3MLFA

Putative transcriptional regulator from staphylococcus aureus.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
95
structure length
95
Chain Sequence
TENLYFQSNAMKTLKELRTDYGLTQKELGDLFKVSSRTIQNMEKDSTNIKDSLLSKYMSAFNVKYDDIFLGNEYENFVFTNDKKKSIILAFKEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of putative transcriptional regulator from Staphylococcus aureus.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transcription regulator
molecule keywords transcriptional regulator
total genus 29
structure length 95
sequence length 95
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3mlfA00
4X4BA 2IVGA 1QP4A 1LLIA 1YSEA 3R1FA 1QP7A 4I8TA 1Y9QA 1DWKA 2GZUA 2GRLA 1HF0A 1RZRA 4GHJA 3FYAA 4X4HA 1JWLA 3UFDA 1LCCA 3QWGA 3L1PA 2B5AA 3GN5A 4PU7A 3H5TA 2A6CA 1RPEL 4Z59A 2CSFA 1X57A 1NERA 2AXUA 2EBYA 1PRUA 1ADRA 1ZZCA 2L8NA 1AU7A 2LYPA 2LYRA 4J1WA 4J1XA 2KEJA 2BJCA 1CQTA 4YG4A 2XI8A 3QQ6A 1LQCA 2PPXA 1WETA 4IVZA 2HINA 2KPJA 2PIJA 4OB4A 1ZPQA 1QP0A 2D5VA 2OFYA 2AXVA 4YG1A 4NDWA 4JCXA 4MCTA 1SQ8A 2OR1L 1XWRA 2PUBA 1CJGA 1ZVVA 1ZZ7A 1E3OC 3JXDL 4Z5DA 1Y7YA 3GN5B 1S7EA 1WH6A 2R1JL 3OQOA 2IVBA 3RZZA 1UXDA 2JCGA 4I6RA 3ZKCA 1UXCA 1IC8A 3BDNA 1LMB3 2LYQA 3OP9A 1POUA 4GQMA 2PUGA 2O4AA 3VK0A 3ZHIA 4IA8A 3TRBA 1ZZ9A 2LCVA 2GRMA 1ZZ8A 1PNRA 1BDHA 2IU7A 1ZS4A 2MQKA 2LYSA 2AWIA 2IUOA 2LYKA 3EUSA 2XIUA 4FN3A 1OSLA 1X2LA 4X4GA 1RZSA 4PU4C 3KZ3A 4I6TA 5K98B 4X4DA 4X4CA 2XCJA 3KJXA 3G7DA 3CECA 3F6WA 4Z58A 3JXBC 3HZIB 3OMTA 2PUAA 2XJ3A 4FBIA 3SCHA 3OQNA 3G5GA 3BD1A 3LISA 3O9XA 3LFPA 2PUCA 4IWRA 3F51A 2PE5A 2AXZA 4YG7B 1QQAA 2CROA 3GBFA 4PU8A 3F52A 3QYXA 1JFTA 2HSGA 2AW6A 1PERL 2EF8A 1EFAA 1ZAYA 4X4IA 2EWTA 4Z5CA 1JFSA 3B7HA 1L1MA 1WH8A 2ICPA 4PU3C 1QPZA 1RIOA 4I6UA 1VPWA 2L49A 2H8RA 3FYMA 3BS3A 3FMYA 4MCXA 2KEIA 4YARA 1JH9A 3SCGA 1B0NA 3CROL 1WIZA 4YBAA 1QQBA 3ZHMA 1DW9A 2FJRA 3MLFA 2PUDA 2R63A 2O38A 1LCDA 2O49A 1BDIA 2AUWA 4Z5HA 4X4FA 1NEQA 1UTXA 3OQMA 2KEKA 3QF3A 2PUFA 3S8QA 5A7LA 3IVPA 2MEZA 4F8DA 1RZRD 4JQDA 1ZZ6A 2WIUB 1PRAA 4JCYA 2IV1A 3JXCL 3PXPA 1OCTC 2ICTA 3DNVB 2JVLA 1GT0C 2LYLA 1R69A 1PRVA 3D1NI 3U3WA 2IVQA 3CLCA 4Y42A 2KZ8A 2LYJA 2BNOA 1O4XA 1ZUGA 1R63A 2BNMA 2PUEA 2XSDC 2BNNA 1ZZBA 3KXAA 4O8BA 3SCFA 4X4EA 2WUSR
chains in the Genus database with same CATH superfamily
1QP4A 1YSEA 1QP7A 5DSXA 1RZRA 4GHJA 4X4HA 2A6CA 4EKIA 3M9LA 4ER6A 2LYRA 4J1XA 4IVZA 2LLVA 4YG1A 4JCXA 2LNMA 1ZVVA 4Z5DA 3GN5B 2R1JL 3GZDA 3R09A 4I6RA 1LMB3 2PUGA 3ZHIA 4IA8A 2LCVA 2IU7A 3GZCA 4EQZA 2IUOA 3QFIA 3SR4A 1X2LA 4PU4C 4I6TA 1DULA 3CECA 3JXBC 2XJ3A 3BD1A 2YBDA 3VWSA 2AXZA 1JFTA 2HSGA 2EF8A 1EFAA 3ZPXA 2EWTA 1JFSA 1L1MA 2ICPA 4PU3C 1QPZA 4ER3A 1RIOA 4I6UA 3LQXA 3FYMA 4MCXA 1JH9A 3SCGA 3TEPA 1QQBA 2PXDA 2O49A 4Z5HA 4X4FA 3S8QA 4WVLA 5A7LA 1ZZ6A 3A9ZA 1PRAA 4JCYA 2IV1A 2ICTA 3DNVB 2LYLA 1R69A 1PRVA 4Y42A 1O4XA 2BNOA 2BNMA 2XXQA 3DM5A 1QB2A 4O8BA 5GAGi 3PE5A 3R1FA 2V3CC 1DWKA 3A9YA 4EK9A 2J7UA 1JWLA 3FYAA 5DRYA 4Z59A 1X57A 2PXLA 1ZZCA 2L8NA 1AU7A 1CQTA 4YG4A 1LQCA 2PXPA 1ZPQA 1QP0A 2D5VA 2AXVA 2OFYA 4NDWA 1SQ8A 4Q2JA 1S7EA 3OQOA 3RZZA 3ZKCA 3BDNA 3MEJA 3OP9A 1POUA 2PXEA 2O4AA 3VK0A 4HRAA 1HQ1A 3TRBA 1ZZ8A 1ZS4A 2LYSA 2LYKA 2XIUA 4X4GA 1RZSA 4DE8A 4X4DA 2XCJA 4EZIA 2PXVA 3F6WA 2XXPA 2PUAA 4OBMA 3G5GA 3O9XA 4IWRA 4DE9A 2PE5A 4PU8A 3QYXA 2AW6A 3A9XA 2PXQA 2HCSA 3UWPA 1VPWA 2H8RA 3BS3A 3FMYA 1BDIA 4ER5A 2MEZA 1RZRD 1OCTC 4ER0A 4ER7A 2JVLA 3D1NI 2M4HA 3SX0A 2J7WA 1R63A 2XSDC 2BNNA 2XXAA 2OR1L 3HZIB 2HFZA 4X4BA 2IVGA 1Y9QA 2GZUA 3NDBB 1LCCA 3G0TA 3UFDA 3L1PA 2B5AA 3GN5A 3H5TA 1RPEL 1NERA 1ADRA 1PRUA 3TELA 2LYPA 4J1WA 2LLWA 2XI8A 1WETA 2HINA 2HCNA 4MCTA 1XWRA 1ZZ7A 3JXDL 1Y7YA 1WH6A 2IVBA 1UXDA 3TFLA 1UXCA 4GQMA 1PNRA 2MQKA 4FN3A 3KZ3A 5K98B 4X4CA 3KJXA 4Z58A 3OMTA 3SCHA 3OQNA 3LFPA 2PXKA 3F51A 3GZDC 2FFHA 4YG7B 1QQAA 2CROA 3GBFA 3F52A 1PERL 4X4IA 2L49A 2ODRD 2KEIA 4YARA 3QOWA 3CROL 5DTRA 2L1PA 2FJRA 2PUDA 2R63A 3NZLA 1LCDA 1UTXA 2KEKA 3OKZA 3QOXA 4F8DA 2WIUB 3OWQA 5DTQA 3JXCL 3U3WA 2IVQA 3CLCA 2KZ8A 1ZUGA 2VEOA 2PUEA 4EKGA 3KXAA 4X4EA 2WUSR 3LISA 3KL4A 1LLIA 2PXTA 3NXHA 2GRLA 1HF0A 3QWGA 4PU7A 2PXFA 2PXUA 2CSFA 2AXUA 2EBYA 5GAHi 2KEJA 2BJCA 3ME5A 2JQEA 3GUUA 3QQ6A 2PPXA 2KPJA 2PIJA 5JUWA 4OB4A 2PUBA 1CJGA 1E3OC 2JCGA 1IC8A 2LYQA 3NROA 1ZZ9A 2GRMA 1BDHA 3EUSA 2AWIA 1OSLA 2MXDA 3G7DA 4FBIA 2PUCA 1QZXA 2PXBA 1ZAYA 4Z5CA 3B7HA 1WH8A 5DT2A 5DTMA 1B0NA 1WIZA 4YBAA 3ZHMA 1DW9A 3MLFA 1MFQC 2O38A 2AUWA 1NEQA 3OQMA 3QF3A 2PUFA 4JQDA 3IVPA 3PXPA 1U2ZA 1GT0C 5DRTA 1NW3A 2LYJA 1ZZBA 4I8TA 3SCFA
chains in the Genus database with same CATH topology
4X4BA 2IVGA 1QP4A 1LLIA 1YSEA 3R1FA 1QP7A 4I8TA 1Y9QA 1DWKA 2GZUA 2GRLA 1HF0A 1RZRA 4GHJA 3FYAA 4X4HA 1JWLA 3UFDA 1LCCA 3QWGA 3L1PA 2B5AA 3GN5A 4PU7A 3H5TA 2A6CA 1RPEL 4Z59A 2CSFA 1X57A 1NERA 2AXUA 2EBYA 1PRUA 1ADRA 1ZZCA 2L8NA 1AU7A 2LYPA 2LYRA 4J1WA 4J1XA 2KEJA 2BJCA 1CQTA 4YG4A 2XI8A 3QQ6A 1LQCA 2PPXA 1WETA 4IVZA 2HINA 2KPJA 2PIJA 4OB4A 1ZPQA 1QP0A 2D5VA 2OFYA 2AXVA 4YG1A 4NDWA 4JCXA 4MCTA 1SQ8A 2OR1L 1XWRA 2PUBA 1CJGA 1ZVVA 1ZZ7A 1E3OC 3JXDL 4Z5DA 1Y7YA 3GN5B 1S7EA 1WH6A 2R1JL 3OQOA 2IVBA 3RZZA 1UXDA 2JCGA 4I6RA 3ZKCA 1UXCA 1IC8A 3BDNA 1LMB3 2LYQA 3OP9A 1POUA 4GQMA 2PUGA 2O4AA 3VK0A 3ZHIA 4IA8A 3TRBA 1ZZ9A 2LCVA 2GRMA 1ZZ8A 1PNRA 1BDHA 2IU7A 1ZS4A 2MQKA 2LYSA 2AWIA 2IUOA 2LYKA 3EUSA 2XIUA 4FN3A 1OSLA 1X2LA 4X4GA 1RZSA 4PU4C 3KZ3A 4I6TA 5K98B 4X4DA 4X4CA 2XCJA 3KJXA 3G7DA 3CECA 3F6WA 4Z58A 3JXBC 3HZIB 3OMTA 2PUAA 2XJ3A 4FBIA 3SCHA 3OQNA 3G5GA 3BD1A 3LISA 3O9XA 3LFPA 2PUCA 4IWRA 3F51A 2PE5A 2AXZA 4YG7B 1QQAA 2CROA 3GBFA 4PU8A 3F52A 3QYXA 1JFTA 2HSGA 2AW6A 1PERL 2EF8A 1EFAA 1ZAYA 4X4IA 2EWTA 4Z5CA 1JFSA 3B7HA 1L1MA 1WH8A 2ICPA 4PU3C 1QPZA 1RIOA 4I6UA 1VPWA 2L49A 2H8RA 3FYMA 3BS3A 3FMYA 4MCXA 2KEIA 4YARA 1JH9A 3SCGA 1B0NA 3CROL 1WIZA 4YBAA 1QQBA 3ZHMA 1DW9A 2FJRA 3MLFA 2PUDA 2R63A 2O38A 1LCDA 2O49A 1BDIA 2AUWA 4Z5HA 4X4FA 1NEQA 1UTXA 3OQMA 2KEKA 3QF3A 2PUFA 3S8QA 5A7LA 3IVPA 2MEZA 4F8DA 1RZRD 4JQDA 1ZZ6A 2WIUB 1PRAA 4JCYA 2IV1A 3JXCL 3PXPA 1OCTC 2ICTA 3DNVB 2JVLA 1GT0C 2LYLA 1R69A 1PRVA 3D1NI 3U3WA 2IVQA 3CLCA 4Y42A 2KZ8A 2LYJA 2BNOA 1O4XA 1ZUGA 1R63A 2BNMA 2PUEA 2XSDC 2BNNA 1ZZBA 3KXAA 4O8BA 3SCFA 4X4EA 2WUSR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X4B A;  2IVG A;  1QP4 A;  1LLI A;  1YSE A;  3R1F A;  1QP7 A;  4I8T A;  1Y9Q A;  1DWK A;  2GZU A;  2GRL A;  1HF0 A;  1RZR A;  4GHJ A;  3FYA A;  4X4H A;  1JWL A;  3UFD A;  1LCC A;  3QWG A;  3L1P A;  2B5A A;  3GN5 A;  4PU7 A;  3H5T A;  2A6C A;  1RPE L;  4Z59 A;  2CSF A;  1X57 A;  1NER A;  2AXU A;  2EBY A;  1PRU A;  1ADR A;  1ZZC A;  2L8N A;  1AU7 A;  2LYP A;  2LYR A;  4J1W A;  4J1X A;  2KEJ A;  2BJC A;  1CQT A;  4YG4 A;  2XI8 A;  3QQ6 A;  1LQC A;  2PPX A;  1WET A;  4IVZ A;  2HIN A;  2KPJ A;  2PIJ A;  4OB4 A;  1ZPQ A;  1QP0 A;  2D5V A;  2OFY A;  2AXV A;  4YG1 A;  4NDW A;  4JCX A;  4MCT A;  1SQ8 A;  2OR1 L;  1XWR A;  2PUB A;  1CJG A;  1ZVV A;  1ZZ7 A;  1E3O C;  3JXD L;  4Z5D A;  1Y7Y A;  3GN5 B;  1S7E A;  1WH6 A;  2R1J L;  3OQO A;  2IVB A;  3RZZ A;  1UXD A;  2JCG A;  4I6R A;  3ZKC A;  1UXC A;  1IC8 A;  3BDN A;  1LMB 3;  2LYQ A;  3OP9 A;  1POU A;  4GQM A;  2PUG A;  2O4A A;  3VK0 A;  3ZHI A;  4IA8 A;  3TRB A;  1ZZ9 A;  2LCV A;  2GRM A;  1ZZ8 A;  1PNR A;  1BDH A;  2IU7 A;  1ZS4 A;  2MQK A;  2LYS A;  2AWI A;  2IUO A;  2LYK A;  3EUS A;  2XIU A;  4FN3 A;  1OSL A;  1X2L A;  4X4G A;  1RZS A;  4PU4 C;  3KZ3 A;  4I6T A;  5K98 B;  4X4D A;  4X4C A;  2XCJ A;  3KJX A;  3G7D A;  3CEC A;  3F6W A;  4Z58 A;  3JXB C;  3HZI B;  3OMT A;  2PUA A;  2XJ3 A;  4FBI A;  3SCH A;  3OQN A;  3G5G A;  3BD1 A;  3LIS A;  3O9X A;  3LFP A;  2PUC A;  4IWR A;  3F51 A;  2PE5 A;  2AXZ A;  4YG7 B;  1QQA A;  2CRO A;  3GBF A;  4PU8 A;  3F52 A;  3QYX A;  1JFT A;  2HSG A;  2AW6 A;  1PER L;  2EF8 A;  1EFA A;  1ZAY A;  4X4I A;  2EWT A;  4Z5C A;  1JFS A;  3B7H A;  1L1M A;  1WH8 A;  2ICP A;  4PU3 C;  1QPZ A;  1RIO A;  4I6U A;  1VPW A;  2L49 A;  2H8R A;  3FYM A;  3BS3 A;  3FMY A;  4MCX A;  2KEI A;  4YAR A;  1JH9 A;  3SCG A;  1B0N A;  3CRO L;  1WIZ A;  4YBA A;  1QQB A;  3ZHM A;  1DW9 A;  2FJR A;  3MLF A;  2PUD A;  2R63 A;  2O38 A;  1LCD A;  2O49 A;  1BDI A;  2AUW A;  4Z5H A;  4X4F A;  1NEQ A;  1UTX A;  3OQM A;  2KEK A;  3QF3 A;  2PUF A;  3S8Q A;  5A7L A;  3IVP A;  2MEZ A;  4F8D A;  1RZR D;  4JQD A;  1ZZ6 A;  2WIU B;  1PRA A;  4JCY A;  2IV1 A;  3JXC L;  3PXP A;  1OCT C;  2ICT A;  3DNV B;  2JVL A;  1GT0 C;  2LYL A;  1R69 A;  1PRV A;  3D1N I;  3U3W A;  2IVQ A;  3CLC A;  4Y42 A;  2KZ8 A;  2LYJ A;  2BNO A;  1O4X A;  1ZUG A;  1R63 A;  2BNM A;  2PUE A;  2XSD C;  2BNN A;  1ZZB A;  3KXA A;  4O8B A;  3SCF A;  4X4E A;  2WUS R; 
#chains in the Genus database with same CATH topology
 1QP4 A;  1YSE A;  1QP7 A;  5DSX A;  1RZR A;  4GHJ A;  4X4H A;  2A6C A;  4EKI A;  3M9L A;  4ER6 A;  2LYR A;  4J1X A;  4IVZ A;  2LLV A;  4YG1 A;  4JCX A;  2LNM A;  1ZVV A;  4Z5D A;  3GN5 B;  2R1J L;  3GZD A;  3R09 A;  4I6R A;  1LMB 3;  2PUG A;  3ZHI A;  4IA8 A;  2LCV A;  2IU7 A;  3GZC A;  4EQZ A;  2IUO A;  3QFI A;  3SR4 A;  1X2L A;  4PU4 C;  4I6T A;  1DUL A;  3CEC A;  3JXB C;  2XJ3 A;  3BD1 A;  2YBD A;  3VWS A;  2AXZ A;  1JFT A;  2HSG A;  2EF8 A;  1EFA A;  3ZPX A;  2EWT A;  1JFS A;  1L1M A;  2ICP A;  4PU3 C;  1QPZ A;  4ER3 A;  1RIO A;  4I6U A;  3LQX A;  3FYM A;  4MCX A;  1JH9 A;  3SCG A;  3TEP A;  1QQB A;  2PXD A;  2O49 A;  4Z5H A;  4X4F A;  3S8Q A;  4WVL A;  5A7L A;  1ZZ6 A;  3A9Z A;  1PRA A;  4JCY A;  2IV1 A;  2ICT A;  3DNV B;  2LYL A;  1R69 A;  1PRV A;  4Y42 A;  1O4X A;  2BNO A;  2BNM A;  2XXQ A;  3DM5 A;  1QB2 A;  4O8B A;  5GAG i;  3PE5 A;  3R1F A;  2V3C C;  1DWK A;  3A9Y A;  4EK9 A;  2J7U A;  1JWL A;  3FYA A;  5DRY A;  4Z59 A;  1X57 A;  2PXL A;  1ZZC A;  2L8N A;  1AU7 A;  1CQT A;  4YG4 A;  1LQC A;  2PXP A;  1ZPQ A;  1QP0 A;  2D5V A;  2AXV A;  2OFY A;  4NDW A;  1SQ8 A;  4Q2J A;  1S7E A;  3OQO A;  3RZZ A;  3ZKC A;  3BDN A;  3MEJ A;  3OP9 A;  1POU A;  2PXE A;  2O4A A;  3VK0 A;  4HRA A;  1HQ1 A;  3TRB A;  1ZZ8 A;  1ZS4 A;  2LYS A;  2LYK A;  2XIU A;  4X4G A;  1RZS A;  4DE8 A;  4X4D A;  2XCJ A;  4EZI A;  2PXV A;  3F6W A;  2XXP A;  2PUA A;  4OBM A;  3G5G A;  3O9X A;  4IWR A;  4DE9 A;  2PE5 A;  4PU8 A;  3QYX A;  2AW6 A;  3A9X A;  2PXQ A;  2HCS A;  3UWP A;  1VPW A;  2H8R A;  3BS3 A;  3FMY A;  1BDI A;  4ER5 A;  2MEZ A;  1RZR D;  1OCT C;  4ER0 A;  4ER7 A;  2JVL A;  3D1N I;  2M4H A;  3SX0 A;  2J7W A;  1R63 A;  2XSD C;  2BNN A;  2XXA A;  2OR1 L;  3HZI B;  2HFZ A;  4X4B A;  2IVG A;  1Y9Q A;  2GZU A;  3NDB B;  1LCC A;  3G0T A;  3UFD A;  3L1P A;  2B5A A;  3GN5 A;  3H5T A;  1RPE L;  1NER A;  1ADR A;  1PRU A;  3TEL A;  2LYP A;  4J1W A;  2LLW A;  2XI8 A;  1WET A;  2HIN A;  2HCN A;  4MCT A;  1XWR A;  1ZZ7 A;  3JXD L;  1Y7Y A;  1WH6 A;  2IVB A;  1UXD A;  3TFL A;  1UXC A;  4GQM A;  1PNR A;  2MQK A;  4FN3 A;  3KZ3 A;  5K98 B;  4X4C A;  3KJX A;  4Z58 A;  3OMT A;  3SCH A;  3OQN A;  3LFP A;  2PXK A;  3F51 A;  3GZD C;  2FFH A;  4YG7 B;  1QQA A;  2CRO A;  3GBF A;  3F52 A;  1PER L;  4X4I A;  2L49 A;  2ODR D;  2KEI A;  4YAR A;  3QOW A;  3CRO L;  5DTR A;  2L1P A;  2FJR A;  2PUD A;  2R63 A;  3NZL A;  1LCD A;  1UTX A;  2KEK A;  3OKZ A;  3QOX A;  4F8D A;  2WIU B;  3OWQ A;  5DTQ A;  3JXC L;  3U3W A;  2IVQ A;  3CLC A;  2KZ8 A;  1ZUG A;  2VEO A;  2PUE A;  4EKG A;  3KXA A;  4X4E A;  2WUS R;  3LIS A;  3KL4 A;  1LLI A;  2PXT A;  3NXH A;  2GRL A;  1HF0 A;  3QWG A;  4PU7 A;  2PXF A;  2PXU A;  2CSF A;  2AXU A;  2EBY A;  5GAH i;  2KEJ A;  2BJC A;  3ME5 A;  2JQE A;  3GUU A;  3QQ6 A;  2PPX A;  2KPJ A;  2PIJ A;  5JUW A;  4OB4 A;  2PUB A;  1CJG A;  1E3O C;  2JCG A;  1IC8 A;  2LYQ A;  3NRO A;  1ZZ9 A;  2GRM A;  1BDH A;  3EUS A;  2AWI A;  1OSL A;  2MXD A;  3G7D A;  4FBI A;  2PUC A;  1QZX A;  2PXB A;  1ZAY A;  4Z5C A;  3B7H A;  1WH8 A;  5DT2 A;  5DTM A;  1B0N A;  1WIZ A;  4YBA A;  3ZHM A;  1DW9 A;  3MLF A;  1MFQ C;  2O38 A;  2AUW A;  1NEQ A;  3OQM A;  3QF3 A;  2PUF A;  4JQD A;  3IVP A;  3PXP A;  1U2Z A;  1GT0 C;  5DRT A;  1NW3 A;  2LYJ A;  1ZZB A;  4I8T A;  3SCF A; 
#chains in the Genus database with same CATH homology
 4X4B A;  2IVG A;  1QP4 A;  1LLI A;  1YSE A;  3R1F A;  1QP7 A;  4I8T A;  1Y9Q A;  1DWK A;  2GZU A;  2GRL A;  1HF0 A;  1RZR A;  4GHJ A;  3FYA A;  4X4H A;  1JWL A;  3UFD A;  1LCC A;  3QWG A;  3L1P A;  2B5A A;  3GN5 A;  4PU7 A;  3H5T A;  2A6C A;  1RPE L;  4Z59 A;  2CSF A;  1X57 A;  1NER A;  2AXU A;  2EBY A;  1PRU A;  1ADR A;  1ZZC A;  2L8N A;  1AU7 A;  2LYP A;  2LYR A;  4J1W A;  4J1X A;  2KEJ A;  2BJC A;  1CQT A;  4YG4 A;  2XI8 A;  3QQ6 A;  1LQC A;  2PPX A;  1WET A;  4IVZ A;  2HIN A;  2KPJ A;  2PIJ A;  4OB4 A;  1ZPQ A;  1QP0 A;  2D5V A;  2OFY A;  2AXV A;  4YG1 A;  4NDW A;  4JCX A;  4MCT A;  1SQ8 A;  2OR1 L;  1XWR A;  2PUB A;  1CJG A;  1ZVV A;  1ZZ7 A;  1E3O C;  3JXD L;  4Z5D A;  1Y7Y A;  3GN5 B;  1S7E A;  1WH6 A;  2R1J L;  3OQO A;  2IVB A;  3RZZ A;  1UXD A;  2JCG A;  4I6R A;  3ZKC A;  1UXC A;  1IC8 A;  3BDN A;  1LMB 3;  2LYQ A;  3OP9 A;  1POU A;  4GQM A;  2PUG A;  2O4A A;  3VK0 A;  3ZHI A;  4IA8 A;  3TRB A;  1ZZ9 A;  2LCV A;  2GRM A;  1ZZ8 A;  1PNR A;  1BDH A;  2IU7 A;  1ZS4 A;  2MQK A;  2LYS A;  2AWI A;  2IUO A;  2LYK A;  3EUS A;  2XIU A;  4FN3 A;  1OSL A;  1X2L A;  4X4G A;  1RZS A;  4PU4 C;  3KZ3 A;  4I6T A;  5K98 B;  4X4D A;  4X4C A;  2XCJ A;  3KJX A;  3G7D A;  3CEC A;  3F6W A;  4Z58 A;  3JXB C;  3HZI B;  3OMT A;  2PUA A;  2XJ3 A;  4FBI A;  3SCH A;  3OQN A;  3G5G A;  3BD1 A;  3LIS A;  3O9X A;  3LFP A;  2PUC A;  4IWR A;  3F51 A;  2PE5 A;  2AXZ A;  4YG7 B;  1QQA A;  2CRO A;  3GBF A;  4PU8 A;  3F52 A;  3QYX A;  1JFT A;  2HSG A;  2AW6 A;  1PER L;  2EF8 A;  1EFA A;  1ZAY A;  4X4I A;  2EWT A;  4Z5C A;  1JFS A;  3B7H A;  1L1M A;  1WH8 A;  2ICP A;  4PU3 C;  1QPZ A;  1RIO A;  4I6U A;  1VPW A;  2L49 A;  2H8R A;  3FYM A;  3BS3 A;  3FMY A;  4MCX A;  2KEI A;  4YAR A;  1JH9 A;  3SCG A;  1B0N A;  3CRO L;  1WIZ A;  4YBA A;  1QQB A;  3ZHM A;  1DW9 A;  2FJR A;  3MLF A;  2PUD A;  2R63 A;  2O38 A;  1LCD A;  2O49 A;  1BDI A;  2AUW A;  4Z5H A;  4X4F A;  1NEQ A;  1UTX A;  3OQM A;  2KEK A;  3QF3 A;  2PUF A;  3S8Q A;  5A7L A;  3IVP A;  2MEZ A;  4F8D A;  1RZR D;  4JQD A;  1ZZ6 A;  2WIU B;  1PRA A;  4JCY A;  2IV1 A;  3JXC L;  3PXP A;  1OCT C;  2ICT A;  3DNV B;  2JVL A;  1GT0 C;  2LYL A;  1R69 A;  1PRV A;  3D1N I;  3U3W A;  2IVQ A;  3CLC A;  4Y42 A;  2KZ8 A;  2LYJ A;  2BNO A;  1O4X A;  1ZUG A;  1R63 A;  2BNM A;  2PUE A;  2XSD C;  2BNN A;  1ZZB A;  3KXA A;  4O8B A;  3SCF A;  4X4E A;  2WUS R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...