3MLKA

Reduced (cu+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound nitrite
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
309
structure length
306
Chain Sequence
b'ECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDIRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
publication title Differential reactivity between two copper sites in peptidylglycine alpha-hydroxylating monooxygenase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 61
structure length 306
sequence length 309
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2010-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mlkA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 3mlkA01
1PNFA 3MIHA 4R4XA 1PHMA 1SDWA 3KS7A 1PGSA 3PHMA 3MIDA 3PMSA 3MIFA 4R4ZA 3MICA 1PNGA 3MLKA 1YI9A 1YJKA 3MLLA 1YJLA 4QHBA 4E4ZA 3MIBA 3MLJA 1YIPA 3MIGA 3MIEA 1OPMA
chains in the Genus database with same CATH superfamily
3MIHA 3WP3A 4CDQA 4YW4A 1CN1A 1VBD2 5HCHA 1BVP1 1KD7A 4HMZA 3NJXA 5A3LA 4ZZ5A 5CB7A 2CTVA 1W8FA 3VL9A 3I4IA 2GMPA 2P17A 1CONA 1ULEA 2DVDA 4B1MA 4Y20B 1GZ9A 1W6PB 3WHTA 1SCRA 2WSUA 4GD4A 2G4IA 3LIGA 4AI0A 4UAPA 4EN7B 4Z1VA 2BYVE 4ONUA 4A6SA 1S0DA 4YVSA 4D8MA 2DCKA 2Y0IA 4D0QA 4Q4V2 4M0HA 4CTEA 4AF9A 5HXMA 3WCRA 3I2FA 4AVBA 1PGL1 5DZEA 2R0HA 3CBNA 4LIVA 2EAKA 2RS13 2YG0A 3T2QA 2XG3A 2VUCA 4R4ZA 2WWUA 3WQ0A 5FBJA 1WWYA 2BDRA 4B8EA 3VL8A 4AAXA 4ARYA 2W68A 2Y6GA 1DZTA 4UFIA 5FZFA 3WP6A 3ZPYA 4WZFA 2D43A 1Q8OA 4I09A 3UGFA 5JZGA 3ZXEA 1GOFA 2D7FA 2TBVA 3PUAA 4EN6B 1PZ9A 4GQ7A 5FZ3A 2VNOA 4XQWA 1QY4A 4IERA 1MS0A 5A1AA 2DUQA 4JGYC 1FYUA 4AVTA 4YW6A 2WR9A 4PQQA 3ZYGA 4ZXKA 3VLBB 2R063 3LAGA 3RYKA 3ZIXA 1GU3A 4XAEA 2V72A 3IIIA 1SBDA 3RMXA 5JOYA 4ZXEA 4RA0A 1DQ0A 4YGBA 3USSA 4RFT0 3RZKA 1G9AA 4NPLA 3UJQA 1ZBA1 4RGGA 3PHMA 1TMF1 2ETEA 2X5IB 2JD9A 2YBSA 5T54A 4WVMA 2RE9A 2VTXJ 1OPOA 1W0NA 4P5YA 1YQ5A 4Q4X3 2JEMA 4LO6B 1V6MA 4INDA 3NKGA 4JCKA 1B35A 2EXHA 5FMBA 4NHMA 5APAA 1V9U3 5FWEA 4QHBA 5IAVA 2ZGSA 4QPIC 5BNNB 4OYUA 5DDJ3 3ZFGA 2BGCA 2Q8CA 3ZMOA 4OLLA 1CX4A 3HAGA 3FBMA 1R091 5CU1A 4NJ4A 4XFCA 3RFRA 2WZPP 4D6RA 5CFDB 3IM0A 1OQDA 4AEDB 2MEV2 4W65A 1C3HA 4BXFA 3BTAA 4M4RA 4PLOA 2E32A 3OTFA 4XF0A 3WG3A 3VD5A 1JODA 3RZLA 1ODNA 2B9UA 1O5UA 4HKOA 5FUIA 4IV1B 3TBDA 1OUXA 5F9TA 5FXWA 3RI8A 1J1LA 5ACA2 5J96B 1TNFA 2D44A 2OZ6A 5L9VA 5KHHA 4XUTA 3T0AA 4LLFA 1EAH2 3TB0A 4Q0PA 3JBG2 1RIRA 2EF6A 4M3CE 1JYTA 2WT0A 2DFCA 3GGLA 5FAXA 1WUVA 4HPKA 4P9GA 1F15A 2YPJA 3B5LB 4AHYA 3PUQA 4IEOA 4XYXA 1XYOA 2VJXA 1LHVA 3DN7A 2EVXA 1SLCA 1PVC1 3WHUA 1IS5A 4CXYA 2ZGTA 1R1A3 1AR72 3G7DA 4QX3A 2IXLA 5FYZA 3I2JA 1ASJ2 1W0PA 4BQYA 4HT1T 2AEYA 4IE6A 1M4WA 4OI2A 4XJ8A 3VKNA 2YXSA 5BY5A 5FZ1A 3IZOA 4R9DA 5A7NA 3PVOA 4L0PA 3AVSA 5CKMA 1ZBE1 2PFWA 2ZTNA 5FQ0A 2B5HA 2ORXA 1BHGA 2J1UA 3VBHC 5FYVA 2X5IC 4K1ZA 2XVLA 5ANQA 5IATA 1G86A 4COZA 5HXVA 4RR3B 1V6NA 3UK9A 4EROA 5I8SA 3IWZA 2SBAA 1C8M2 2ZZJA 1XJAA 4PDWC 3T2PA 4E2SA 2C0ZA 4CRQA 4DRRA 4BCUA 1BBT2 4QDQA 5BNNC 3GZUC 4OI4A 1ALYA 2ARBA 1OUSA 3LPGA 3J9SA 4LBQD 4PF1A 4QQ2A 1HRI1 3S7EA 1QXJA 3ZSJA 1TME1 4AEKA 5J37A 1QOTA 4OUMA 3S30A 1SQ4A 4JGYA 3OGSA 4BYYA 2E33A 2HWD3 3OBTA 1ND2B 2VECA 1ULGA 5K9YA 4AEDC 5A3PA 1J84A 4H2AA 2HBUA 3OBRA 4BU2A 5LW9A 3SEEA 5FLHA 1RC6A 2XJQA 3AP6A 2QFEA 1QGLA 4K8FA 1HXS3 2A7AA 4YZ2A 5FMOL 3JU9A 4KG8A 4W8JA 2XWBB 1F5JA 3J7HA 1SACA 3E6BA 3LPFA 5T5PA 3VD9A 1QIQA 4QPIA 1UO9A 1TQ5A 5F5QA 5KXCA 1LGCA 2P5BA 4XF9A 4AVSA 3UJOA 3UETA 4W50A 1ST8A 5FZKA 4LBOA 4DMIA 2O0OA 3PU3A 4FT8A 2FD8A 3ZYFA 1F8VA 2HWF2 5A33B 3URFA 1EP0A 3O7OA 4M0NA 4LPLA 1EV13 1FI2A 1SMVA 3BN6A 4IGQA 5BNOB 3M3IA 3BYWA 4Z92B 3NMBA 2VL4A 1W6PA 1C5HA 3POBA 2PAMA 3CEWA 4JGZC 5AVAA 3O0WA 3OGJA 2XBO2 5FZGA 4XE9A 1VBA2 4HOOA 1PO22 4HSJA 1AR82 2IWGB 4SBVA 1OF3A 3EMRA 4Y24A 5FYHA 4YGDA 2JWPA 2R071 2RMU1 3J26N 3MEPA 4L97A 5TSWA 3VBSC 4P9LA 2SLIA 4QPGB 1LOCA 1S0CA 1YEWA 2LM3A 1X9TA 2WLQA 4Q0VA 1FOD3 3K4DA 2QNKA 4NROA 4CP0A 1HRV2 1LHUA 1VBE3 3T1LA 1NZCA 2X09A 3M4FA 3KLSA 5FXVA 5JI9A 1VBB2 3WDWA 1R64A 3VZOA 1J3PA 3VV1A 3SKJE 1NE6A 4N90A 3Q9OA 1RUF1 4YSFA 4I30A 2I45A 2ZAHA 4Q4W1 1YQ6A 1D4M3 2WL1A 1ND2C 5A3TA 1ULPA 3FFQA 1VLNA 3LEKA 4P14A 1L7LA 5FP4A 4EJRA 3EYPA 2C4XA 3DF0A 1MEC1 4ASMB 1WMEA 3AYAA 1FNYA 2XJSA 1G9FA 1QH6A 1CAWB 1VP6A 3LOIA 3VBHA 2XGXA 1RUC3 5HI0A 2X5IA 3USUB 2XPJA 3HEIA 4FOVA 4UFHA 2GZWA 1WCKA 1V6OA 1W6OB 3N7MA 3A23A 4URTA 5IVCA 1AX1A 3NKTA 1US3A 4MGSA 4PDWA 4ATEA 4PIXA 3O1MA 5L36A 4CDWC 2RS33 4FCAA 1FPN1 1RUI1 3MLKA 4JKKA 4XQDA 3R0RA 4YZ1A 1L7RA 2RDQA 4PQ9A 4DQAA 5BNNA 1YJLA 3WR0A 1RB8G 1FNZA 3WUCA 1UY2A 4I0AA 4NRMA 2O14A 4BQWA 3AZXA 3F95A 2RS12 1UWWA 2FDIA 1HX6A 3GCXA 3WF2A 2FMDA 4FXGB 1AR93 1BEV3 4AEDA 1HQNA 1QQP2 2VXRA 4N9IA 2YHJA 4P00B 4Q4Y1 5I0UA 1F9KA 1CAUA 4CUGA 1OLMA 3M7AA 4BQ2A 1YNAA 4IQPA 3MIDA 1CJDA 2K46A 4M3CB 3HT1A 3I97A 1MS1A 3KV4A 4XFAA 4MHUA 2JICA 3SXWA 4BIFA 1JXNA 1GSLA 3WNPA 4S2FA 1SBFA 1OFSA 3FE5A 1NZIA 2QTWB 3TRSB 5LCWL 3E5UA 5DAWA 1W8WA 1JTZX 4GH4C 3V56A 3C7OA 1YHFA 3LA3A 2KA3A 5GLUA 1LHWA 4QPGC 3M8LA 4OHYA 1OURA 4WVVA 5C3PA 1JYVA 1S0GA 3KSCA 3DXTA 5DAQA 1HKDA 1ENSA 1HJFA 2B9VA 2D6NA 4H3WA 1R1ZA 5F6LB 5FZ0A 2VZSA 4NHKA 5KXEA 2BBAA 2HWE1 3NNLA 1SLIA 1A8MA 4KU7A 4E4DX 1QNWA 2JDAA 3ME2A 1AL23 2UWCA 1XOYA 3MYXA 4Q5OA 2RM21 3RJ2X 4CA9A 1VBC1 1W9FA 2Y34A 4FOYA 4OZXA 2DVFA 2K0GA 3LEIA 4OZOA 1RUJ2 4XDQA 4YYOA 4RHV1 1AYN2 1V00A 2W9XA 1H8TC 2ZGNA 4CCDA 2VGDA 1JZ8A 4K9SA 2HWB1 1I5PA 2OPWA 3GDBA 3RNSA 2ZBJA 4Z2AA 2EIDA 5IWFA 2IFWA 3I3DA 5LBBA 3VBSA 1T6GC 2C24A 4K3UA 4RD7A 1WW5A 4DPNA 1AR63 1I6XA 2ZKNA 4GB33 4BDVB 5F3IA 3DPRC 1CQ9A 4AQTA 5CBLA 3ACGA 5A3MA 3KB5A 3FFZA 5J7MA 4PLNA 3WV6A 4XXAA 3WZ1A 3ZKUA 3BALA 2W39A 1VBD3 4G4FA 2B4KA 4I01A 5CKNA 3U1XA 3OUHA 3WDUA 1KS4A 1SPPA 4R52A 5FZAA 3WSOA 3WX5A 1W0OA 1ND2A 2Y6HA 5HCBA 3B69A 2JDYA 3MIGA 4FPCA 3MIEA 5CKQA 4YVWB 4Y22B 5FPBA 3WDVA 3ZSMA 2RHPA 3I59B 4QXKA 4CUCA 1NLQA 4LHSA 1LOEA 3ZX7A 3BTXA 2LUWA 1KXGA 2HWC2 2PLV1 5JOWA 5JXHA 2QQNA 3THPA 1OC1A 1UZ0A 5K8SA 3J7LA 2VZQA 3ST7A 5LK7B 1EYBA 3DKWA 2D93A 1QJFA 1I1EA 3POYA 1AUYA 2R30A 2WIIB 3AP7A 4FQZA 2KR2A 2WC2A 1K5MC 4JAAA 1OSGA 4QKBA 2VOXA 1X82A 4GALA 3BOWA 3OYWA 3WNKA 3WQBA 1W6NA 4QWNA 3AZWA 4CCLA 1EUTA 4YARA 4QPYA 3C8XA 4IEPA 4P9XA 2PA7A 3AJYA 1DGRN 4E8CA 1C1LA 5F3CA 4CYDA 2C5DA 4FAHA 5A33A 4DXSA 4NO4A 1LOGA 2ZABA 5FZEA 2WNOA 5FP9A 5T5OA 3UKNA 1W2UA 4AVCA 1UU4A 2Z42A 1PMHX 4MX3A 4FOWA 4AI9A 3V0AB 3D6EA 1AYM2 5DG1A 5HPOA 2RR12 2WN2A 1QF3A 2WABA 4COVA 4XQ4A 5AC91 3J8F1 1KQRA 4IEZA 2ZGKA 2CYFA 2WJSA 5DN2A 1O4TA 2BNMA 2TNFA 1RVF2 3DXUA 4GH4A 3A4UA 5IK8A 2IVJA 1YFYA 4UF0B 4QPGA 3TAYA 1H6YA 3ZXJA 3IPVB 3O1VA 2AEZA 1DZQA 4YNIA 2VZRA 4JV4A 3ZXFA 4E8DA 3O1UA 2W08A 5JXJA 2D40A 2CL2A 3BOPA 4H14A 1UQXA 1YQ2A 1K45A 1HV0A 1XRUA 2YUEA 5LASA 2PN5A 3T1MA 2XDVA 1L3JA 3ALQA 4K7JA 4XCAA 3IDCB 1PMIA 5BV6A 3U0ZA 2MEV3 5JSRA 1NQDA 1SLLA 2EIBA 1C28A 4AR2A 4QMAA 2DUPA 2WKKA 4YVWC 1ZX5A 4XFIA 1GP5A 3W59A 1QJY1 4NIAA 1H8TA 1YQ8A 5F39A 1JZ5A 1HV1A 4NAMA 2OKXA 4XF4A 2D3PA 1TG7A 1H4HA 3RYPA 1CAWA 4FFHA 4DXTA 2YC0A 2WRAA 5ACA3 4CE8A 4OI0A 2FDFA 5FPVA 3KCCA 1H2LA 2VCCA 3WNLA 2DBIA 4Q27A 1W6OA 3FN9A 1ENRA 4CDXC 5FUPA 1EAH3 1XE7A 4CCKA 3DPRA 3JBG3 5GZDA 1Q8QA 5FKBA 5FMOS 1YLLA 3PUHA 4MXWB 4FTBA 2VOTA 1KFUL 5JCTA 1KJLA 4YGCA 2OA2A 1GZWB 4JTNA 2D3RA 2OUHA 3I2KA 3JZVA 1FOD2 2XJRA 4NUBA 4BLIA 4COWA 4CU9A 1HN0A 2ZGQA 3AL6A 4UYBA 1N1YA 2XKPA 1AR73 4U36A 4BQXA 3H8RA 3MPBA 4EWEA 1GOGA 5C3OA 4MGYE 2KD7A 1S0BA 1UY4A 3AC0A 3BPZA 3POFA 1ZA4A 2P3KA 4JZRA 4X8NA 5EP9A 4JDMA 2ZGOA 2NLRA 4FXKB 5JSOA 2G1MA 4M3CA 2NQYA 2VW2A 4IE0A 2GC3A 3FBYA 4AK3A 1CAVA 1UZVA 4UFJA 1GP6A 4CCCA 3ON7A 5CEHA 3TEZA 5DZFA 5IJRA 4QM9A 5GLWA 3VZKA 1ULCA 1XE8A 1BMV2 4OFGA 2JDNA 4IE7A 1JZ2A 3KF3A 5FY8A 2XHNA 2E7QA 2Q8EA 3O12A 1HQLA 3GNEA 4LOSA 3OJBA 5I91A 4BHPA 1XNBA 1ZA7A 2ZEWA 3T4HB 3KV6A 1BBT3 5I0RA 1RUNA 4AHXA 2NN8A 3I2DA 4B4PA 1IKPA 3AZVA 5C6CA 1LGBA 4TLFA 3TN93 2E9QA 3KS7A 4LJHA 3E6DA 5LWBA 3EXUA 2WUHA 2EICA 4Y26A 5JOZA 1XYPA 4P9YA 2QQOA 3N7JA 3OBAA 3LEMA 3AMQA 3OGRA 3AFKA 3I7DA 4MO3M 3OPTA 4AFDA 1CAXA 2R061 1W04A 1VJ2A 1UYYA 3POJA 1Z7S2 2JDUA 2VUAA 4AQ6A 1ZBE2 4EE2A 1D4VB 2J1RA 1RJ7A 4DO0A 1KDKA 2ENRA 3KV9A 4M00A 3QACA 3NAPB 4V2WA 3B00A 1LKNA 4N53B 2X05A 2QQKA 2P4EA 3HBKA 1QNYA 4LITA 4XJAA 1X8EA 5A70A 3DEMA 4HN0A 1VRBA 3IB3A 3MW4A 1V9U1 3R6SA 5FJKA 4KMQA 1W2AX 4QGMA 1VMFA 4RL7A 2VMCA 5LY2A 4BM8A 1HIXA 4XJUA 2FDGA 1HRI2 1YO8A 3ETPA 4RQPB 2VMFA 4LHKA 1V6JA 4NRPA 2WINB 2ZEXA 3WINE 3PJQA 4DIQA 4D6SA 2WFF2 1TNRA 1NCQB 5K0UB 3ZFGC 4B4QA 3P1IA 4ISQA 1OKQA 4YVWA 2WNVC 2ARXA 2A70A 2HH9A 2JDKA 2WO1A 1WMDA 2EXKA 3I59A 3I3BA 3N9LA 4Y22A 5E6HA 1IPJA 3ZYPA 3KZ4C 4AL9A 4CDWA 5E8AA 1AXKA 4WVZA 1NCRB 4LR4A 3UNPA 4QU1A 1CJPA 2BERA 2E31A 3IN9A 4EN9B 1CZSA 4CEWB 4OHXA 1LOAA 2ID4A 2XBO3 3E97A 5FZ4A 1VBA3 1PO23 2JKXA 5A3UA 4CDXA 4XOGA 4MGTA 3C7HA 3CZJA 2W1QA 2ZEZA 4EYUA 2PHFA 5JI7A 3IAPA 1C5IA 4AGRA 3NJVA 1JYNA 3NQHA 4HK9A 2F6BA 3SITA 4E4ZA 1URXA 2K9ZA 1RXGA 2JB8A 4NHXA 1HRV3 1DLCA 1V70A 4CUAA 3CNAA 4NMIA 4NHYA 1W6MB 2ZGUA 3UESA 2Z4FA 5D1IA 3Q8CA 4FP2A 5T5JA 2A6VA 1H2NA 1H1MA 5EZWA 1GNYA 3ZOIA 2OT7A 3T30A 3U37A 1IQDC 3ZYRA 2CDPA 2PHLA 3V0AA 1LR5A 3KD4A 4NWVA 5A3OA 5EJ3A 1RTVA 3HBZA 5FZ6A 2XVGA 2VCAA 3S7IA 1UZWA 4DOUA 4JRAA 1N3QA 5FYIA 3KGZA 1IG3A 4NVPA 5LA1A 1CIWA 3H50A 5LRSA 2VNRA 3LFMA 5CIRA 2XQXA 2I2SA 3CKHA 3FLPA 3NAPC 3HPNA 3T08A 5ABJB 5L9RA 4B1LA 4UF0A 4LUMA 3ECQA 4LHNA 1C4RA 1REDA 1SEFA 3IPVA 1LU2A 3LA2A 2YBKA 3ZPOA 4C0HA 2Y0OA 1W90A 4CPBD 5FR3A 3GZEA 2J1EA 1EUUA 5G05L 1PIV2 1E5HA 1RHI2 4LBQB 4A44A 1CGPA 1JMUB 1UPSA 2CGOA 2BUKA 5FCCA 2WAAA 3IKWA 3RMYA 3TNQA 3KMHA 1VMJA 2D5HA 2P3JA 1MZFA 2PMWB 3NW4A 5CFCC 5KBFA 1CWPA 1UY1A 1IHMA 5HV0A 3OF1A 4IEXA 2BW8A 2WNUC 4DY3A 5LB6A 3VDAA 1ZM1A 4OQ9A 4LBLA 4BB3A 4S2HA 5K0UC 2G9ZA 4QT6A 2VNVA 3OB8A 1NA1B 1QQP3 1HB2A 1T6BX 1RUH2 3VZMA 2EA7A 3ACFA 2ZX0A 2A6YA 2WQZC 2BV4A 3ACLA 1NCRC 3I2HA 2DYCA 2OXBA 3ZN6B 3E6CC 4CEWC 2QQUA 5EPAA 1JHNA 3JD71 4Y1VA 5E89A 1IS4A 3I2GA 5C4WB 1S4CA 1W8NA 2AENA 5FYUA 1HXS1 4TWTA 2ZGLA 3PURA 1S2KA 4FPEA 3FJSA 3C7EA 3WXPA 1FPN2 1OOPB 1OHFA 4MXWA 3HT2A 2D5FA 2E63A 4H55A 5IVEA 2NMNA 5T3NA 3AKSA 4XVHA 1GZWA 4YM2A 1G8WA 1RUE2 1S0JA 1US2A 2UY8A 5LBCA 2BGPA 4E27A 5IK5A 3BTZA 3BU0A 3LZZA 1UYZA 5DUVA 3DYPA 2QZ3A 1ZZCA 1VB2A 3B93A 3FZ3A 4ZS2A 1B09A 1QKQA 2WNVA 5LRRA 2XOMA 3MUY1 2JE8A 1AL0G 2B45X 3LCPA 2JDPA 1OPMA 3ORJA 5FXXA 1D0HA 4Y1XA 2O1QA 1EV11 4R9BA 4WM8B 3AMPA 3PVEA 4AWDA 2ZZQA 1COV2 4BISA 3WG1A 1BK1A 3O1TA 2BVVA 1RUJ3 4D3WA 1UMIA 1AYN3 3AKRA 4QXHA 2B8MA 2JD4A 2OS2A 2J7MA 4C1WA 3B9CA 4F83A 2WZ8A 5FZHA 2JECA 4AE2A 4LNVA 3VZJA 5C9AB 3Q8EA 4YW5A 1OI6A 1APNA 1WLTA 2R32A 2W1WA 3CJXA 2D6LX 5T5LA 1J1TA 2WWJA 2BOIA 1RMU1 4IEVA 2GNMA 4PLMA 3AXEA 5CADA 3WF3A 3KV5A 1XXNA 4KL1A 3ZXGA 4TN7A 1FATA 1OF4A 2W1SA 4A42A 1UU5A 1KS5A 5FRAA 3KF5A 3NVCA 4I02A 3ZM8A 3WW3A 3NNJA 2QKDA 5IAXA 1VBC2 3JB4C 2VW1A 3KQRA 3R4UA 1XE0A 3I3QA 1D4M1 1W8TA 2Z79A 4BQ4A 4CU6A 1ND3B 2R49A 4OCTA 3EO6A 3LSEA 4GAZA 4RHV2 2JDHA 5FYMA 1V6KA 5KWRA 2ZAAA 3GYDA 4K21A 2ARAA 1KRIA 4XUOA 2NYYA 5JDBA 2AGSA 2HWB2 2HWC3 2LALA 4G3YC 5F1RA 3MHZA 3NAPA 1OH4A 3S0MA 4FPJA 4XPVA 1W28A 4X6QB 5I8TA 2J1VA 4KGGA 1RITA 4Q26A 5A7SA 4O9EA 2W52A 2NM1A 3NV4A 4X8PA 4CEYB 2NZ9A 4PBPA 4MGKE 2Q4SA 4MGZE 4CU7A 2DBNA 3KQ4B 4Y5TA 3ZFEB 2FCVA 2LRPA 5C3SA 1GMMA 1LEMA 4ZS3A 5CFCA 2GALA 1UU6A 4RQPA 2Y8KA 5FZ8A 2VBBA 2WNUA 1DZRA 4WVWA 5K0UA 2CGPA 3GHNA 1R082 1Y9GA 3J4UH 5C8CB 2VMGA 1P8JA 3MLJA 2CAVA 1AR91 3GJAA 3SC7X 3TN92 5FYBA 4EQVA 4QU2A 1RJ8A 2J22A 2X10A 4LBMA 3WNNA 5IK4A 4M3CF 1AYM3 3W21A 3BIEA 2RR13 1LEDA 1XNTA 1NCRA 2WFPA 4MADA 2ZX2A 2ZHMA 4TSVA 3WLUA 5CFDC 4CEWA 4ATFA 2PLV2 5T55A 1QXRA 1BZWA 1H6XA 1MS9A 1PHMA 3BI3A 3ZSEA 3H1WA 1LAJA 1IS3A 3SLIA 1UD1A 1MS8A 4GXLA 5KXDA 1RVF3 3M3EA 1LNSA 4IGOA 4R9CA 3VBFB 4AFBA 3MIFA 3AP5A 4IV1C 4XHBA 4K40A 4OHWA 1HB3A 1MQTB 1WW6A 4DEQA 1AVBA 2C9KA 2GSYA 3ZDVA 2RDRA 3BIWE 1H30A 2JE7A 3SH3A 4GZ9A 2ZMKA 4P9WA 1NY71 1W6MA 1DQ1A 3OD0A 4QHOA 3WDXA 3WF0A 4BQ5A 5FY9A 3GHMA 2ADDA 3MPPG 1QJU1 2WS91 4LORA 2JG8B 3V64A 1IPSA 4KBZA 3K2OA 4AXOA 1UZZA 1AL21 1VAKA 4HSLA 1LTEA 1X7NA 5GKAC 4YFZA 1XYNA 1NLRA 3WOGA 5F2SA 4A45A 1ND3C 1NKGA 3Q8AA 2IXCA 2W2IA 3HWJA 2VBDA 3RZMA 1A3KA 5IVVA 1SLAA 2WZR1 3AL5A 4J6GA 4Y20A 1YI9A 4IEQA 3NNMA 3FC0A 5ABJA 2N7GA 3MIBA 3T09A 3RZHA 4C0BA 4ISRA 2G9FA 3RYRA 4DZGA 3FLTA 1PZ8A 3FUQA 5C3QA 1VRH2 1W2NA 2UURA 2EAAA 1OMIA 4GB31 1K5JA 3AK0A 3BODA 1KGYA 4CEYC 2QQLA 2XLAA 2CWSA 3B3QE 4LBQA 3DKQA 3X29B 4P9JA 2F4PA 3ITQA 4KGQA 3K46A 4RR3C 5FYSA 5I93A 4L92A 2YY1A 2BFUS 5FY1A 1Y3TA 1CZVA 1QOSA 3D82A 2RG4A 4CCJA 1U0AA 1NLSA 2G19A 2VY0A 3A22A 3PMSA 2ES3A 5FYYA 4A3XA 3MO4A 4KWKA 1NA1A 3SHRA 1DCSA 2E53A 2JENA 1SZBA 2UU8A 3UKVA 4BPZA 2DTYA 1HB1A 4O61A 3A7QA 3ROUA 2OIIA 4C91A 3D3AA 4YG6A 1O8PA 4WBBA 4BQ3A 4CXXA 2V09A 5BUVA 5FY7A 4EZ4A 1WCUA 3CJIB 3POIA 2ERFA 1G9BA 3ZYIB 4FTEA 2BZDA 1PX4A 2DFBA 3H3ZA 3ZO0B 1XU2A 3WF1A 1LECA 4OUSA 3MZHA 4Q4V1 1YFXA 2C26A 1W3VA 4XF3A 4NOTA 4YZ4A 4Z07A 2FCUA 5FZLA 4G9SB 2PAKA 2WAOA 5A7PA 4BA6A 1UY0A 3HD8B 4RS5B 1CVNA 1MQTC 2VNGA 5DPNA 5I0TA 1RINA 2PHUA 1X33A 3CF6E 4FQ4A 3MICA 4A4AA 4JDOA 3ZYBA 4EN0A 1QHDA 3M3CA 3PL0A 1PMJX 4QX0A 4LE3A 4E9KA 1UNBA 2PHWA 3NV3A 4HZFA 5ANNA 1YXWA 1JZ4A 2JIGA 3VDBA 5CYYA 1WKYA 4LBJA 2GC2A 1RUD1 4OHVA 4DXRA 4QKNA 2IZWA 2A3WA 5SV5A 1QJX2 2V5YA 3N4MA 1OQEA 5DUUA 1WLDA 2VOWA 5GLZA 5CFDA 2A71A 3ATGA 1HQWA 3HIFA 3OPZA 4R8HA 4XIKA 4AGVA 3U4XA 1GQHA 3DUIA 1O6UA 4PIYA 1N3OA 2QVSB 4UFKA 1Z7S3 1S55A 2YV8A 3PDQA 1ZBE3 3ELNA 3N7LA 4GMP1 5FZOB 5BNOC 2J1TA 1GNHA 1GR3A 4N7IA 4XW3A 4XBQA 5T50A 5L7OB 1RUG1 1O3QA 3RZJA 1U5YA 3RJRA 3IIAA 2PHXA 5D8AB 4IV1A 3WDYA 4XBLA 3ZR6A 5A6ZA 5H9RA 5FP3A 4P02B 3OCPA 5GALA 4BK5A 2I74A 2PQSA 4M01A 2VQAA 2LTNA 1ONAA 3AXDA 3W5NA 3PVNA 3VBUB 3WW2A 3WY6A 4DFSA 5FY4A 4A3ZA 4BZ4A 5HCFA 1ZZBA 3WUDA 4D7TA 3NRUA 3RI9A 4HVOA 2CSGA 1LCLA 3QOPA 4JHZA 3UV9A 2P6HA 1HRI3 3GM8A 5A3WA 3VUOA 1O4ZA 2YFZA 4GULA 4L8QA 1JYIA 1DF0A 1GV9A 1OT5A 1PK6B 1W39A 2WFF3 2WO2A 3OEAA 4RSUA 1HLCA 2FZ2A 2ET7A 4AYUA 2MEV1 3B7MA 1KDMA 1ND3A 2GC0A 5L19A 3TWIA 4D94A 3D5OA 5H9PA 2R0FA 4QXCA 4A7ZA 1FX5A 1J3RA 2QDNA 4UW6A 1ULOA 1K42A 3THTA 2P3YA 1W9YA 5JAXA 2D97A 5DUXA 1E57A 3RQ0A 5FK7A 4LBNA 4IGPA 3H0OA 4QQHA 5J1XA 1EAH1 2C1FA 2E7TA 2OW4A 2Q30A 5KC6A 3JBG1 4CEYA 4LO5B 2Q5TA 4Q0QA 1MZ5A 2JKBA 1GWMA 4QGNA 3J7NA 4RR3A 3RS6A 3U14A 1DHKB 3NSTA 4CDUB 2OQ7A 2OQ6A 3HVDA 4J1WA 2HYKA 4XACA 2W47A 4HANA 4XILA 2KM2A 1SDDB 1FMD1 4QX5A 1DQ5A 1WCQA 4AZZA 1U12A 4LULA 2DU1A 1HN1A 3WNMA 1OKOA 2R042 2W87A 1C57A 4W6XA 5FOBB 1ZNPA 2QQPA 1ASJ1 3LE0A 2FCTA 2V4VA 1NQJA 4IEUA 4YM0A 3ZLIA 3ZSLA 2XL9A 5JMCA 3C3VA 4IXLA 2A75A 5BNPB 2VG9A 3LKJA 1DYOA 1WMXA 2D6PA 3HQUA 2YFUA 4W6YA 4ARXA 2VQUA 5FZMA 1EPWA 4YGEA 4XIOA 5A32B 3SEPA 4CP9B 5L7OC 1PO11 3I8TA 4UBGA 2RMU3 2AACA 5J09A 4MLOA 5D8AC 1EPZA 2BNOA 1NT0A 3LA7A 5EXOA 5B4NA 5BPXA 1MQTA 3RWNA 1DQ2A 3WW1A 4ZKTB 1C8M1 3ZMNA 4LKEA 1WZXA 3VBUC 1PIV3 2GNTA 3MW2A 1RHI3 4FAGA 1BBT1 3N9PA 4UBHA 4DINB 4BXSV 5A1FA 5CG8A 4LO4B 1DYPA 1OVPA 2RS51 3LEGA 5F32A 1MZ6A 2R7EB 3KT4A 2BBVA 1RUH3 5K4LA 1POQA 3O1PA 4META 1BK0A 1SG3A 2E26A 1F31A 2Q1FA 2GU9A 1OH3A 3DL3A 3MF9A 5BNOA 4LEJA 4PCRA 2VMEA 4QB6A 3T4VA 1JOBA 4Y5SA 1UPIA 3U11A 2EIEA 4LK7A 3WT3A 1PGW1 2VZ3A 3D8CA 4COYA 3WG2A 3OSDA 2J1SA 2VZPA 3H3UA 1FPN3 1QWRA 1D0GA 3P5BA 1SCSA 5JIAA 4BQ1A 4XHXA 3ILFA 5KHKA 2ZEYA 5G04L 1QDCA 1PGL2 2X8KA 3H1MA 5EFUA 2D6OX 4CDQB 1RUE3 2PXJA 3ZFFB 3T0DA 2E51A 2ZCWA 3D0SA 3OEBA 1UYXA 5JWPA 4JRLA 4QKFA 2HWF1 5FPLA 4QX2A 1FXZA 3ILRA 5IHRA 1U5XA 3HR9A 4Y4YA 2BQPA 3HNMA 5FP8A 1ZVFA 3DYMA 1COV3 2ZGMA 1JZ7A 3UYJA 2VE1A 1UW8A 5L9BA 3D4KA 2WQ4A 4V2VA 3LIHA 3CJIA 1H9PA 4TXWA 1YIFA 2VVDA 3JD72 2X53S 4QAWA 1C1FA 1VBA1 1PO21 3SQOA 1AR81 3QH6A 3GCWA 4FP3A 4OUEA 4WV8A 4ES8A 5FY0A 1ZBA2 1CPMA 3IAQA 1ENXA 3USUA 1TMF2 2ZXQA 5FZBA 5A1LA 1F2NA 3VKFC 3H8OA 5AVPA 2Z69A 3W20A 2QE3A 4HBNA 5JSPA 1SHWB 2EALA 4NHLA 1UKRA 2W92A 1RXFA 1HRV1 5FY5A 4XMIA 4ASKA 3RVHA 3AMHA 2HWE3 1CX1A 1S0IA 3ACHA 1WA4A 1VBB1 2QQWA 4HKLA 4K1YA 2H0BA 4XFBA 4XZUG 4PT6A 1UMHA 3GF6A 4HLTA 2R1DA 3H3LA 1R092 2RM23 4FPYA 1VBC3 1WCSA 3K4AA 4CP2A 3I49A 4CP1A 3A0KA 2FMYA 4IE4A 4RHV3 1PM4A 4YRDA 4IE5A 1W9SA 4Q1PA 1RGSA 4NE9A 2VTFA 1OQ1A 1OVSA 4D69A 3KCYA 4XFGA 5FZOA 3PIJA 1W2OA 2HWB3 2RJKA 5JOXA 5L7OA 1N1VA 5D8AA 5LEJA 2O8QA 3GBFA 5EJZB 3N35A 1AF9A 5EHDA 1QJZA 1N1TA 3CMGA 2AZ5A 3O1OA 2VH9A 2VW0A 4FPLA 3O5SA 4PHZA 1OXCA 3H9AA 3VBUA 5KHIA 1BCXA 1B35B 3PUSA 5FZIA 2GNBA 3V0BB 4QQOA 1GUIA 1DDLA 3KVBA 3OBZA 4CXWA 1L7QA 4LO8A 3MI8A 3ZFFC 4CZSA 2RS11 1DLLA 1MACA 1PK6A 2Q8OA 4UFLA 3KT7A 4XTPA 2JX9A 5FFOC 1R083 4K8RB 3RPQA 4LMFA 3U10A 1Z0HA 1PVC2 4KWLA 2VM9A 4AEJA 1QQP1 5FWJA 3HNYM 5J98B 1ZZ8A 2FBEA 4LKSA 2OZJA 5FMDA 1A78A 3ZXDA 3BTYA 4MV2A 2PLV3 4ET7A 1XNKA 3I2IA 3RZGA 2DCTA 4AHWA 5A7WB 1VPHA 5FZDA 4ZU7A 1OLME 4Y5Z0 2IXKA 4YW1A 5KHGA 2VQTA 2A5ZA 2YC4A 2XL7A 2XONA 3WVJA 3PVBB 4FFFA 4R9AA 2DVAA 5E88A 4MZUA 1TE1B 3KHBA 2UY9A 4Q4X1 1DGWA 2NPIA 5FLIA 1AXZA 4V1PA 5CG9A 2FDKA 4I2OA 2VBPA 4YM3A 2VO5A 1IG0A 5GZEA 2VU9A 3C7FA 3V65A 5LA0A 4NPRA 4B4RA 4FTSA 2HEVF 5DDJ1 5FP7A 2G9GA 2VVFA 2W0XA 3WDTA 2W91A 4Y1UA 1TME2 1OLQA 4HN1A 2ZOEB 3ZR5A 5IT6A 3HN1A 1FV3A 1JOJA 5ISLA 5GZCA 3AFGA 3VB9A 5BNPA 2WLPA 1RUJ1 2BNNA 3Q8FA 4XJWA 4J25A 4BMEA 4DUWA 1AYN1 3CHXA 2AH2A 1Q43A 1Y9QA 5CA6A 1H4GA 1O91A 2VVEA 5KXBA 5A32A 1JYXA 2VZTA 4I3PA 4P9IA 5FQ0B 5A80A 5H9SA 2DF7A 2MHFA 3EJKA 1UOFA 4JTOA 3GZAA 3AP9A 4B7KA 3VKOA 1XSQA 1JZ3A 3P6BA 1VRH3 2AC1A 1V6IA 2YMZA 3VHOA 4QQPA 4N43B 3K77A 3MDPA 5DAXA 5B4XA 5F37A 4QB2A 1IZ3A 4YWAA 4GWMA 4FFGA 1YFUA 2PHRA 4K20A 5BXXA 2VMIA 1NG0A 4COUA 2P6CA 1SLBA 4NRQA 2EXIA 1JZ6A 1PVXA 3OOXA 2ZX3A 2WS92 4QPWA 3L9JT 1OFNA 4ZHNA 1S2BA 4RGKA 3ZN4A 2FDJA 4P5HA 5GM0A 1QDOA 3N9NA 2VUJA 1WLCA 1G7YA 3NNFA 1Q8PA 4LLOA 3DV8A 4YW3A 4XF1A 2R6QA 2YGMA 1R1A1 5DAVA 4KWJA 2HEWF 4I0BA 2GMEA 2XXZA 4OI1A 1BKZA 2WZR2 1W06A 3AMNA 2DWRA 2CGNA 2OX0A 3LQCA 4XETA 4XZPA 1W99A 5FZ9A 3UGGA 1A8DA 1IOAA 2PELA 2XB6C 2D6MA 2EXJA 1S0FA 5JIUA 2I07B 1POV0 2JDZA 4B7EA 4FSJA 1HB4A 5FPUA 2CV6A 1GZTA 1ODMA 2R072 4F3JA 3POEA 3ZYHA 2RVAA 2RMU2 1O59A 4BLJA 4F8AA 3JQWA 1POV3 1DIWA 4N53C 5FO8B 1LODA 2HJIA 4AEMA 1REFA 2GP3A 3MGUA 1WMFA 3ZFFA 5HBAA 4KU8A 4TYSA 4XDOA 1D2QA 1UAIA 5FXZA 2HKXA 5CAZA 1SDWA 4Y1YA 1W3XA 1RYYA 3OD4A 4A6OA 5A6YA 3GJBA 1JS9A 1QJX3 4AFMA 1IKQA 3FHQA 4HXCA 3ZIWA 4RQPC 1KITA 3ACIA 3OUJA 1RUF2 1AYM1 4HFSA 1DYKA 2RR11 4Q4W2 1NCQC 3QBQA 4UI9L 5EQUA 1GOHA 4EZHA 2HWD1 4ZU5A 4AQSA 1ZZ9A 3AM2A 4S2GA 3MF6A 4HVRA 3C2UA 2P34A 2Q1MA 3VGIA 2YGLA 1MEC2 2RV9A 2TEPA 2GN3A 1H8VA 4UT5A 2AREA 4XUQA 1RVF1 2BWCA 4DRVA 4DEVA 5JR7B 1CD3G 2BPA2 1W9WA 2ET1A 2HYXA 2LROA 2R1BA 3OPWA 4CSWA 4N43C 5L73A 1GQPA 4IEYA 4XBNA 2Y6LA 2CAUA 3N9QA 5FJHA 4UW3A 2WN3A 4QX8A 5M0TA 1RUI2 1JN2P 4MSVA 2A73B 2PHDA 3BVCA 3W58A 3LDKA 4MXVA 2PYTA 3SH4A 4FOQA 1RUD2 3FL7A 4QD2A 5BYNA 3VZNA 3E5QA 1ZZ6A 2VXJA 2ZMLA 2JIJA 1OA2A 4IESA 5F5IA 3NJZA 3CO2A 4D6QA 4IV3B 3VBRB 2ILMA 1LOFC 2FZ1A 3PTRB 3TNPB 4Q4Y2 3S57A 2ZHNA 3POWA 1MS3A 2F17A 1BLZA 1O7FA 3JB8A 5IFPA 1RUG2 1W8HA 3VBHB 2Z2SB 1D2SA 3M3OA 4XCBA 3T0BA 4CPBA 4YG3A 4FVVA 1A6CA 4B3NA 3I54A 4PDWB 4CCOA 4XJ9A 4AI1A 4YZ5A 1E5SA 4QDRA 4XTMA 4D7SA 3V0BA 1MVQA 5E16A 2A3YA 5ABJC 1NXD1 1YUDA 2VZUA 4NIGA 3VD4A 2WA3A 1YIPA 2XVKA 1X8MA 1YCIA 2NMOA 3OGGA 3PNAA 1STMA 3L2HA 3VDDB 1OA4A 1LGNA 1JYWA 1FOD1 2YZ4A 1G9CA 1BQPA 1VBE1 3ZSKA 2A6XA 2UYBA 2ARCA 2HWE2 2R043 2VC9A 5IVFA 5F5CA 4ITCA 5CZKA 1Z78A 1DP0A 4DUXA 4XABA 1CAUB 5GZFA 1DGRA 2RM22 3QCWA 3LWCA 2J1AA 5JVVA 1X50A 2PAEA 5FIXA 1NA1C 1V6LA 2Y33A 4ORFA 2WT2A 1U5ZA 5A7WA 4YPJA 3UL2A 2P1BA 5JPMB 4L11A 3RWKX 3W5MA 2W1UA 2V5DA 1SFPA 1GZCA 3PUIA 1BMV1 2DURA 1JOPA 1RUC1 4PBOA 3WD5A 1WW7A 4Q8KA 2BRTA 4N53A 1MZEA 2VTXA 1TVGA 5C4WC 2QQMA 5FMCA 4AGGA 3ZYJB 3OY8B 1OOPC 1WCDJ 1GANA 2CU5A 2RS31 2OVUA 4PI0A 1LOBA 1FMD2 1C8NA 4MHRA 1Y9MA 2CHHA 5IFTA 1RUOA 1PZ7A 5C7GA 4H7MA 4L99A 1U5IA 1UKGA 3S5QA 4XJZA 1JW6A 4URAA 1UX7A 5FV3A 1XC6A 5C70A 4KG0A 2JDMA 3ZN5A 4FI9A 1NCQA 1FV2A 4AOCA 1H1IA 4IV3C 1W6QB 3VBRC 4JGZB 2MPFA 3T3YA 4DUVA 1BEV1 1DGLA 1Z7S1 2Y6JA 2RDSA 4WM8C 3K4ZA 4YG0A 3T2TA 3RG0A 4HL0A 1PO12 1SFNA 4JDNA 2YYOA 3VBSB 4XDPA 3I3MA 2XJPA 3LF7A 4FPGA 4Z2WA 5D2AA 1I5ZA 1GYKA 3GZTB 5EV7A 5BNQA 1DG6A 1HJGA 4N43A 1W8OA 1UMZA 5CISA 1MPXA 1XNAA 5DMYA 3B02A 3K48A 2F4LA 5FYTA 3ZDSA 1LESA 2UWAA 3H7JA 5C9AC 5JMOA 4X6RB 3FUOA 4QQLA 3MLLA 2QJVA 2RS52 3PLQA 5FPZA 1OLRA 3CDZB 3VDDC 1DGWX 1SPPB 1DQ6A 2JJ6A 2WFF1 1H2MA 4Y4RA 4IDZA 4NIIA 3TEXA 3CIHA 1AX2A 5IVJA 1SFYA 5LEKA 4AQ2A 3AB0A 1LOFA 4E2QA 1GBGA 3ETQA 3WEZA 3BU7A 3KM5A 3A21A 3BPSA 3O1RA 4UXAA 2MNGA 1NXMA 1PGSA 3VD3A 4XXPA 5KR7A 3JD73 3HQXA 2UYAA 4GWNA 3SCHA 3AZZA 1CPNA 2XLGA 1QXPA 5AC92 3J8F2 1PGW2 4HK8A 2WDBA 5SV8A 3KGLA 3RGBA 4A2UA 1ZBA3 4NIDA 4CDWB 3LFIA 2ZS6B 1H2KA 1TMF3 2P37A 5A7OA 3WF4A 4O7XA 2WYSA 1NYWA 4MYEA 4OHZA 3LSDA 4PI2A 1J3QA 1PX3A 5DZGA 1BJQA 1LJ7A 2ZHKA 2ZACA 3HOBA 1PM7A 1JBCA 3IDBB 3OYWB 3TEYA 1W6NB 1AR61 4FPKA 4WM7B 5J3UA 4NIHA 1DFQA 1KFXL 3NWKA 1Q8VA 3ABZA 4IW3A 2PHTA 3ZFEC 1R093 3E5XA 2YB7A 4C1XA 5F5AA 3H42B 2D6KA 1VBD1 2WBKA 4HG6B 5F6KA 4TZDA 3VZLA 2DVBA 4JVAA 3K51A 1NAEA 3IDEA 2RJLA 3JCIA 3NV1A 5C8CC 2VR4A 2BP6A 3AMMA 4N8MA 2GN7A 4Y1ZA 1A34A 2W46A 4OQ8A 1LHOA 5LBFA 4ES9A 3HJRA 3O0VA 1CESA 4XAAA 1QJY2 5EYXA 2VCMA 4W6WA 4XC9A 3WNOA 4LBKA 3BKZA 4XEZA 1FT9A 4GH4B 4ZPIA 3QH7A 3ZN6A 4AW7A 1UN1A 2VPVA 5FZ7A 1YYNA 3U78A 2BVBA 3POSA 4ZU4A 5DUWA 5FYCA 4AI3A 1HW5A 3B94A 4L9BA 1W9TA 2Y6FA 4OMCA 5C4WA 4LIUA 5C5TA 2IVIB 2QCSB 3WP4A 1RMU3 4LOTA 3NL1A 3ZXLA 5F3EA 3H8XA 4PF5A 1MVEA 3GXUA 3BUCA 4AI2A 3VBFC 4BWOA 3FHAA 1OOPA 1PIV1 2HLEA 1Q5OA 1RHI1 3HNBM 2DCYA 3U4SA 2NP0A 4Z8BA 4BK4A 3APBA 4RGAA 4OMDA 1LHNA 1DBNA 2DVGA 4TTGA 3F2ZA 4QB1A 3SCGA 1MS4A 3UKTA 2GP5A 1GICA 4Q2FA 3SH5A 4JKLA 1HDKA 3AZYA 4C8DA 1PVC3 3ASIA 1Q3EA 1XSRA 4HKWA 2XUMA 4XMAA 5FUNA 2VUDA 5FZCA 3GALA 4IV3A 3VBRA 1RUH1 4HETA 5FO9B 1NUKA 2JG8C 2XJUA 1H8TB 4RFRB 1G9DA 4WM8A 1VE0A 4BJ0A 2C9AA 4K6BA 3MV01 5FLJA 1ENQA 3UT0A 3VHRA 3ZXKA 5A6QA 1JH5A 4GA9A 2FQPA 2W95A 1BVVA 4QHZA 1YQCA 4CCNA 1YC61 3MBWA 1BXHA 4LA3A 4CU8A 1H1AA 3DPRB 1QOOA 2BWAA 2JG9B 4IEWA 2VOKA 1LULA 4J1XA 2BTVC 4FFIA 2Q8DA 3EQEA 5C9AA 2QUOA 2GH2A 3ZVXA 2A3XA 4PJYA 1WGPA 2H0VA 2YC2A 3N3HA 4Q8LA 4A41A 4BH9A 4Q29A 3FMGA 4FPFA 5LBEA 3ES4A 4WM7C 1RUE1 3KCXA 3VDDA 5A6XA 3M2MA 2Y26A 1UL9A 4DXZA 1LENA 3CZUA 3P3NA 3HN3A 5FK8A 1BYHA 5T52A 2EIGA 1GQGA 1TME3 2HEYF 2IC1A 4FBFA 4PIZA 2CY6A 5JXIA 2B7YA 2CWMA 1QEXA 3RSJA 5LK5A 1COV1 1UYPA 3KHCA 5JXGA 1X9PA 5HCAA 2Y64A 1W2TA 2R062 4HONA 4NWWA 1CAVB 1O4YA 4I3GA 1N47A 3SNMA 4AG4A 1WBFA 1W8UA 5FO7B 3H7YA 2YDEA 3WW4A 1VAMA 3PIGA 2FDHA 1K5MB 1S2EA 2KXLA 2HBTA 3VD7A 3CJIC 5JPNB 5ACA1 5FDBA 1XQNA 5EWSA 1JUHA 4FPHA 2R16A 3THDA 3IDAA 5EIYB 4TLGA 1IQAA 4Q4X2 3VBOB 2ADEA 2AR6A 2YPDA 3OY8A 2RJ2A 2DTWA 2ZHLA 1ZREA 1UXZA 1KEXA 4L2NA 1V9U2 4MOAA 1X36A 2CDOA 3WNXA 1QJU3 4RS5C 2WS93 4AVVA 3K3NA 3ZFEA 1YRZA 3OGVA 4DY5A 5DDJ2 5GLVA 5FTTC 4DB5A 3AKPA 4FPOB 1MR5A 2XQRA 4S2DA 2LW8A 5DG2A 4LA2A 1JI6A 1ZRDA 2BU9A 2E7AA 1CIYA 1TEIA 3LDRA 1TZOA 2GMMA 1W6QA 4JGZA 5C8CA 1LB2A 3BGAA 1CAXB 2WO3A 3WP5A 1AR71 1F35A 2WZR3 2WSVA 2V73A 3P3PA 3C7GA 5ERLA 2OUJA 4AAPA 1F4HA 4N7UA 1FAYA 1XBFA 5JLVA 1ZRFA 2L9LA 4E2GA 4IETA 2TUNA 4NPMA 5A3NA 3KT1A 1IPKA 1F5FA 1QJEA 4IUGA 1LU1A 4Q0UA 1VALA 2BJSA 2R073 4LK6A 3VBFA 2JG9C 5F2WA 2Y38A 3AP4A 2QBXA 4CCMA 2WZEA 4GWIA 3UGHA 5IUQA 4KI5M 4EWAA 1Q56A 4LKDA 1GLHA 4YW7A 3THCA 1GFF2 3N36A 1H0BA 1PNGA 5FBZA 3VDCA 1Y43B 2VOVA 3U07A 3NV2A 2P2KA 3DCQA 2DCJA 1O5LA 4W4ZA 4BOWA 1O3RA 1R081 2H6BA 4JC1A 5J48A 5EJ1B 1UXXX 1V0AA 1AXYA 2Y60A 3TN91 1R1A2 2JG8A 4WZCA 4YLZA 2GDFA 3JQXA 1RUF3 1PK6C 2VMDA 2WO7A 1ZZ7A 3NO8A 4MUVA 1JHJA 3H8UA 4Q4W3 2YBPA 4RN5A 2BOJA 5C5UA 3SKVA 1YWKA 3HQRA 4OVEA 4MGIE 3O0XA 4Y3OA 5DXDA 5FOJB 4HVQA 3CU7A 1M06G 3O1SA 5C3RA 3OG2A 3VKLA 3LD8A 1MEC3 2D3SA 2ZPXA 2W3JA 2WQ8A 4Y33A 4CCEA 3LGRA 3PMEA 3OUIA 4CDXB 4Q4V3 1OD5A 5I0DA 4UWDA 3EBRA 4QGLA 4XUNA 3RDIA 1VB4A 4MVTA 1W03A 3FLRA 1E5IA 2Q1ZB 1REEA 4GIQA 3VN4A 2IFRA 2IXHA 2B46X 5I0SA 2ZGRA 3H1YA 4SLIA 3PTYA 1F4AA 3AYDA 5GZGA 1JYCA 4O9GA 4E4SA 4GKYA 4WM7A 3VBOC 5KC5A 1RUI3 3AVRA 3RRDA 4JHTA 1K12A 2GC1A 3AKTA 3BCWA 4QM8A 4E4HA 3B9IA 3VHNA 2PQQA 1RUD3 2W5FA 3HMYA 3NNGA 1SLTA 1WBLA 5CNAA 5DQ0A 5A7QA 1W05A 4CDUC 2DCZA 3R4SA 4GJYA 2XR4A 4JQRA 1AJKA 4GMP0 1OA3A 1QU0A 5AFEA 5DAPA 3M3QA 2YU1A 5GJ6A 1UF2C 2YU2A 2GAUA 2XWJB 4F7ZA 2ZX1A 1GP4A 2XJVA 3AX4A 2HWD2 2Y6KA 4NR1A 4AFCA 4Q4Y3 3PJYA 4CUBA 1J58A 1W8ZA 1XB9A 4GMP3 4BE3A 3B01A 1OBNA 4LE4A 3WCSA 4EWDA 1N1SA 1RUG3 4H7LA 1RL3A 5E1RA 1D7PM 4JKMA 3K75B 4Q0SA 5F7UA 4XURA 2XKOA 3VKMA 3M1HA 5BNPC 2OPKA 2K2SA 1WD3A 2XBO1 5LATA 5KHJA 4JX0A 3MFCA 2PTMA 1VRH1 3EB7A 4LKFA 4MGQA 1HXS2 1DU3D 4YVSB 5C71A 3SISA 4R4XA 3I2OA 2DV9A 3PU8A 3U75A 4RS5A 4C90A 5CVRA 2QZ2A 1WW4A 2XMLA 3FX3A 1J83A 1GKBA 2FHRA 4ZY9A 5B2GB 1O8SA 3DECA 3TYJA 3KVAA 4QX7A 3FWEA 1UOJA 1LRHA 1YI7A 4ASLA 4MG2A 3IMMA 1IGOA 3K3OA 4KH9A 4O65A 2GH8A 5FPAA 5JZGB 3EHKA 2DDUA 2IXIA 1I9RA 1O3SA 4UW5A 1AJOA 3BB6A 4Q1RA 1UCXA 2IXJA 3LB9A 2Q0AA 2A6ZA 2B39A 1EV12 2VZ1A 1E5RA 1QMJA 1YFWA 4ZONA 2WNEA 1SBEA 4I0WB 4OULA 1CZTA 4P08A 2WWSA 3MW3A 2C6SA 2VZOA 2XJTA 4UOJA 3WG4A 1KJRA 1ULDA 1NE4A 1VAVA 3CLPA 5LY1A 2JG9A 1AX0A 1EY2A 2ZMNA 2JE9A 4UW4A 4GJZA 4WVMB 3TOJA 5FKCA 3INAA 1POV1 2IUWA 4LHLA 4XFFA 3RZZA 3ZXAC 3AYCA 2DU0A 3Q8BA 1CR7A 3DGTA 1RMU2 2A1XA 3JUUA 4KNCA 4B29A 2J42A 1NOVA 2P3IA 3AJZA 1FMD3 1JU4A 1VBE2 2W94A 3IT8A 2CNAA 3MFAA 1Y4WA 3QD6A 5LA2A 3ZFGB 2H6CA 5HV4A 2B42B 2WNVB 2QDRA 1XNCA 2XHKA 5GLTA 4CDQC 4EV0A 4LT5A 1ASJ3 1QJX1 2JXAA 2GNDA 2VAUA 4Z82A 3R4DB 1Y7BA 4QKDA 2RDNA 2VULA 1ZRRA 4NN0A 1D4M2 3MUZ1 2E6VA 3GBGA 1DQ4A 2UWBA 3IBMA 3DYOA 1OD3A 1UOBA 1G6NA 1K3IA 1WA6X 2O8OA 3KWVA 2WT1A 5LA9A 4BMBA 5JUVA 3AYEA 1PO13 2XUEA 3JXSA 5IW0A 1MS5A 1VR3A 1K5MA 3W9AA 3FHIB 1S1AA 3ILNA 1ZRIA 1RUC2 2JB4A 2ZX4A 3QLQA 4QXBA 1C8M3 4CVUA 3ZKYA 1NX9A 2ATFA 1AZDA 5FREA 1GWKA 4IL7A 3O14A 4YVSC 3VBOA 1UIKA 4JQTA 1IS6A 3A0NA 2RS32 5F8PA 2A6WA 5F3GA 3WQ1A 1ULFA 2RS53 2VD7A 4CDUA 3S5AA 2XH6A 4HPKB 1UY3A 4U2AA 1ZYBA 4XFHA 1N3PA 3T2OA 3LDBA 3R05A 1JUIA 3N7KA 2ORZA 4UFMA 5J36A 5JZGC 4YM1A 2VQ0A 4D7YA 1AR92 1BEV2 4LQRA 1JU3A 4EN8B 1H9WA 1YJKA 2DUOA 4LXLA 5H9QA 3G6JB 4QX1A 3POGA 2WA4A 3S6PA 5JR2A 1ZRCA 4YFWA 1WD4A 4YW2A 4DS0A 2LS6A 3J8F3 4A7KA 4RYDA 5AC93 4AVAA 1Q8SA 2ZKLA 1T2XA 1WLWA 2OYZA 2ZGPA 4CP9A 4KWUA 3LOBA 4LUKA 1GNZA 2QQVA 3N9MA 2VMHA 3CL1A 2QQJA 3E1F1 1XU1A 1UZYA 2BFUL 1UIJA 4N9HA 3VHPA 5C8WA 3MV11 3M70A 1VIWB 3NJYA 5IVYA 5CFCB 3SCFA 5D21A 1B35C 2WNUB 1NY72 1S0EA 2HWF3 2ZA9A 3CQOA 4ZZ8A 1GWLA 4YZ3A 3WQ7A 5FPXA 5I8YA 2AUYA 3IMNA 5K7PA 1QJU2 3N9OA 3I3EA 1ACCA 4NAOA 2R041 1UOGA 2ZJCA 2BGOA 1AL22 3D0JA 4JGYB 5IVBA 1PNFA 4XUPA 1UX6A 5C33A 4AFAA 4DNYA 4LTAA 1AHSA 5IYYA 1J59A 2BEOA 3L2YA 1QJY3 3GBWA 1AR83 2VZVA 4MH0E 2YROA 4AI8A 1QH7A 4A7YA 4M4PA 3ES1A 1O3TA 3TEWA 1XNDA 2AYHA 2WYFA 3AKQA 4QDSA 2HWC1 5DABA 2QQIA 4LO7A 5IK7A 4BIOA 4KBBA 5EYYA 4KQ7A 4AHZA 2VCBA 4GKXA 2V4AA 4GWJA 4FO9A 1AR62 5LZ6A 4GB32 1I3HA 2X29A 3J7MA 2XLFA 1VBB3 4QPIB 3SMHA 5AFBA 3ENRA 2D98A 1XPWA 2Z5WA 1VMHA
chains in the Genus database with same CATH topology
3MIHA 3WP3A 4CDQA 4YW4A 1CN1A 1VBD2 1BVP1 1KD7A 4HMZA 5A3LA 5CB7A 2CTVA 3VL9A 3I4IA 2GMPA 2P17A 1CONA 1ULEA 2DVDA 4Y20B 1GZ9A 1W6PB 3WHTA 1SCRA 2WSUA 4AI0A 2G4IA 4EN7B 4Z1VA 2BYVE 4ONUA 1S0DA 4YVSA 2DCKA 2Y0IA 4Q4V2 4M0HA 4CTEA 4AF9A 3WCRA 4AVBA 1PGL1 5DZEA 2R0HA 2EAKA 2RS13 2XG3A 4R4ZA 3WQ0A 4B8EA 3VL8A 2W68A 1DZTA 3WP6A 3ZPYA 4WZFA 2D43A 1Q8OA 4I09A 5JZGA 3ZXEA 2D7FA 2TBVA 4EN6B 1PZ9A 4GQ7A 2VNOA 4XQWA 1QY4A 4IERA 1MS0A 2DUQA 4JGYC 1FYUA 4AVTA 3ZYGA 4ZXKA 3VLBB 2R063 3LAGA 3RYKA 3ZIXA 1SBDA 3RMXA 5JOYA 4RA0A 1DQ0A 4YGBA 3USSA 4RFT0 1G9AA 3UJQA 1ZBA1 4RGGA 3PHMA 1TMF1 2ETEA 2X5IB 5T54A 4WVMA 2RE9A 1OPOA 4Q4X3 2JEMA 4LO6B 1V6MA 4INDA 3NKGA 4JCKA 1B35A 2EXHA 4NHMA 1V9U3 4QHBA 2ZGSA 4QPIC 5BNNB 5DDJ3 3ZFGA 2BGCA 3ZMOA 4OLLA 1CX4A 3HAGA 3FBMA 1R091 5CU1A 4XFCA 5CFDB 2WZPP 3IM0A 1OQDA 4AEDB 2MEV2 4W65A 1C3HA 3BTAA 4PLOA 3OTFA 4XF0A 3WG3A 2B9UA 4HKOA 1O5UA 3TBDA 5F9TA 4IV1B 5J36A 3RI8A 1J1LA 5ACA2 5J96B 1TNFA 2D44A 2OZ6A 5KHHA 4LLFA 1EAH2 3TB0A 4Q0PA 3JBG2 1RIRA 2EF6A 4M3CE 2WT0A 2DFCA 5FAXA 1WUVA 4HPKA 4P9GA 2YPJA 3B5LB 4AHYA 4IEOA 4XYXA 1XYOA 1LHVA 3DN7A 2EVXA 1SLCA 1PVC1 3WHUA 1IS5A 2ZGTA 1R1A3 1AR72 3G7DA 2IXLA 1ASJ2 1W0PA 4HT1T 1M4WA 4OI2A 4XJ8A 3VKNA 2YXSA 5BY5A 4R9DA 3PVOA 1ZBE1 2PFWA 2ZTNA 5FQ0A 2B5HA 3VBHC 2X5IC 4K1ZA 2XVLA 1G86A 4COZA 5HXVA 4RR3B 1V6NA 3UK9A 4EROA 5I8SA 3IWZA 2SBAA 1C8M2 2ZZJA 4PDWC 4E2SA 2C0ZA 4CRQA 4DRRA 4BCUA 1BBT2 5BNNC 3GZUC 4OI4A 1ALYA 2ARBA 3J9SA 4LBQD 4QQ2A 1HRI1 3S7EA 1QXJA 3ZSJA 1TME1 4AEKA 5J37A 1QOTA 4OUMA 3S30A 1SQ4A 4JGYA 2HWD3 3OBTA 1ND2B 2VECA 1ULGA 5K9YA 4AEDC 3OBRA 5FLHA 1RC6A 2XJQA 3AP6A 2QFEA 1QGLA 4K8FA 1HXS3 2A7AA 4YZ2A 5FMOL 3JU9A 4KG8A 2XWBB 1F5JA 1SACA 3E6BA 5T5PA 4QPIA 1TQ5A 5F5QA 5KXCA 1LGCA 4XF9A 4AVSA 3UJOA 4DMIA 4LBOA 2O0OA 4FT8A 1F8VA 2HWF2 5A33B 3URFA 1EP0A 3O7OA 4M0NA 1EV13 1FI2A 1SMVA 5BNOB 3M3IA 4Z92B 1W6PA 1C5HA 5AVAA 2PAMA 3CEWA 4JGZC 3O0WA 3OGJA 2XBO2 4XE9A 1VBA2 1PO22 4HSJA 1AR82 2IWGB 4SBVA 4Y24A 4YGDA 2R071 2RMU1 3J26N 3MEPA 4L97A 5TSWA 3VBSC 4P9LA 2SLIA 4QPGB 1LOCA 1S0CA 2LM3A 2WLQA 4Q0VA 1FOD3 2QNKA 4CP0A 1HRV2 1LHUA 1VBE3 3T1LA 1NZCA 3M4FA 3KLSA 5JI9A 1VBB2 3WDWA 3VZOA 1J3PA 3VV1A 1NE6A 4N90A 3Q9OA 1RUF1 4YSFA 4I30A 2I45A 2ZAHA 4Q4W1 1D4M3 2WL1A 1ND2C 3FFQA 1VLNA 4P14A 4EJRA 3DF0A 1MEC1 4ASMB 1WMEA 3AYAA 1FNYA 2XJSA 1G9FA 1QH6A 1CAWB 1VP6A 3LOIA 3VBHA 2XGXA 1RUC3 5HI0A 2X5IA 3USUB 2XPJA 4FOVA 2GZWA 1WCKA 1V6OA 1W6OB 3N7MA 4URTA 1AX1A 3NKTA 4PDWA 4ATEA 4PIXA 5L36A 4CDWC 2RS33 4FCAA 1FPN1 1RUI1 3MLKA 4XQDA 3R0RA 4YZ1A 4DQAA 4PQ9A 5BNNA 1YJLA 3WR0A 1RB8G 1FNZA 3WUCA 4I0AA 3AZXA 2RS12 1HX6A 2FMDA 4FXGB 1AR93 1BEV3 4AEDA 1HQNA 1QQP2 2VXRA 4N9IA 2YHJA 4Q4Y1 5I0UA 1F9KA 1CAUA 3M7AA 1YNAA 4IQPA 3MIDA 1CJDA 4M3CB 3HT1A 4XFAA 1MS1A 2JICA 3SXWA 4BIFA 1JXNA 1GSLA 4S2FA 1SBFA 1OFSA 3FE5A 3TRSB 3E5UA 1JTZX 4GH4C 3V56A 1YHFA 3LA3A 2KA3A 5GLUA 1LHWA 4QPGC 3M8LA 4OHYA 4WVVA 1S0GA 3KSCA 1HKDA 1ENSA 2D6NA 4H3WA 5F6LB 1R1ZA 4NHKA 5KXEA 2HWE1 1SLIA 1A8MA 4KU7A 4E4DX 1QNWA 3ME2A 1AL23 2UWCA 3MYXA 2RM21 3RJ2X 1VBC1 4FOYA 4OZXA 2DVFA 2K0GA 4XDQA 1RUJ2 4YYOA 4RHV1 1AYN2 1V00A 1H8TC 2ZGNA 2VGDA 4K9SA 2HWB1 3RNSA 2ZBJA 2IFWA 3VBSA 1T6GC 4K3UA 4RD7A 1WW5A 4DPNA 1AR63 1I6XA 2ZKNA 4GB33 3DPRC 1CQ9A 4AQTA 5CBLA 5A3MA 3KB5A 3FFZA 5J7MA 4PLNA 3WV6A 4XXAA 3WZ1A 3BALA 2W39A 1VBD3 4G4FA 4I01A 3WDUA 1KS4A 3WX5A 4R52A 1W0OA 1ND2A 5HCBA 3B69A 4FPCA 3MIGA 4YVWB 3MIEA 3ZSMA 4Y22B 3WDVA 2RHPA 3I59B 4QXKA 1LOEA 3ZX7A 2LUWA 1KXGA 2HWC2 2PLV1 5JOWA 3THPA 5K8SA 3ST7A 5LK7B 1EYBA 3DKWA 2D93A 1I1EA 3POYA 1AUYA 2WIIB 2R30A 3AP7A 4FQZA 4JAAA 2WC2A 1K5MC 4CDWA 1OSGA 2VOXA 1X82A 4GALA 3BOWA 3OYWA 1W6NA 3AZWA 4YARA 4QPYA 4IEPA 4P9XA 2PA7A 3AJYA 1DGRN 1C1LA 4CYDA 2C5DA 4FAHA 5A33A 4NO4A 1LOGA 2ZABA 5T5OA 3UKNA 1W2UA 4AVCA 1UU4A 2Z42A 4MX3A 4FOWA 3V0AB 3D6EA 1AYM2 5DG1A 2RR12 1QF3A 4COVA 4XQ4A 5AC91 3J8F1 1KQRA 4IEZA 2ZGKA 2CYFA 2WJSA 1O4TA 2BNMA 2TNFA 1RVF2 4GH4A 3A4UA 5IK8A 1YFYA 4QPGA 3TAYA 3ZXJA 3IPVB 1DZQA 4YNIA 4JV4A 3ZXFA 2W08A 2D40A 2CL2A 3BOPA 4H14A 1HV0A 1XRUA 2YUEA 2PN5A 3T1MA 1L3JA 3ALQA 4K7JA 3IDCB 1PMIA 5BV6A 3U0ZA 2MEV3 5JSRA 1NQDA 1SLLA 1C28A 4QMAA 2DUPA 2WKKA 4YVWC 1ZX5A 4XFIA 3W59A 1QJY1 1H8TA 1HV1A 4XF4A 2D3PA 1H4HA 3RYPA 1CAWA 4OI0A 2YC0A 5ACA3 3KCCA 1H2LA 4Q27A 1W6OA 1ENRA 4CDXC 1EAH3 1XE7A 3DPRA 3JBG3 5GZDA 1Q8QA 5FMOS 1YLLA 4MXWB 4FTBA 1KFUL 5JCTA 1KJLA 4YGCA 2OA2A 1GZWB 4JTNA 2D3RA 2OUHA 3JZVA 4BLIA 1FOD2 2XJRA 4COWA 2ZGQA 1N1YA 2XKPA 1AR73 4U36A 3MPBA 4EWEA 4MGYE 1S0BA 3BPZA 1ZA4A 2P3KA 4X8NA 4JDMA 2ZGOA 2NLRA 4FXKB 5JSOA 4M3CA 2NQYA 2VW2A 2GC3A 3FBYA 4AK3A 1CAVA 5DZFA 4QM9A 5GLWA 3VZKA 1ULCA 1XE8A 1BMV2 4OFGA 2E7QA 3O12A 1HQLA 3GNEA 3OJBA 5I91A 4BHPA 1XNBA 5I0RA 1BBT3 4AHXA 2NN8A 3I2DA 4B4PA 1IKPA 3AZVA 5C6CA 1LGBA 4TLFA 3TN93 2E9QA 3KS7A 3E6DA 3EXUA 4Y26A 5JOZA 1XYPA 4P9YA 3N7JA 3AMQA 3AFKA 3I7DA 4AFDA 1CAXA 2R061 1VJ2A 1Z7S2 2VUAA 4AQ6A 1ZBE2 1D4VB 1RJ7A 1KDKA 2ENRA 4M00A 3QACA 3NAPB 3B00A 1LKNA 4N53B 1QNYA 4XJAA 1X8EA 4HN0A 3MW4A 1V9U1 3R6SA 4QGMA 4RL7A 4BM8A 1HIXA 4XJUA 1HRI2 1YO8A 4RQPB 4LHKA 1V6JA 2WINB 3WINE 3PJQA 2WFF2 1TNRA 1NCQB 5K0UB 3ZFGC 4B4QA 4ISQA 1OKQA 4YVWA 2WNVC 2ARXA 2A70A 4Y22A 1RUNA 1WMDA 2EXKA 3I59A 3ZYPA 1IPJA 3KZ4C 5E8AA 1AXKA 4WVZA 1NCRB 4LR4A 1CJPA 3IN9A 4EN9B 4CEWB 4OHXA 1LOAA 2XBO3 3E97A 1VBA3 1PO23 4CDXA 4XOGA 2PHFA 5JI7A 1C5IA 4AGRA 4HK9A 3SITA 2F6BA 4E4ZA 1URXA 2K9ZA 1HRV3 1V70A 3CNAA 1W6MB 2ZGUA 5D1IA 4FP2A 5T5JA 2A6VA 1H2NA 1H1MA 5EZWA 3ZYRA 2PHLA 3V0AA 1LR5A 3KD4A 4NWVA 5EJ3A 1RTVA 3HBZA 2XVGA 3S7IA 4DOUA 4JRAA 1N3QA 3KGZA 4NVPA 1CIWA 3H50A 5LRSA 2VNRA 5CIRA 2I2SA 3FLPA 3NAPC 5ABJB 4LUMA 3ECQA 4LHNA 1C4RA 1REDA 1SEFA 3IPVA 1LU2A 3LA2A 4C0HA 2Y0OA 1PIV2 1RHI2 4LBQB 1CGPA 1UPSA 2CGOA 2BUKA 5FCCA 3IKWA 3RMYA 3TNQA 3KMHA 2P3JA 2D5HA 3NW4A 1MZFA 5CFCC 5KBFA 1IHMA 3OF1A 4IEXA 2BW8A 2WNUC 4DY3A 1ZM1A 4LBLA 4S2HA 5K0UC 4QT6A 1NA1B 1QQP3 1RUH2 3VZMA 2EA7A 2ZX0A 2A6YA 2WQZC 3ACLA 1NCRC 2DYCA 3ZN6B 3E6CC 4CEWC 1JHNA 3JD71 4Y1VA 5E89A 1IS4A 5C4WB 2AENA 1HXS1 4TWTA 2ZGLA 1S2KA 4FPEA 3FJSA 3WXPA 1FPN2 1OOPB 1OHFA 4MXWA 3HT2A 2D5FA 2E63A 4H55A 2NMNA 5T3NA 3AKSA 1GZWA 4YM2A 1G8WA 1RUE2 1S0JA 2UY8A 4E27A 5IK5A 3LZZA 5DUVA 2QZ3A 1ZZCA 1VB2A 3B93A 3FZ3A 1B09A 1QKQA 2WNVA 5LRRA 3LCPA 1AL0G 2B45X 1OPMA 1D0HA 4Y1XA 2O1QA 1EV11 4R9BA 4WM8B 3AMPA 3PVEA 4AWDA 2ZZQA 1COV2 3WG1A 1BK1A 2BVVA 1RUJ3 4D3WA 1AYN3 3AKRA 2B8MA 2JD4A 4C1WA 3B9CA 4F83A 2JECA 4AE2A 4LNVA 3VZJA 5C9AB 4YW5A 1OI6A 1APNA 1WLTA 2R32A 3CJXA 5T5LA 2D6LX 1J1TA 4IEVA 1RMU1 2GNMA 4PLMA 3AXEA 5CADA 1XXNA 4KL1A 3ZXGA 1FATA 1UU5A 1KS5A 5FRAA 3NVCA 4I02A 3WW3A 2QKDA 1VBC2 3JB4C 2VW1A 3KQRA 3R4UA 1D4M1 2Z79A 1ND3B 2R49A 3EO6A 3LSEA 4RHV2 1V6KA 5KWRA 2ZAAA 3GYDA 4K21A 1KRIA 2NYYA 5JDBA 2AGSA 2HWB2 2HWC3 2LALA 4G3YC 5F1RA 3NAPA 3S0MA 4FPJA 4XPVA 4X6QB 5I8TA 4KGGA 1RITA 4Q26A 4O9EA 2W52A 2NM1A 3NV4A 4X8PA 4CEYB 2NZ9A 4PBPA 4MGKE 2Q4SA 4MGZE 3ZFEB 1LEMA 5CFCA 2GALA 1UU6A 4RQPA 2WNUA 1DZRA 4WVWA 5K0UA 2CGPA 3GHNA 1R082 3J4UH 5C8CB 2VMGA 3MLJA 2CAVA 1AR91 3TN92 4QU2A 1RJ8A 4LBMA 5IK4A 4M3CF 1AYM3 2WFPA 2RR13 1LEDA 1NCRA 3WLUA 5CFDC 2ZX2A 2ZHMA 4TSVA 4CEWA 4ATFA 2PLV2 5T55A 1QXRA 1BZWA 1MS9A 1PHMA 3ZSEA 3H1WA 1IS3A 3SLIA 1UD1A 1MS8A 4GXLA 5KXDA 1RVF3 3M3EA 4R9CA 3VBFB 4AFBA 3MIFA 3AP5A 4IV1C 4XHBA 4K40A 4OHWA 1MQTB 1WW6A 1AVBA 2GSYA 3BIWE 3SH3A 1H30A 2JE7A 2ZMKA 4P9WA 1NY71 1W6MA 1DQ1A 3OD0A 3WDXA 3GHMA 3MPPG 1QJU1 2WS91 2JG8B 3V64A 4AXOA 1UZZA 1AL21 1VAKA 4HSLA 1LTEA 1X7NA 5GKAC 4YFZA 1XYNA 1NLRA 3WOGA 1ND3C 2IXCA 3HWJA 1A3KA 1SLAA 2WZR1 4J6GA 4Y20A 1YI9A 4IEQA 3FC0A 5ABJA 2N7GA 3MIBA 4C0BA 4ISRA 2G9FA 3RYRA 4DZGA 3FLTA 1PZ8A 3FUQA 1VRH2 2UURA 2EAAA 1OMIA 4GB31 3AK0A 3BODA 4CEYC 2XLAA 2CWSA 3B3QE 4LBQA 3X29B 4P9JA 2F4PA 4KGQA 4RR3C 5I93A 4L92A 2YY1A 2BFUS 1Y3TA 1QOSA 3D82A 1U0AA 1NLSA 2VY0A 3PMSA 4A3XA 2ES3A 4KWKA 1NA1A 3SHRA 2E53A 2JENA 2UU8A 3UKVA 4BPZA 2DTYA 3ROUA 2OIIA 4C91A 4YG6A 4WBBA 2V09A 5BUVA 3CJIB 2ERFA 1G9BA 3ZYIB 4FTEA 2DFBA 3H3ZA 3ZO0B 1XU2A 1LECA 4OUSA 3MZHA 4Q4V1 1YFXA 4XF3A 4NOTA 4YZ4A 4Z07A 4BA6A 4G9SB 2PAKA 3HD8B 4RS5B 1CVNA 1MQTC 2VNGA 5I0TA 1RINA 2PHUA 1X33A 3CF6E 4FQ4A 3MICA 4JDOA 4EN0A 1QHDA 3M3CA 4E9KA 4LE3A 2PHWA 3NV3A 4HZFA 1YXWA 4LBJA 2GC2A 1RUD1 4OHVA 2IZWA 2A3WA 5SV5A 1QJX2 2V5YA 3N4MA 1OQEA 5DUUA 1WLDA 2VOWA 5GLZA 5CFDA 2A71A 3ATGA 1HQWA 3HIFA 3OPZA 4R8HA 4XIKA 4AGVA 3U4XA 1GQHA 3DUIA 4PIYA 1N3OA 2QVSB 1Z7S3 1S55A 2YV8A 1ZBE3 3ELNA 3N7LA 4GMP1 5BNOC 1O3QA 1GNHA 1GR3A 4N7IA 4XW3A 4XBQA 5T50A 5L7OB 1RUG1 1U5YA 3RJRA 3IIAA 2PHXA 5D8AB 4IV1A 3WDYA 4XBLA 5H9RA 5GALA 3OCPA 2I74A 4M01A 2VQAA 2LTNA 1ONAA 3AXDA 3PVNA 3VBUB 3WW2A 3WY6A 4DFSA 4BZ4A 5HCFA 1ZZBA 3WUDA 4D7TA 3RI9A 4HVOA 1LCLA 3UV9A 3QOPA 1HRI3 3VUOA 1O4ZA 4GULA 4L8QA 1JYIA 1DF0A 1GV9A 1PK6B 1W39A 2WFF3 4RSUA 1HLCA 2FZ2A 2ET7A 4AYUA 2MEV1 3B7MA 1KDMA 1ND3A 2GC0A 5L19A 3TWIA 4D94A 3D5OA 5H9PA 2R0FA 4A7ZA 1FX5A 1J3RA 2QDNA 4UW6A 3THTA 5JAXA 2D97A 5DUXA 1E57A 3RQ0A 4LBNA 3H0OA 4QQHA 1EAH1 2C1FA 2E7TA 2OW4A 2Q30A 5KC6A 3JBG1 4CEYA 4LO5B 2Q5TA 4Q0QA 1MZ5A 2JKBA 4QGNA 4RR3A 3RS6A 1DHKB 3NSTA 4CDUB 4J1WA 2HYKA 4HANA 4XILA 2KM2A 4QX5A 1FMD1 1DQ5A 1U12A 4LULA 2DU1A 2R042 1C57A 4W6XA 5FOBB 1ZNPA 2QQPA 1ASJ1 4IEUA 4YM0A 1NQJA 3ZSLA 2XL9A 5JMCA 3C3VA 4IXLA 2A75A 5BNPB 2VG9A 3LKJA 2D6PA 4W6YA 5A32B 1EPWA 4YGEA 4XIOA 5L7OC 1PO11 3I8TA 4UBGA 2RMU3 5J09A 4MLOA 5D8AC 1EPZA 2BNOA 3LA7A 5EXOA 5BPXA 1MQTA 3RWNA 1DQ2A 3WW1A 4ZKTB 1C8M1 3ZMNA 3VBUC 1PIV3 2GNTA 3MW2A 1RHI3 4FAGA 1BBT1 4UBHA 4DINB 5CG8A 4LO4B 1DYPA 2RS51 1MZ6A 3KT4A 2BBVA 1RUH3 4META 1F31A 2GU9A 3DL3A 3MF9A 5BNOA 4LEJA 4PCRA 1UPIA 3U11A 3WT3A 1PGW1 3D8CA 4COYA 3WG2A 3H3UA 1FPN3 1QWRA 1D0GA 5JIAA 1SCSA 4BQ1A 4XHXA 3ILFA 5KHKA 1QDCA 1PGL2 2X8KA 3H1MA 5EFUA 2D6OX 4CDQB 1RUE3 3ZFFB 2E51A 2ZCWA 3D0SA 5JWPA 4JRLA 2HWF1 1FXZA 3ILRA 1U5XA 3HR9A 4Y4YA 2BQPA 1ZVFA 1COV3 2ZGMA 1UW8A 3D4KA 2WQ4A 3CJIA 1H9PA 1YIFA 2VVDA 3JD72 2X53S 1C1FA 1VBA1 1PO21 1AR81 3QH6A 4FP3A 4WV8A 4ES8A 1ZBA2 1CPMA 3USUA 1ENXA 1TMF2 1F2NA 3VKFC 5AVPA 2Z69A 2QE3A 4HBNA 5JSPA 2EALA 4NHLA 1UKRA 1HRV1 4XMIA 3AMHA 2HWE3 1S0IA 4XFBA 1WA4A 1VBB1 4HKLA 4K1YA 2H0BA 4HLTA 3GF6A 2R1DA 1R092 2RM23 4FPYA 1VBC3 1WCSA 4CP2A 4CP1A 3A0KA 2FMYA 4RHV3 4YRDA 4Q1PA 1RGSA 1OQ1A 4D69A 3KCYA 4XFGA 2HWB3 2RJKA 5JOXA 5L7OA 1N1VA 5D8AA 5LEJA 2O8QA 3GBFA 3N35A 1AF9A 1QJZA 1N1TA 2AZ5A 2VH9A 2VW0A 4FPLA 3O5SA 3VBUA 3H9AA 5KHIA 1BCXA 1B35B 2GNBA 3V0BB 4QQOA 1DDLA 4LO8A 3MI8A 3ZFFC 4CZSA 2RS11 1DLLA 1MACA 1PK6A 2Q8OA 3KT7A 4XTPA 2JX9A 5FFOC 1R083 3RPQA 3U10A 1Z0HA 1PVC2 4KWLA 4AEJA 1QQP1 5J98B 1ZZ8A 2FBEA 2OZJA 1A78A 3ZXDA 4MV2A 2PLV3 1XNKA 2DCTA 4AHWA 4ZU7A 4Y5Z0 4YW1A 2IXKA 5KHGA 2A5ZA 2XL7A 3WVJA 3PVBB 4R9AA 2DVAA 5E88A 4MZUA 1TE1B 2UY9A 4Q4X1 1DGWA 2NPIA 5FLIA 1AXZA 4V1PA 5CG9A 4I2OA 4YM3A 5GZEA 2VU9A 3V65A 4NPRA 4B4RA 4FTSA 2HEVF 5DDJ1 2G9GA 2VVFA 2W0XA 3WDTA 4Y1UA 1TME2 1OLQA 4HN1A 2ZOEB 5IT6A 3HN1A 1FV3A 1JOJA 5GZCA 3AFGA 5BNPA 2WLPA 1RUJ1 2BNNA 4XJWA 4BMEA 1AYN1 2AH2A 1Q43A 1Y9QA 5CA6A 1H4GA 1O91A 2VVEA 5KXBA 5A32A 4I3PA 5FQ0B 4P9IA 5H9SA 2MHFA 2DF7A 3EJKA 4JTOA 3GZAA 3AP9A 4B7KA 3VKOA 1VRH3 1V6IA 2YMZA 3VHOA 4QQPA 4N43B 3MDPA 1IZ3A 4GWMA 1YFUA 2PHRA 4K20A 5BXXA 2VMIA 1NG0A 4COUA 1SLBA 2EXIA 1PVXA 2ZX3A 2WS92 3L9JT 1OFNA 1S2BA 3ZN4A 4P5HA 5GM0A 1QDOA 2VUJA 1WLCA 1G7YA 1Q8PA 4LLOA 3DV8A 4YW3A 4XF1A 2R6QA 2YGMA 1R1A1 4KWJA 2HEWF 4I0BA 2GMEA 4OI1A 1BKZA 2WZR2 3AMNA 2DWRA 2CGNA 4XETA 4XZPA 1A8DA 1IOAA 2PELA 2XB6C 2D6MA 2EXJA 1S0FA 5JIUA 2I07B 1POV0 2JDZA 4B7EA 4FSJA 2CV6A 2R072 4F3JA 2RMU2 4BLJA 4F8AA 3JQWA 1POV3 1DIWA 4N53C 5FO8B 1LODA 2HJIA 4AEMA 1REFA 3MGUA 1WMFA 3ZFFA 5HBAA 4KU8A 4TYSA 1D2QA 1UAIA 2HKXA 5CAZA 1SDWA 4Y1YA 3OD4A 1QJX3 4AFMA 1IKQA 3ZIWA 4RQPC 1KITA 1RUF2 1AYM1 4HFSA 1DYKA 2RR11 4Q4W2 1NCQC 3QBQA 2HWD1 4ZU5A 4AQSA 1ZZ9A 3AM2A 4S2GA 3MF6A 4HVRA 3C2UA 2P34A 2Q1MA 3VGIA 2YGLA 1MEC2 2TEPA 2GN3A 1H8VA 2AREA 4DRVA 1RVF1 2BWCA 5JR7B 1CD3G 2BPA2 2ET1A 2R1BA 4N43C 5L73A 4IEYA 4XBNA 2CAUA 4UW3A 1RUI2 1JN2P 4MSVA 2A73B 2PHDA 3W58A 4MXVA 2PYTA 3SH4A 4FOQA 1RUD2 4QD2A 5BYNA 3VZNA 3E5QA 1ZZ6A 2ZMLA 1OA2A 4IESA 3NJZA 3CO2A 4IV3B 3VBRB 2ILMA 1LOFC 2FZ1A 3TNPB 4Q4Y2 2ZHNA 3POWA 1MS3A 1O7FA 3JB8A 1RUG2 3VBHB 2Z2SB 1D2SA 3M3OA 4YG3A 4FVVA 1A6CA 4B3NA 3I54A 4PDWB 4XJ9A 4AI1A 4YZ5A 4XTMA 4D7SA 3V0BA 1MVQA 5E16A 2A3YA 5ABJC 1NXD1 1YUDA 2WA3A 1YIPA 2XVKA 1X8MA 1YCIA 2NMOA 3OGGA 3PNAA 3L2HA 3VDDB 1OA4A 1LGNA 1FOD1 2YZ4A 1G9CA 1BQPA 1VBE1 3ZSKA 2A6XA 2UYBA 2HWE2 2R043 4ITCA 1Z78A 1CAUB 5GZFA 1DGRA 2RM22 3QCWA 3LWCA 5JVVA 1X50A 2PAEA 1NA1C 1V6LA 4ORFA 2WT2A 1U5ZA 3UL2A 5JPMB 4L11A 1GZCA 1BMV1 2DURA 1RUC1 4PBOA 3WD5A 1WW7A 4Q8KA 4N53A 1MZEA 5C4WC 4AGGA 3ZYJB 3OY8B 1OOPC 1WCDJ 1GANA 2RS31 2OVUA 1LOBA 1FMD2 1C8NA 1RUOA 1PZ7A 4H7MA 4L99A 1U5IA 1UKGA 4XJZA 1JW6A 4KG0A 3ZN5A 1NCQA 1FV2A 1H1IA 4IV3C 1W6QB 3VBRC 4JGZB 2MPFA 1BEV1 1DGLA 1Z7S1 4WM8C 4YG0A 3T2TA 3RG0A 4HL0A 1PO12 1SFNA 4JDNA 2YYOA 3VBSB 2XJPA 4FPGA 4Z2WA 5BNQA 1I5ZA 1GYKA 3GZTB 5EV7A 1DG6A 4N43A 1UMZA 3B02A 3K48A 3ZDSA 1LESA 2UWAA 3H7JA 5C9AC 4X6RB 3FUOA 4QQLA 3MLLA 2QJVA 2RS52 3PLQA 5FPZA 1OLRA 3VDDC 1DGWX 1DQ6A 2JJ6A 2WFF1 1H2MA 5LEKA 1AX2A 1SFYA 4AQ2A 3AB0A 1LOFA 4E2QA 1GBGA 3ETQA 3BU7A 3KM5A 4UXAA 2MNGA 1NXMA 1PGSA 4XXPA 3JD73 3HQXA 2UYAA 4GWNA 3SCHA 3AZZA 1CPNA 2XLGA 1QXPA 5AC92 3J8F2 1PGW2 4HK8A 5SV8A 3KGLA 4A2UA 1ZBA3 4CDWB 2ZS6B 1H2KA 1TMF3 2P37A 4MYEA 1NYWA 4OHZA 3LSDA 5DZGA 1J3QA 1BJQA 1LJ7A 2ZHKA 2ZACA 1PM7A 1JBCA 3IDBB 3OYWB 1W6NB 1AR61 4FPKA 4WM7B 5J3UA 1DFQA 1KFXL 3NWKA 1Q8VA 2PHTA 3ZFEC 1R093 3E5XA 4C1XA 2D6KA 1VBD1 5F6KA 4TZDA 3VZLA 2DVBA 4JVAA 3K51A 3IDEA 3JCI