0 A;  3NZU A;  4CDM A;  3UXG A;  3DXK G;  3QKY A;  5ENQ D;  1NFI E;  2KM4 A;  2EIK E;  3K9I A;  5BUZ A;  3DRA A;  3SZ7 A;  2FF4 A;  1UJK A;  2WXH A;  3OXF A;  5J08 A;  4GYO A;  4HLL A;  4Y6W A;  2NSZ A;  3ZU7 B;  3AS5 A;  5BXO A;  4FU3 A;  2VGX A;  4ANV A;  4BT9 A;  1YCS B;  4N5C A;  4AY5 A;  4G25 A;  3ABL E;  2GRN B;  3TAX A;  2DWZ A;  4GZ3 A;  2GRL A;  3AJI A;  1MQS A;  4W9R A;  5JHB A;  1INZ A;  1N95 A;  1HS6 A;  2XCB A;  4I2Z A;  1NA0 A;  3HXD A;  3JCK C;  2GW1 A;  3TWQ A;  4UI9 C;  3B7S A;  5KNH D;  3SBS A;  1OXJ A;  1TJF A;  4G8L A;  3VLD A;  4RSY A;  4A3V A;  3ZVV A;  3AG4 E;  3FUM A;  3ML8 A;  5KJM A;  1E8W A;  4NAC A;  4FJZ A;  2L0I A;  3PNT B;  3EU9 A;  3GYZ A;  4I9C A;  2WXN A;  4O1P A;  4BEP A;  1B89 A;  4MKT A;  1HO8 A;  1MX4 A;  4XKC A;  3CVU A;  3LJN A;  4GMJ A;  1TR4 A;  2F37 A;  3L6A A;  2X6H A;  3SFY A;  1V54 E;  3ZEF A;  4HRL A;  4ME2 A;  1DNP A;  1TNZ A;  4BY6 A;  2J49 A;  2C2L A;  3FTS A;  4YDE A;  5LCW C;  3RO2 A;  2LAH A;  1H0A A;  3BUA A;  2WMN A;  2YIN A;  2H6F A;  3ULY A;  4ILH B;  1UOH A;  4DLO A;  3S7D A;  1BI7 B;  3Q75 A;  2FO1 E;  4DJA A;  4F3V A;  4IRU A;  2CHW A;  5ENT D;  3TWW A;  1HFA A;  2IY0 C;  2C0L A;  4GA0 A;  4ILG A;  5HI7 A;  4GTO A;  2RD0 A;  5JMN D;  2IU1 A;  4O60 A;  1S64 A;  2ION A;  4UWK A;  4GCO A;  5CRV A;  3PRZ A;  3SHF A;  4E85 A;  4JEH A;  2J8S D;  4U04 A;  1OCC E;  3MJW A;  2YQ8 A;  4I6J A;  2DYR E;  2MYO A;  1UW4 B;  3C72 A;  3FEX A;  4N5Q A;  2OV8 A;  3FFL A;  4I1O B;  4F7A A;  2MHK A;  3TWS A;  4JEU A;  4CT0 A;  3GZ1 A;  3ML9 A;  3UIO C;  3AU5 A;  5BXU A;  2AVP A;  4CEM A;  4U7E B;  3UT8 A;  1W3B A;  2CHX A;  4M3O A;  1PC2 A;  2KC7 A;  4QFV A;  4F1P A;  1TNU A;  2CG2 A;  3LYA A;  3DPD A;  5KJN A;  1V55 E;  4GZ6 A;  4BES A;  4GMR A;  1MYO A;  2KZT A;  3PZ2 A;  3EHQ A;  3NOG D;  4EQF A;  1KZP A;  4BT8 A;  3KD7 A;  3IKO B;  4U8H A;  2Y69 E;  3SD5 A;  3QAR A;  1RW2 A;  2P2C P;  3P1U A;  3AU4 A;  4BTB A;  3DXM G;  4LNG A;  4HI8 A;  2OCC E;  2Y3A A;  3Q73 A;  5FQ7 A;  2VGX B;  4UQZ A;  4J8F A;  5BV1 A;  4L9P A;  4HB5 A;  4ZFH A;  4ANW A;  4LNU D;  4IUL A;  3C3Q A;  1HH8 A;  2J09 A;  3PE3 A;  2Y1L E;  1AWC B;  4KMO A;  3CK8 A;  2YHE A;  4J0U A;  4HRM B;  3Q79 A;  1H2V C;  3CEQ A;  2Y0B G;  4RG9 A;  3D9K A;  3PE4 A;  3UPV A;  1N0Q A;  3HXE A;  1IQU A;  1OCZ E;  1N0R A;  4PH4 B;  2F8X K;  1E8Z A;  3ASD A;  1S70 B;  1N94 A;  4XI0 A;  4GZC A;  3S7J A;  3DST A;  1H6K A;  5AQ7 A;  2V5F A;  4HQD A;  5BPP A;  4RVB A;  5EYL A;  4ATZ D;  4H7Y A;  1OUV A;  1HF8 A;  4F6R D;  2ZU6 B;  5FIO A;  4FLB A;  3L82 A;  1TYQ G;  2IF4 A;  3FUK A;  4AM9 A;  3V2X A;  3G2S A;  3DSW A;  1WY6 A;  5EIL A;  1DVP A;  2LNI A;  2XGM A;  3CHQ A;  5EIB E;  3QAQ A;  3LY7 A;  5D0O D;  3LKU A;  5BV0 A;  2RFA A;  1HU3 A;  4J8D A;  4PS7 A;  4EBA G;  1H2U A;  5AEN A;  4MS6 A;  4U8V D;  4KXK B;  3ESK A;  4G26 A;  2IQC A;  4G1T A;  3U9W A;  3HXC A;  3LXU X;  3L17 A;  3LS8 A;  3RJV A;  5CEC B;  3IEG A;  1MZC A;  2VGE A;  2KBX A;  3FU6 A;  4KBQ A;  3BQO A;  4GYW A;  1MX6 A;  3EIJ A;  4L1B A;  3U3W A;  3ENE A;  2RG8 A;  1OWO A;  4WUY A;  3EJN A;  2JAB A;  3R7Q A;  2XPY A;  2J4B A;  5A23 A;  3BU8 A;  2LXM A;  3B7R L;  3MA5 A;  5AYW D;  3KS2 A;  3IHY A;  5A6C A;  1TN8 A;  3FTX A;  3PS6 A;  1FVF A;  3B7T A;  3QB2 A;  3LCA A;  4B93 B;  3URZ A;  4PS3 A;  2OOE A;  4HOQ A;  2QYU A;  4AVX A;  4AP2 A;  3E32 A;  3UM3 A;  1Z3X A;  1HXI A;  2EIN E;  3CKB A;  2P9P G;  3NQP A;  2IJG X;  3AG1 E;  2MOW A;  3S7B A;  4Q96 A;  4N2S A;  2ILR A;  3Q78 A;  4GYY A;  3TG5 A;  4JZY A;  3LVR E;  3FH7 A;  2WQ6 A;  1PAQ A;  2LXL A;  4U63 A;  4AEZ C;  2HE0 A;  4J6I A;  2KZT B;  4UQX A;  2XGS A;  2P58 C;  4B0Z A;  4XIF A;  1UN8 A;  4XKB A;  1FT1 A;  2ETC A;  3LPZ A;  2EIM E;  3FTV A;  4UI9 K;  3ZN3 A;  1PY1 A;  3FHE A;  1H19 A;  3MX3 A;  4TUU A;  2LUH A;  3CVQ A;  3VTY A;  3MYV A;  5G05 J;  4YVO A;  3D9I A;  1OWP A;  4FHK A;  4G11 A;  1U3D A;  3FP3 A;  3C5R A;  5G04 J;  4KYO B;  4JA9 A;  5KJL A;  1BI8 B;  2XZD G;  3D9J A;  3PRE A;  3UQ3 A;  3N71 A;  4JVS A;  2WXL A;  4RG6 A;  2HR2 A;  1ELW A;  3TWT A;  5KJK A;  4L2L A;  2EIL E;  4GZ5 A;  3SFX A;  2IOL A;  3BG0 B;  1NP7 A;  1H6O A;  1NZN A;  3FUE A;  1U3C A;  3HRA A;  4UUC A;  2VJ8 A;  5ENN A;  2R05 A;  1HG2 A;  3PUK A;  4APF A;  3SQV A;  4WAF A;  1WM5 A;  4HNA D;  2LSU A;  4DX5 D;  3UM1 A;  2V4H C;  3QK0 A;  3MCX A;  4J8E A;  3DSV A;  1O1T A;  1K1A A;  2R03 A;  4V3I A;  3ZXS A;  5FQ6 A;  2WXI A;  2P9L G;  2KCL A;  2P9K G;  3FU0 A;  4LNB A;  1YA0 A;  3D9N A;  5D2M C;  2B0O E;  1JCR A;  2WXP A;  4GTQ A;  2XS1 A;  4N3C A;  4B8A A;  3B95 A;  5FJY A;  2VSN A;  3TL5 A;  3J5P A;  5AAR A;  1TNO A;  3W9F A;  1OWN A;  5HS0 A;  4NQ0 A;  4JHR A;  3OXL A;  1OT8 A;  2VSO E;  3E37 A;  5FT9 A;  4PDX A;  3QOU A;  1BPO A;  5ENR D;  5T4Y A;  3LJ3 A;  3AG3 E;  4JD2 G;  5EX3 A;  3WG7 E;  4BET A;  4ILI A;  3CST A;  3TG4 A;  4I43 A;  3DPY A;  3FTU A;  3I5P A;  3ZHE A;  2H6G A;  2A4Z A;  3CKC A;  2AXZ A;  4TUM A;  4DLQ A;  3FEY A;  4U0U A;  4OAU C;  3CVV A;  3HHM A;  3EHM A;  4C0E A;  5EDS A;  4FA6 A;  1ZU2 A;  2XPI A;  2X38 A;  3I4G A;  2X6J A;  1IKN D;  2BED A;  3SF4 A;  2WQH A;  4DX7 D;  5FZQ A;  1EYH A;  2XEH A;  2WQ7 A;  1E90 A;  5ENO D;  2MRI A;  4BSZ B;  1G3N B;  2KCK A;  4I6E A;  5LOZ A;  3DSU A;  1ELK A;  4BX8 A;  1SW6 A;  2FEZ A;  1ELR A;  5AN8 A;  1O5M A;  3TGO A;  4OAV B;  1QZ2 A;  3MV2 B;  1LF8 A;  4HI9 A;  2H6H A;  4GML A;  4MBG A;  3JYS A;  2VSY A;  1IYG A;  1HG5 A;  3FUL A;  2P9S G;  3ZKJ A;  2L0T B;  2V4L A;  3PEU B;  1SVX A;  5A7D B;  3Q47 B;  3SFZ A;  4ANX A;  5ENP D;  4URK A;  2OVB A;  4AY6 A;  1KT1 A;  4I9E A;  4ACK A;  2KXP C;  3CHO A;  2P9U G;  3ZIM A;  2J4D A;  3TWU A;  4UQY A;  4ANU A;  1KPS B;  5CHE E;  4GAA A;  4FP7 A;  4GTM A;  5M72 A;  1D8D A;  2JLB A;  3FUF A;  4GZD A;  1DCQ A;  3PUJ A;  3ZNG A;  2WXQ A;  3L22 A;  1JPL A;  3UT4 A;  4CDN A;  5JHA A;  4CYM D;  3JQ1 A;  3QWW A;  5HRY A;  2P9I G;  3ABK E;  3RRM B;  4NIK A;  3Q5M A;  5DIZ A;  5D0Q D;  2GRQ B;  1AP7 A;  3DSX A;  4GB9 A;  3MV3 B;  5E75 A;  4JHJ A;  4KVM A;  1JUQ A;  4E6H A;  2R59 A;  2XCC A;  1E96 B;  3FUN A;  3CQC B;  4Z68 A;  2XEE A;  3JQ0 A;  3ZYM A;  3ASN E;  1Y8M A;  4CCA A;  1WG0 A;  3UKU G;  2VSX E;  3D3M A;  3J5Q B;  4IYP A;  2I2O A;  3EUV A;  5FZR A;  3HG0 D;  3CK9 A;  5CMW A;  3AS8 A;  4KZ0 A;  4ABN A;  2KCV A;  1UJJ A;  3CVP A;  2GRM A;  4FLH A;  3DEO A;  4AIF A;  3B13 A;  4C48 B;  2CFZ A;  4NRH B;  3QJZ A;  3ASO E;  3TXN A;  2R5S A;  4TXP A;  2ZIR A;  4RQI A;  3RU0 A;  3D9L A;  3EHN A;  3RRU A;  3ZHE B;  3I3N A;  2AJA A;  5IY5 E;  5FZS A;  4BWR A;  1TJC A;  1EPU A;  4PS8 A;  2VTB A;  4D10 C;  5CCM A;  1LD8 A;  1IQR A;  3FTW A;  2PZI A;  4LRZ A;  1TN7 A;  5C1D A;  3O4Z A;  2X3M A;  5CER B;  3B7B A;  4HBD A;  1YMP A;  4BTA A;  2XEN A;  3RAU A;  4DI4 A;  1N9A A;  2FBN A;  4WWO A;  1N11 A;  4K5B A;  5HQ8 A;  1O1R A;  4YDY A;  1XNF A;  1S63 A;  1ZB1 A;  3CR3 A;  3Q9N C;  3UT7 A;  2OND A;  3VTX A;  3LEW A;  3NAW A;  3CHP A;  3IV0 A;  4GU5 A;  3SY2 A;  4P29 A;  2LO6 A;  5AAO A;  5ITZ F;  1NA3 A;  5KBA A;  3ULQ A;  3R9M A;  4LUN U;  4EZL A;  4MLP A;  1TN6 A;  2X6F A;  1E8Y A;  1H2T C;  4K03 A;  2V5Q C;  5JA4 D;  2UWJ G;  2WM9 A;  1TNY A;  3HVE B;  5CCL A;  2X6K A;  4DK5 A;  4WNG A;  3PDN A;  4N3A A;  4DRX E;  5LP0 A;  3Q49 B;  2I1J A;  3RO3 A;  5AJL A;  3SBT B;  4EZJ A;  2JEK A;  3AG2 E;  3FU5 A;  3DWL G;  2UY1 B;  3EU5 A;  3KEA A;  3UUX A;  4WWN A;  5AIJ A;  3UM2 A;  3ZGQ A;  5G04 C;  3P2B A;  1FT2 A;  2Y4T A;  3ISM C;  1OCO E;  4OYS A;  5JJ7 A;  5EN5 D;  2CHZ A;  3T5V A;  4A55 A;  1LD7 A;  3BG1 B;  3D9P A;  2A5U A;  4YDO A;  4L7T A;  4EBA A;  3ZRH A;  3FY4 A;  3CVX A;  3HXB A;  2R02 A;  1Z5S C;  2WVI A;  2FUL A;  2XPZ A;  3NZS A;  3UTM A;  4HOU A;  1OWM A;  3KSQ A;  2P9N G;  4O6F A;  4AXH A;  3SO8 A;  2XS8 A;  2E0I A;  4XX5 A;  4YDW A;  4G24 A;  2WB2 A;  1BD8 A;  4NUR A;  1A17 A;  3CIA A;  1RZ4 A;  2RFM A;  3L08 A;  2IO3 C;  5DBK A;  2I9C A;  2OVF A;  4AV7 A;  1JCQ A;  4I1M A;  3E34 A;  3PZ1 A;  2VTB B;  3LY8 A;  3U64 A;  3G2U A;  3AS4 A;  4JL0 A;  1BU9 A;  2LAI A;  1LTX A;  1Y6I A;  2J08 A;  1N4Q A;  5G55 A;  3L54 A;  4JHK A;  4HXI A;  5ARG A;  4OVV A;  4K5C A;  4LG6 A;  4UWG A;  3CVN A;  4Q94 A;  2QYJ A;  2L9B A;  3FH8 A;  5LFA A;  2ZIS A;  3ZUV B;  3RIB A;  4LSZ E;  1O1S A;  4XE0 A;  2WXM A;  5ANL A;  4J8S A;  2PQN A;  1N4S A;  3MEK A;  4U95 D;  3S2A A;  3PZ3 A;  3CHR A;  4DX1 A;  2WXJ A;  3WXX A;  3CQG B;  4CGV A;  2ZXW E;  2IOS A;  3FUI A;  2DIW A;  5G2N A;  5HKP A;  2QZA A;  3X2Q E;  1MX2 A;  5EX0 A;  3FH5 A;  4TRQ A;  1EF1 C;  3TXM A;  3CGH A;  3GZ2 A;  4APO A;  5JJ6 A;  4KT6 B;  3IBE A;  2DZO A;  3F6Q A;  3ASG A;  2R2L A;  4UWL A;  4L23 A;  2GGF A;  2WMO A;  3U66 A;  3G2T A;  4FUL A;  3RSE G;  3PZD A;  4O1O A;  4UWH A;  4KVO A;  4U07 A;  2NYJ A;  5EKQ D;  1H6P A;  3R9A B;  4A1G A;  1SQM A;  2VQ2 A;  4A3T A;  3PH0 C;  1GW6 A;  1K1B A;  4UWF A;  5B3S E;  1UN9 A;  4BER A;  3UIN C;  4AOF A;  1FPP A;  5FIN A;  3MGB A;  4GTR A;  4CT4 A;  2BKK B;  4EHM A;  4GA2 A;  2IO2 C;  3KEZ A;  4HVB A;  4X8Q A;  3I4R B;  5E76 A;  2F8Y A;  4WNF A;  1KZO A;  3PNL B;  4I17 A;  4TXQ A;  1TEZ A;  3C3R A;  2PM6 A;  3LVQ E;  3OAW A;  4WND A;  2HYZ A;  3NF1 A;  2I1K A;  4FJY A;  4R7L A;  1ZBP A;  2DBA A;  2XQ0 A;  4K5A B;  1MJ0 A;  1D8E A;  5AJD A;  2J9Q A;  5KWD A;  1DC2 A;  3EIQ C;  4WWP A;  5EYP F;  3T8K A;  2F0Y A;  3FDH A;  3SNX A;  3C3O A;  2J07 A;  2NC9 A;  3FTZ A;  1SZ9 A;  3G2W A;  4I2W A;  3CVY A;  2BKG A;  3ZYK A;  3W9G A;  2V0P A;  4JB8 P;  3DEP A;  3SGH A;  2NXP A;  4M7C A;  4GTS A;  5AQ9 A;  5FTP A;  3APD A;  3CVL A;  2A5E A;  1E8X A;  2E2E A;  3ONK A;  3FTY A;  1N4P A;  2H6I A;  3CLJ A;  3V79 K;  2DVW A;  2BF0 X;  3AAA C;  3HVE A;  3UX4 A;  4U0S A;  4HOS A;  3G2V A;  3TJP A;  3R7R A;  2AWI A;  2I6H A;  2IFU A;  4EEC A;  3CSF A;  4GTP A;  2XGO A;  4UI9 J;  4HFG A;  2XHE A;  1IXV A;  2PL2 A;  2UY1 A;  4U96 D;  3OXG A;  2C0M A;  1QQE A;  2QFC A;  2Q7F A;  4C9B B;  5CEA A;  3E4B A;  1OY3 D;  3Q9U C;  3VLE A;  4DPR A;  4N2Q A;  4Q69 A;  3ZPJ A;  3CHM A;  3RRN B;  3KSL A; 
#chains in the Genus database with same CATH homology
 5JHB A;  1OWP A;  2LO6 A;  1INZ A;  4FHK A;  4G11 A;  1U3D A;  5LCW J;  4I6G A;  4LER A;  3FP3 A;  1NA3 A;  1HS6 A;  2XCB A;  4I2Z A;  5G04 J;  4KYO B;  1JWG A;  3ZYL A;  3Q15 A;  1NA0 A;  3JUI A;  3ULQ A;  4JA9 A;  3IHV A;  5KJL A;  4LUN U;  3B7U X;  3JCK C;  4EZL A;  2GW1 A;  4OVU A;  3D9J A;  3GW4 A;  3PRE A;  3UQ3 A;  1P5Q A;  4MLP A;  3N71 A;  4XI9 A;  4JVS A;  2X6F A;  1E8Y A;  4UI9 C;  2WXL A;  4F1S A;  1H2T C;  3B7S A;  4RG6 A;  5FWQ A;  4K03 A;  2HR2 A;  1ELW A;  3RK6 A;  3APC A;  1FCH A;  3SBS A;  5C2Y A;  2UWJ G;  5KJK A;  4L2L A;  2WM9 A;  5ANR A;  4GPK A;  2WPV A;  1Z3Y A;  4GZ5 A;  4AJW A;  1TJF A;  2PM7 A;  3QDN A;  3VLD A;  3HVE B;  2IOL A;  4RSY A;  4A3V A;  2X6K A;  5CCL A;  3ZVV A;  2CFU A;  2Y4U A;  4FC8 A;  4DK5 A;  3BG0 B;  4BSX A;  1OWL A;  1NP7 A;  3FUE A;  1NZN A;  3FUM A;  1U3C A;  3ML8 A;  4I1A A;  5KJM A;  2VJ8 A;  1KLX A;  5ENN A;  4WNG A;  5CMY A;  4ACL A;  1E8W A;  2HM8 A;  3PDN A;  4NAC A;  4FJZ A;  2L0I A;  3PNT B;  4N3A A;  1L5J A;  3GYZ A;  4I9C A;  2WXN A;  3Q49 B;  2I1J A;  3QWV A;  4CDR A;  5LP0 A;  5LX8 A;  1B89 A;  3RO3 A;  1HG2 A;  3PUK A;  3MKR A;  1HO8 A;  4MKT A;  2JEK A;  5AJL A;  3SBT B;  1N54 A;  3HDX A;  4LCT A;  4APF A;  4XKC A;  3HIZ A;  3CVU A;  4EZK A;  1JWF A;  2WXF A;  3FU5 A;  3FUD A;  4GMJ A;  1E7U A;  2UY1 B;  4WAF A;  1WM5 A;  3MKQ A;  4FAD A;  3L6A A;  2LSU A;  4H7X A;  4HLE A;  3APF A;  2X6H A;  3EDT B;  3UUX A;  2XRZ A;  3ZEF A;  3QK0 A;  4ME2 A;  1DNP A;  4BY6 A;  2WXK A;  2J49 A;  4WWN A;  2C2L A;  3FTS A;  3MCX A;  5AIJ A;  4J8E A;  1EDU A;  3ZGQ A;  1IHG A;  3RO2 A;  5LCW C;  2LAH A;  1H0A A;  4BX9 A;  5G04 C;  2WMN A;  3P2B A;  2YIN A;  4IN3 B;  4ILH B;  4DLO A;  3O48 A;  2Y4T A;  4V3I A;  3ZXS A;  4TV3 A;  3S7D A;  1XGW A;  5FQ6 A;  2WXI A;  4YVO A;  4A1S A;  4DJA A;  4F3V A;  4OYS A;  4IRU A;  2CHW A;  2KCL A;  1MHQ A;  3ZW3 A;  4G2V A;  2YHC A;  5JJ7 A;  1WAO 1;  3PVL A;  2CHZ A;  3FU0 A;  3T5V A;  4B8C B;  4WNE A;  4A55 A;  1HFA A;  1YA0 A;  3BG1 B;  3D9P A;  3D9N A;  2C0L A;  2WXP A;  2A5U A;  4GA0 A;  5BW8 C;  4N3C A;  4L7T A;  4ILG A;  4EBA A;  4B8A A;  5FJY A;  2VSN A;  5HI7 A;  3ZRH A;  3QC1 A;  2RD0 A;  3ZFW A;  2R17 C;  2IU1 A;  3TL5 A;  3FY4 A;  2VYI A;  4ATG A;  3CVX A;  2PQR A;  2ION A;  4UWK A;  2WVI A;  4GCO A;  3PRZ A;  2FUL A;  4JA7 A;  3SHF A;  4E85 A;  1OWN A;  4JEH A;  4EZJ A;  2XPZ A;  1HE8 A;  4NQ0 A;  4JHR A;  3NZS A;  4U04 A;  3OXL A;  2VSO E;  3MJW A;  3QWP A;  5FT9 A;  2BUG A;  4HOU A;  1OWM A;  2YQ8 A;  4PDX A;  4I6J A;  5J90 A;  3QOU A;  1BPO A;  4O6F A;  4AXH A;  5T4Y A;  3LJ3 A;  1UW4 B;  5EX3 A;  2KAT A;  4GCN A;  2E0I A;  4N3B A;  4XX5 A;  2LSV A;  4ILI A;  3FEX A;  4G24 A;  3CST A;  2OV8 A;  3FFL A;  3TG4 A;  3VLF A;  2WB2 A;  4I43 A;  3FTU A;  3I5P A;  3MZL B;  4I1O B;  3ZHE A;  4F7A A;  2MHK A;  4JEU A;  4CT0 A;  2A4Z A;  3GZ1 A;  3ML9 A;  4NUR A;  3AU5 A;  3CKC A;  2AXZ A;  1A17 A;  3CIA A;  4DLQ A;  3FEY A;  3L08 A;  4U0U A;  2AVP A;  4DI3 A;  2X6I A;  5DBK A;  4CEM A;  2I9C A;  2OVF A;  4F53 A;  4AV7 A;  3UT8 A;  4PUC A;  3CVV A;  1W3B A;  1SZA A;  2CHX A;  3HYM B;  3HHM A;  4M3O A;  4B89 A;  4JW1 A;  3EHM A;  4C0E A;  5EDS A;  2XEV A;  4FA6 A;  4I1M A;  1PC2 A;  2VTB B;  2KC7 A;  4QFV A;  3LY8 A;  3U64 A;  1ZU2 A;  4CRW A;  2VGY A;  2XPI A;  2CG2 A;  3G2U A;  2X38 A;  3I4G A;  3LYA A;  2X6J A;  1HZ4 A;  3DPD A;  4U0Z A;  5KJN A;  3AS4 A;  4GZ6 A;  4JL0 A;  3SF4 A;  4G23 A;  2WQH A;  3RKV A;  2LAI A;  4EPZ A;  1Y6I A;  5FZQ A;  2KZT A;  1EYH A;  2J08 A;  4EQF A;  4XZ4 A;  4L2Y A;  5G55 A;  3L54 A;  2WQ7 A;  1E90 A;  4MRU A;  4YVQ C;  3KD7 A;  3CV0 A;  3IKO B;  4BT8 A;  4HS2 A;  4JHK A;  2MRI A;  3BEE A;  3FUJ A;  2AW6 A;  4U8H A;  4HXI A;  3ASF A;  3SD5 A;  2KCK A;  5FQ4 A;  3QAR A;  4I6E A;  3PEV B;  5ARG A;  4OVV A;  5LOZ A;  1ELK A;  4BX8 A;  3P1U A;  3AU4 A;  4BTB A;  2FEZ A;  1ELR A;  4UWG A;  3LY9 A;  3CVN A;  3QNK A;  5G05 C;  2Y3A A;  2YNQ A;  4Q94 A;  3TGO A;  1QZ2 A;  2L9B A;  3L13 A;  3D9M A;  5FQ7 A;  4BFR A;  3MV2 B;  2VGX B;  3FH8 A;  4UQZ A;  5LFA A;  3RIB A;  4J8F A;  5BV1 A;  1LF8 A;  4XE0 A;  2WXG A;  2FI7 A;  4ANW A;  2WXM A;  4IUL A;  4J8S A;  5ANL A;  2PQN A;  1HH8 A;  2J09 A;  4GML A;  3JYS A;  4Y6C A;  3MEK A;  2VSY A;  3Q4A B;  1IYG A;  3PE3 A;  1HG5 A;  3CK7 A;  3S2A A;  3CVW A;  1QNF A;  3FUL A;  4KMO A;  2XRY A;  3CK8 A;  5ARF A;  2YHE A;  4J0U A;  2L0T B;  3CHR A;  2V4L A;  2WXJ A;  1HX8 A;  3UMV A;  3WXX A;  3PEU B;  4A1G A;  3D9O A;  3CQG B;  1H2V C;  3CEQ A;  3OTN A;  5A7D B;  4CGV A;  3Q47 B;  3SFZ A;  4ANX A;  4YND A;  2IOS A;  3FUI A;  4RG9 A;  2OVB A;  4URK A;  2DIW A;  3D9K A;  3PE4 A;  5G2N A;  3UPV A;  4AY6 A;  2HO1 A;  1KT1 A;  1IQU A;  4I9E A;  3CHO A;  4ACK A;  5EX0 A;  4PH4 B;  5T3R A;  3ZIM A;  2J4D A;  1E8Z A;  1FVH A;  2V8S E;  3ASD A;  3FH5 A;  4TRQ A;  1EF1 C;  4XI0 A;  3CGH A;  3GZ2 A;  4GZC A;  3TXM A;  4APO A;  5BNW A;  3L16 A;  4UQY A;  3S7J A;  1H6K A;  4ANU A;  3DBS A;  5JJ6 A;  2V5F A;  4KT6 B;  5BPP A;  3IBE A;  5CHE E;  4GAA A;  4FP7 A;  4RVB A;  5M72 A;  2JLB A;  3ASG A;  5KCM A;  3FUF A;  4CGW A;  4GZD A;  4K0R A;  3SI5 A;  3PUJ A;  4H7Y A;  4UWL A;  3KAE A;  4L23 A;  1OUV A;  2GGF A;  2WMO A;  4JXT A;  5FQ8 A;  2WXQ A;  3U66 A;  3L22 A;  1JPL A;  1HF8 A;  3T5X A;  3UT4 A;  4CDN A;  5JHA A;  3G2T A;  2ZU6 B;  4FUL A;  5BT1 A;  3JQ1 A;  3PZD A;  4KZC A;  3QWW A;  3U4T A;  3ESL A;  4UWH A;  4KVO A;  4FLB A;  3RRM B;  4U07 A;  1X5B A;  4HOT A;  5EKQ D;  3FUH A;  1SQM A;  2IF4 A;  2VQ2 A;  3MKQ B;  3Q5M A;  3PH0 C;  1GW6 A;  5DIZ A;  3R9A B;  3FUK A;  4A3T A;  4UWF A;  4AM9 A;  2CG3 A;  1UN9 A;  3G2S A;  1WY6 A;  1DVP A;  2LNI A;  4GA1 A;  4AOF A;  4JPS A;  2XGM A;  5D0Q D;  3CHQ A;  4GB9 A;  3QAQ A;  3MV3 B;  3C98 A;  3MGB A;  3LY7 A;  5D0O D;  1S0P A;  4CT4 A;  3ASH A;  3LKU A;  4JHJ A;  5E75 A;  5BV0 A;  1N52 A;  1HU3 A;  4J8D A;  4KVM A;  1JUQ A;  4PS7 A;  4E6H A;  2R59 A;  2WXR A;  4GA2 A;  2XCC A;  4N39 A;  4EBA G;  4B94 A;  2DCP A;  1E96 B;  3FUN A;  3KEZ A;  1H2U A;  3CQC B;  4HVB A;  5AEN A;  4MS6 A;  3JQ0 A;  2AXV A;  3FWV A;  3ZYM A;  3I4R B;  1Y8M A;  4KXK B;  3ESK A;  4G26 A;  5E76 A;  3ZYQ A;  3S7F A;  2IQC A;  4CCA A;  4G1T A;  3U9W A;  4WNF A;  3LXU X;  2VSX E;  3D3M A;  3PNL B;  2QY7 A;  4I17 A;  4P29 A;  4IYP A;  1Z6T A;  3L17 A;  1TEZ A;  2PM6 A;  3LS8 A;  2I2O A;  3LVQ E;  4JC8 A;  2L6J A;  3RJV A;  3IEG A;  3OAW A;  4WND A;  5FZR A;  2HYZ A;  3NF1 A;  2I1K A;  3CK9 A;  3FU6 A;  4FJY A;  4R7L A;  5CMW A;  1ZBP A;  3AS8 A;  4LEU A;  2DBA A;  4KBQ A;  4KZ0 A;  4GYW A;  4C0M A;  2XQ0 A;  5AJD A;  4ABN A;  3EIJ A;  2J9Q A;  4L1B A;  2KCV A;  1UJJ A;  3CHS A;  3CVP A;  2GRM A;  3EIQ C;  3U3W A;  3ENE A;  4FLH A;  2RG8 A;  4WWP A;  1OWO A;  4WUY A;  3EJN A;  3R7Q A;  4FHJ A;  2XPY A;  4AIF A;  3FDH A;  3SNX A;  1E7V A;  3FU3 A;  2J07 A;  2NC9 A;  3FTZ A;  3B13 A;  1UG3 A;  3T8M A;  2J4B A;  5A23 A;  2CFZ A;  1SZ9 A;  3G2W A;  3MA5 A;  3B7R L;  5T8I A;  4I2W A;  2FO7 A;  3CVY A;  5AYW D;  2EQX A;  3KS2 A;  3QJZ A;  4NRH B;  5JJT A;  3IHY A;  5A6C A;  3TXN A;  3FTX A;  2R5S A;  3PS6 A;  1FVF A;  3ZYK A;  2V0P A;  4HOR A;  3B7T A;  3RU0 A;  3QB2 A;  3LCA A;  3GZS A;  3D9L A;  3EHN A;  2NXP A;  3RRU A;  3SGH A;  3URZ A;  3ZHE B;  3LDZ A;  4PS3 A;  2OOE A;  3I3N A;  3ONL A;  5FTP A;  2WXO A;  3APD A;  3CVL A;  4HOQ A;  5FZS A;  4AP2 A;  1E8X A;  2E2E A;  3ONK A;  3FTY A;  4AVX A;  4BWR A;  1TJC A;  1Z3X A;  1EPU A;  4PS8 A;  2M63 A;  2VTB A;  2BTD A;  1HXI A;  4D10 C;  3CKB A;  3CLJ A;  2AXU A;  5CCM A;  2BF0 X;  3NQP A;  1VDY A;  2IJG X;  2MOW A;  3S7B A;  1KT0 A;  4Q96 A;  4N2S A;  1IQR A;  2ILR A;  3HVE A;  3UX4 A;  4U0S A;  4GYY A;  4HOS A;  3G2V A;  3TJP A;  3NZU A;  3R7R A;  3TG5 A;  4CDM A;  4JZY A;  3FTW A;  2AWI A;  2I6H A;  3LVR E;  2IFU A;  4EEC A;  3QKY A;  2PZI A;  4LRZ A;  3FH7 A;  2WQ6 A;  1PAQ A;  3CSF A;  4U63 A;  4AEZ C;  4UI9 J;  2KM4 A;  2XGO A;  4HFG A;  5C1D A;  2XHE A;  3K9I A;  3O4Z A;  5BUZ A;  3SZ7 A;  4J6I A;  2KZT B;  2FF4 A;  2X3M A;  1UJK A;  2PL2 A;  4UQX A;  2XGS A;  2P58 C;  2UY1 A;  2WXH A;  4B0Z A;  4XIF A;  1UN8 A;  4BTA A;  3OXF A;  5J08 A;  4GYO A;  4Y6W A;  3OXG A;  2NSZ A;  4XKB A;  4DI4 A;  2FBN A;  3AS5 A;  2C0M A;  4WWO A;  1QQE A;  3LPZ A;  2QFC A;  4FU3 A;  5HQ8 A;  2Q7F A;  4C9B B;  2VGX A;  3FTV A;  4UI9 K;  3ZN3 A;  3E4B A;  4ANV A;  4BT9 A;  1XNF A;  1PY1 A;  3CR3 A;  4N5C A;  3FHE A;  3UT7 A;  4AY5 A;  4G25 A;  1H19 A;  3MX3 A;  4TUU A;  2OND A;  3VTX A;  3CVQ A;  3TAX A;  3VTY A;  3VLE A;  4DPR A;  3LEW A;  4N2Q A;  4Q69 A;  4GZ3 A;  3MYV A;  3ZPJ A;  5G05 J;  2GRL A;  3CHP A;  3IV0 A;  4GU5 A;  4W9R A;  1MQS A;  3CHM A;  3RRN B;  3D9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...