3MLPA

Early b-cell factor 1 (ebf1) bound to dna
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
351
structure length
337
Chain Sequence
VLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEAATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTEPTIDYGFQRLQKVPKEVILKRAADLVEALYGMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor COE1
publication title Structure of an Ebf1:DNA complex reveals unusual DNA recognition and structural homology with Rel proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 56
structure length 337
sequence length 351
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2010-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01833 TIG IPT/TIG domain
A PF16423 COE1_HLH Transcription factor COE1 helix-loop-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlpA02
3ZE1E 1F2XK 5JPNA 2DYPA 4XC1L 4Q9QL 4WV1A 1INEL 3BSZL 3HI1A 1G6RH 4OD1L 4RX4D 1BOGA 3DMMC 4JFED 5HI3D 5JO5A 3KPSB 4H88L 1A3QA 1N6VA 3MGOB 1K9TA 4UUJB 2PXYC 3P0YL 4YFDB 3U82B 1JHTA 3DOSA 2R23A 2FGWH 4H26A 5E9DA 4BYHA 4LASH 1I9JL 3ROLA 4P2QA 4WDIB 3ET9F 5CGTA 4PGBA 2OL3H 1A14L 2GSGB 2IH3A 5GJSH 2FO1A 3GMOA 1K8DA 1MCPL 3FFDA 5L0QC 3S96A 3MJ9L 4HV8B 1NCCH 4P4RB 3VWKB 3FO2B 5B3NA 3MRGA 2W9LA 5FO9A 5HPMA 4RIRA 2WZPD 2JIXD 3V2AR 3CDFA 1IM3B 1U8PB 1QSEE 4DOHB 5JW4R 1Q72L 3WBDA 4P3DB 1CYGA 4NUGL 5DZNA 5EBWB 4PGDB 4ZO7A 4N0CC 1TVBA 3CFCH 2DD8L 4F2MB 3GSOA 4U1JA 4YHMH 3MJ9A 4U31A 5EUOB 3LVEA 1YEJL 2DM7A 3UYPA 1HWGB 3F65A 1GZQA 2YC1A 5BRZD 4CVZB 1BZ9A 1DVFD 3V79C 4Y1AE 2YSSB 4R4BA 3GMMB 3I6KA 3NFNB 4XC1H 2RBLA 3M17B 3BSZH 4JM2D 2YRZA 5C8JB 4RGMC 4JFFB 3WS3A 5ITFB 2F74B 5KSVA 2DMKA 3G08B 1KG0A 3WFDH 4H88H 3U9UA 1JTPA 3BWAB 3QZWA 3QPQD 3SJVA 2HH0L 4RGOL 4LNRB 5EN2A 2QADB 3ESVF 1M71A 2ITDB 3CH8A 4G8GA 4H8WL 3O3AA 4PJIF 2OR9H 1EXUB 2QR0B 4L3EE 2GSIB 1PZUB 3WSQH 4HUVA 5IF0B 3CK0H 1A14H 2FIKB 5FF6B 1XF3B 5BW7A 4LCWA 1OY3B 4Y4HA 1QLRA 4KZEH 3RWIB 5I8CB 4HK3J 1UACL 1IVLA 5HDQL 2C3XA 1E4KC 1NUNB 3DJ9A 4OCLC 1MFAL 4JJHA 3BH8B 3OXRB 3ILQC 3BRGC 2UVEA 1JUFB 4GLRH 3IU4H 4Y5XB 3T2OA 1HYSC 4NUGH 4UBDD 1SQ2N 4A6YA 4R7DB 3LD8C 3C60B 4HPOH 4JDZA 1LEGB 1LE5B 5F88A 3VXUD 2DD8H 5DK0A 5HGBA 4WCYL 3O6FA 3WLWC 3E6HB 3W2DL 5HYSB 2G75A 2Q20A 2OL3B 4U1MA 4OGZA 4Y19B 2RB8A 3MRQB 5F9WB 1MRDL 2HG5B 1LEIB 1B2WH 3T2NL 1Y6KR 2O5ZL 4CAGA 2EDTA 4CU7A 4F15C 4TNWK 1JV5B 2NY6C 5DUBA 4U4BA 4K3EH 1CXKA 4OZGF 4X83A 4X80L 3L7EB 4LVOC 1F58L 3BKYL 3SDXF 2B0SH 1WFUA 2YD7A 3MRBA 4DVRL 1KEMH 4ETQA 5HI4C 2HN7B 1KCRL 4N5EC 5ACZB 5DJDA 4G43B 1SEQL 4WHCA 4GKNB 3IDNA 3HI1B 4YBLB 5BCAA 3BE1H 2HH0H 3MNZB 2FWOA 5D7JB 5IVOA 3IETB 1KACB 3WNOA 4X6DE 2XXCB 5D7KE 2DQCH 2DQJL 4FQPA 5HDOA 3BN3B 2EKSA 1S9VA 4L4JA 4LSPL 1JHTB 5C0DB 3C8DA 1MLBA 4H26B 4X6BB 5E9DB 3NA9H 4R0LC 3CMOH 4I2XE 3D3VE 4WI6A 3ROLB 4E5XB 1E6OH 4X99B 4OGAC 1QSED 4LLWA 3SGKA 4JHAL 2IBZY 4P23C 5HHOB 5E6YA 2ILLA 4Z76A 1UACH 3FFDB 5TE4H 3VE0A 2WLZA 4KZDL 2HTLC 3I50L 3L3GB 1JWSB 5JOFA 3VFRA 1CFVH 5D7LB 3MRGB 1NFDA 3SE9H 4RIRB 4HFUH 3TIDB 1RU9L 1U8IA 1IEHA 4CW1A 1OWRM 4NRXA 3OG6B 3G04B 4EI5B 3Q5YA 5JQHC 3WNPA 1G9MH 3QUXA 3W2DH 3VFVA 1TVBB 3T2NH 4Y1AD 1HXYA 1F3JA 2MJWA 4FQIH 3GSWB 5MEQA 1PSKL 5ADOL 2YKLH 4R4FL 2YD4A 1M6OB 3DRQB 2E27H 5GS1C 3RVXD 3ZTJG 3RP1A 4YJZL 5E4EC 4K23L 4X80H 1HDMA 4YHLH 3MJ7A 3UROR 1YMMB 3KJ4B 5CIPB 5ESAA 1U8LA 5ISZE 3GI9L 1KCRH 1FGNL 1MAKA 4IDJH 4PJCB 2VERN 3OR7B 2EO9A 5IB2A 5A2IH 5J6HB 2BFVH 3SKOA 2ED8A 1PLGH 3PV7A 3V0AC 3PQYB 1B4JL 5KW9L 2MQ3A 2RFXB 1G0YR 4U05A 5T5FL 4I3SL 1FFPA 1Q94A 4GRWE 1N7ML 1SJHB 3UTSB 2R1WB 2E7BA 3TPUA 1NCUA 2X89D 2AV1A 4JHAH 3IXAA 1CLYH 1WC7B 3VDCA 3TFKD 4EDWL 3W0WB 1QKZH 2XFXB 3GSXA 4LCWB 1JWMA 2C26A 2AERT 4ZFOB 3IDJB 1F02I 3PGCA 5LJYH 3X11B 5F96H 3ROOA 3X3GH 1W72A 1KCVH 4YDKL 1RU9H 4QHMB 3QA3B 2W59A 4N90E 1FIGH 4WV1C 1S7WA 2NY1B 3IGAA 1RZIB 4XMKL 2BSTA 1U8HA 3CUPA 3KLHC 5F1IA 2X4UB 2I27N 3IAGC 2OZ4L 4F7PA 4TSAL 2X1OA 3FOLA 4TVPD 4OI7A 3FB8A 5IHLB 3QDGA 1UM4L 2GAZA 3V4PL 2G75B 5IB3A 3J8F7 1KJ2L 1P7KB 3UBXB 1M7DB 3JV4B 4F58L 2RHEA 3SDAA 4PJHB 4G8FB 3MOAL 3WXVL 3H9ZA 1GYAA 4MX7A 3PDGA 3VGDA 1OAZH 4JR9H 4MLSA 5D7KD 1FYTB 2OZ4A 5IESL 3CX2A 1TVHA 4IIQB 5DGRA 3BRDA 5E08H 1FG9C 1MCIA 4HIIA 4QRRE 2PW2A 2VYRE 4L8CA 4GRLD 5TFSL 2WP3T 5L2JA 4Y5VB 4OLYH 5C6PB 4PLKD 1CGYA 1CDUA 1B4JH 5KW9H 4LDLB 1HHJB 3EYFA 1YEHH 1B90A 2FWOB 4KPHH 4KQ4L 4WNQB 5FYKU 5T5FH 4I3SH 3I9GL 2XICA 2C1OB 1OARL 1KCUH 3WHE0 5GZND 4HKZA 4UIKL 1N7MH 4L3AA 3P73A 5I1EH 4TRPH 3UP1A 4AH2A 3BZFB 2KH2B 4PS4L 4NZTL 4HBCL 3HMWL 4XNQA 2NY3D 1XGYH 4Y2DD 4O4YL 4ONHA 4CVXA 5IWLA 5CJOL 2MSPA 4HZLA 4Z76B 4YDKH 3MV9A 3MROA 3VE0B 4DUVA 5JMOC 5EU4B 1EUUA 1JGEB 2A9MH 4P2OC 5IROA 4YBQD 4YE4H 3HE6A 2E9BA 4XMKH 3IJHB 3I84A 3BPCA 2WUBL 4GG6F 3AU1A 5L8KB 4CW1B 2E9WA 4HUWA 3RIFF 2BNQA 4P99A 1RIHL 3WS6A 1UM4H 1RJLA 1C5CL 1XGRA 1JTOA 5ISZD 5MERB 1ZWIA 3FO1A 1I3RA 1RK1A 1F3JB 1WCQA 4LVHB 3T2QA 4PLNC 5FCSH 4NQSB 5BW7C 1UWXK 1JE6A 4HJ0D 2E9IA 1B6DA 1MVUA 4Y4HC 2B5IB 1KCLA 5D9SB 4K94L 2AV7B 3DRTA 1ZHBA 5DK3A 5F7EH 3S6CA 3OTTA 2EIDA 1AGEB 5ESAB 1U8LB 3T65B 5J13C 2XY2A 1P7QA 2PYEA 2R0WH 3PG2A 3QFDA 1G7IA 4H8WC 3R8BB 3IF1B 3RU8L 1DUZB 1UFUA 2YN3A 2ADFH 2WBJA 1S5HA 3L6FA 4QRPA 4P9ML 1X5GA 5TH2B 5KG9B 4FXGA 1U58B 3O6FC 3WE6A 4GKSA 4X4YB 5CINL 3VJ6A 3MYJA 2I60L 3KLSA 1GOGA 4Z8FL 1INDH 2XN9A 3VXRA 1EMTH 4DFIA 3IFOA 4PJ7F 5GIRA 4HH8A 4LHUA 4DGVH 5FFLA 3HB3D 3HMWH 4N90D 2ERJC 1OB1A 4Z7UA 3TPUB 5F6IB 4O4YH 5CSBA 5CEYB 3VFNA 5LBSL 2X2YA 4D9LH 4YEEA 3GSXB 1JWMB 2EXYD 4BELD 4K8RH 3F12B 4ZXBB 3PGCB 3DETC 4QCIA 4FTVA 4X9HA 1P4IL 2UWEE 3WIHH 1J1XH 2CKBH 4DEPB 2HJKB 4OQ1A 3S3SA 5F7WC 2WUBH 1X5HA 2ICWB 4FFZH 3NACL 1P84J 3JV5A 3L3IB 3SY0A 2EH8H 1KOAA 3MLRL 2ED9A 4L4VE 4XNXH 4AEHL 2IFFL 4I13B 1DEEB 1C5CH 1MH5B 1INQB 3FOLB 1LWRA 1U2HA 4P46D 3QDGB 2VDLH 5IMOB 4OLXL 5IB3B 3MFFA 4NSKA 2M2DA 2XA8L 4KVCL 2A0LC 3SGKC 2FECI 4XCNA 2D7TH 2F8OA 3LPWA 1GJIA 5FYJL 3X14B 2R2HB 4YPJA 4ALAL 4PY8J 3ARDB 5IMKB 4TTDD 1YPZE 4LGRB 3TT1H 4DN3L 4QEGA 3LEXB 1G9NL 1BQHA 1T22B 1TZIA 2LAAA 4MJ5A 3BAEL 1IARB 4WUUE 1A9EB 2OQJA 4PJXE 1FNFA 1DQQA 3GBNL 4HIIB 2KDGA 5T1KB 2PW2B 3RVTD 1X6NA 4RFOL 2MHAA 3P9WB 4MB5A 4PV8A 5DT1L 3QUXC 1KJ2B 3LS5H 4NT6A 3TPKA 4LLUA 3GIVB 2DLTA 4HJGB 3F58H 3DIFB 4PB0L 4PJBF 3MRDA 2P8PA 3BI9X 4KRMB 5JQ6L 3P73B 1TJGH 1XCQB 4J4PA 5FYKD 2Q86B 5FGCE 1NLBL 2DLGA 1KLFA 2GY5A 5ILTH 3QZWG 2DLFL 3P9LB 4XNQB 5C70A 1AI1L 2A77H 1FBIL 3VXPB 4ONHB 5D5MA 4JG1H 3U0PB 1P4IH 1CDBA 3MRFA 3OAYK 2DTMH 5CD3A 4RA0C 1QFUH 2SEBB 3MV9B 5BQ7A 4KUCF 4YGVB 4JN2B 3MLRH 5IM7B 3EOBB 4FFWD 1CDHA 1IMHC 3AY4A 5DFVC 3BPCB 2NY2C 4AEHH 5J6GB 1AD0B 3N0PB 4OZFA 1MFCL 4N0UE 3AU1B 5LCVL 2IFFH 4ZPTA 3TVMD 5DMYA 5BS0A 4HUWB 4R2GB 4UOJA 5J57B 3IKCA 2FGZA 1RURH 1RAMA 4XPTH 4LLQB 3TCLB 1YY9D 1DQDH 5IJVA 3TBWA 3WDIA 4J12A 4MS8C 1XGRB 4IRJA 1CICB 5I71C 4KVCH 4PJGB 3STZA 1MJ8L 2EKJA 4M4RA 5KVFH 5EU6E 1XZ0B 3EHBC 5DRWA 1YEGL 4MCZA 5IFJA 3VXNA 4V1DD 5FYJH 2W9DH 1CVSC 1FJ1B 3O8XC 3S3PA 4HS6A 1DQJA 4DN3H 1UWXH 2MWCA 3DRTB 3V5DA 1G9NH 2IWGA 4U1IB 3BAEH 3G6JE 1Q0XL 1WV7T 1FC1A 1O5DT 4XP1L 2PO6B 3ELAT 5I16A 2PYEB 5DD3L 5E5MB 3QFDB 1G7IB 2F58H 3TF7C 5DGQA 2BSSA 4X7SH 4QRPB 3BWUC 1RZJL 1MPAH 1TIUA 3WE6B 5EOTA 4GKSB 2DQTH 1R3HA 4PB0H 5F9JB 4PP2B 5KS9E 3VJ6B 5JW5A 3PP4H 4QTHB 4HK0A 3HI5L 5JQ6H 1TETL 4Q9RH 4I48A 5HHME 4DGYL 2OTPA 3S36L 2IQ9L 3AAZA 1FO0L 2A83B 4OLUH 1F3RB 3SDAC 3OBAA 4M62H 2DLFH 4XPAL 4HC1L 5I8EB 1UEYA 4G9FA 4P48A 3T4AA 2BC4A 9CGTA 4L4VD 1MCNA 5KVGL 3T09A 3JUYA 3KPOB 2B4CL 5D2NB 1RJZA 4RDQG 3AUVA 5DC9B 1AKJD 4NGHL 1QR1A 4Q6IB 2EC8A 4DAGH 4GMSL 2UYLB 3S7GA 1CI5A 2DJUA 4FXKB 5C0GA 2FYYA 2ED7A 5J8OA 1AD9B 4ZTOH 1UJTA 4L1DA 4HC1A 1S7SB 1JI2A 1QBLH 5ENWA 2G9HA 3HNSH 3GMRA 5E8EA 1YEGH 2W1NA 3MRCA 4WUUD 3ZDZE 1HIML 4ZNEE 3B9DA 3EYVB 1CF8L 1J88A 1I7RA 3QHZH 5IWLC 1LNUA 1U8JA 5T1LD 3BISA 3LSOA 2W0LA 1I1RA 2GTZB 1CXIA 1TCRB 4RDQF 2CRYA 1KSRA 4WTWA 4G80A 3HE6C 1ZT1A 2ORBL 4NYLA 3FN0L 1BQHB 5B38A 2VZ3A 2OQJB 1YEIL 2HJFB 1BBJB 1YYLH 3OZ9H 4KKBC 2GK0B 1EO7A 3WS6C 5E8NA 1NFDF 5DQJB 3GGWA 2BNRE 1TJHL 4ELMB 3FQNA 4F3FB 4HJJH 3MBXH 4GKZB 3QUYD 1IGYA 1WCBA 1T2JA 4XWOD 2VLLA 4KK6C 5FYLL 2EYRA 1AGFB 1FO0H 1D6VH 1OAXL 2B8OT 1QEWA 4YIQA 1YNKH 1LDPL 1MHPL 5DJZA 2OTUA 3ZE0E 4MA1C 3O6KL 2FD6H 3MRPA 4FZEL 3T1FB 2B4CH 3A67L 3PHSA 5EPMB 3NZHL 4KROB 3JVGC 1KTDA 2ICES 3C5ZB 5CD3B 4HXBL 1WWWX 1E6JL 3I2CL 4I0CC 3VFSA 2WBJC 3OAYH 1BD2A 4PD4K 4WW1A 5EU6D 1I8MA 1LDSA 3IS0X 5ANMA 1VENA 2WWMC 1NMBH 3DV6A 4Z77A 5BS0B 1X6LA 3BN9C 1LK3L 2DBLL 1T7VA 5I73C 3WIIL 3UO1L 4AQOA 1REIA 3G9AB 4K94C 1JZ3A 2LQRA 4PJ8A 3MTRA 4ZSOA 4LL9A 4HFWA 3J7HA 3HG1A 2B1HH 4C57C 1BIIA 5J06A 1PKQB 1UGNA 4PLJC 1F90H 2A6KA 1IEBA 2VL5A 5IFJB 3QXDA 2GHWB 3KJ6L 3UJJH 1SVCP 3D39A 3KS0H 4PBWD 5KVEL 1JGDA 1KN2L 4HS6B 1DBJH 4ZTPL 3MV11 3MCKA 3LAFA 3VFOA 3QCUL 3CX5J 4GSDH 1SJEB 1MCJA 3OB8A 5HHMD 3BQUB 5AZEL 2DLHA 3CXDL 4JFQB 5FOJA 4HW6A 1C7SA 3PWJA 3K4AA 2F53E 2BSSB 5FUOH 4HPYL 4NP4L 3C08L 1P2CA 3NCYP 3B6SA 1DLHB 5FYLH 3CZFA 3CDYA 3KYOA 4HKXA 5JUEL 1AGBB 3UTZA 1KTKE 3DLQR 2GTWA 4I48B 3QUML 3HZMA 1LDPH 1X5ZA 1MHPH 1YQVH 1SEBB 4QLRA 1A9BA 4C83B 4Y4KB 2A6JB 1U2CA 2F5AH 4NQDB 4G9FB 3UC0L 2BC4B 1WBXA 1AIFA 1T7ZA 3QFJB 2APTA 4OZ4A 2X1XR 4DUXA 2CSPA 1E6JH 3I2CH 1RJZB 4HCRH 4MGXA 1IC1A 1D5IL 1OSZB 2FX7L 4HHAA 2B1AL 4NKDA 3WJLA 3Q1SL 2XV6B 3SKJH 5C0GB 4HLZH 5FUZL 5DJYA 4OKDA 3PWVA 5TE6L 3QUMA 2W9EL 4PY8I 3WIIH 4UTAH 1J86A 1FO0B 5IBLC 3BGMB 2OTWA 4S1RL 4UILL 1T1WB 1Z5LA 5BVPL 1FVDB 4YNYB 5IGXH 4J4PC 3ULUC 4U6XB 4H0IA 3TA3D 2DLIA 1XF5B 5E8EB 4G6JL 5DTFA 5I1JH 1FZKB 2FO4B 3RWHA 4IM8A 4HUUB 5KVEH 4LEOB 3MO1B 1U8JB 5DJXA 5BVJB 1F5WA 2P42B 1X5FA 2BNRD 3MGTA 4QRUB 1CDYA 4PJAA 1AE6H 5GGVL 4M5ZH 4HS8L 2NY7L 4G80B 3R8QA 3AY4C 4OZHB 1ZT1B 4NYLB 1PX3A 1GRWA 2NY4D 3KYMA 4BFEA 1FQ9C 3VD5A 5I19H 4NP4H 2DWDB 3LDBB 4APQB 4PR5A 4K3JH 5CD5D 4HK3N 5IKCA 1NAKL 5JIKA 3AMKA 3GO1L 1C1EH 3MXWH 5IMLA 2K9UA 3CFBA 3N50A 4BZ1L 1C12B 1KJ3H 4IRJC 1UXSA 2EC9T 1WCBB 4MNQE 2VLLB 4NHUB 4F7EB 2R29H 2AJ3A 3RA7H 4JFEA 1QEWB 3RVWD 5C92A 2X70B 5IOPB 5T3ZH 3BZEB 4HMEA 4M5YH 4R4NC 4XMPH 5DJZB 2P5EB 4X6FA 3WUZA 4P5TD 5CWSA 2DOCA 2FX9H 3NFPA 5FV2A 2OJZH 1AGDB 1RUMH 3PHQB 3BPNB 3VGFA 1FZJB 1KTDB 4PJDB 3BT2L 3Q1SH 4DKEH 5KZCD 4S1QL 3FFCD 4NM8L 1MUJA 1KNOB 2V7NB 1U3HB 4NO0A 1XCTB 3TJEL 4GS7B 5HYJB 1VFBB 1QSFE 4W68A 3VU2A 1OAYH 5F3BA 5J12C 3T0VA 2DRUA 3TCXA 3DV6B 1CXFA 1CD1B 1VESA 5SWZE 5DHYB 3OWEA 3BZ4B 4PTUA 3NCCB 4X7DC 2YD8A 4G6JH 5FEBA 1F45A 1XIWB 2CRMA 4KRNA 3HG1B 4CU6A 2AXFA 2CR3A 1D5BB 2YN5A 4K7PH 5I1IL 2VL5B 4JN1L 1MJUH 1S7VA 3ES6A 1V7NH 3QXUA 3QXDB 4XNUL 4PRPA 2F53D 1NGYB 3PWLA 4L9LB 4Y2OA 4ZUTB 5H37G 3D39B 1IGCL 1ZANL 3P4LA 2XZAH 1RZJC 2IADA 4RGNB 2Y25A 3C5SA 3MNWB 4Z7UF 5E4IA 1RZFH 3VFOB 3P40A 3CH1B 4U3HA 1TJIH 4Y4FA 1ZHLB 3LS4H 1II4E 5E0QA 3ZYIA 1G6RA 3MV01 4HLJA 2MTPA 1NAMH 5SV4A 1NAKH 3DSFL 3GO1H 1EEYB 2W38A 4DQOH 3CVIL 1EJOL 2PN5A 5B39G 5D1ZA 5BRZA 3FB7A 3WFCL 1S78C 4P3CH 1BF8A 5FK9B 1HN1A 3B6SB 3R1GL 1F4XH 3ULSB 4LLAA 2NNAB 4JM2A 3KYOB 3PIQA 5D7IE 4D0BA 4LAJH 1VKXA 3OKMA 2XWBA 4H1LA 4HIEB 1QRNA 4OLWL 1MHCB 4OSUL 4HG4J 1MCOH 3BPLC 4BKLA 3QWQB 2FJFA 2VXSL 5BOPA 4JY6B 4CN6A 2F19L 3B3IB 1KPVA 1AIFB 1HEZB 3LQAL 1Z0NA 1AXTH 1JF1B 3QIWB 3WV0A 1QPXA 4YK4B 3S4SG 2KZWA 1P7HL 3EJZC 4GW5A 2QL1A 2DQEL 2IF7A 3MLTA 4UDUA 2R8SL 1JJUA 1ORQA 5EFIB 4HH9A 2ADIB 1BWWA 3R4DA 3WUWG 1YEDB 3LOWA 5K59F 3C5JA 3Q6FA 4X9FA 1LP9F 3QJHA 5F8RC 1A6PA 3RWHB 3O3BA 3VI4F 3HS0A 3GBML 1R5IA 3WDHA 1UM6L 1QTYT 3O0RL 2FJHA 3SOBH 5HVFB 3ULUF 1HQ4A 2QSVA 3MRKB 3E8UH 3MLWL 1CT8A 5F9OH 4EI6A 1AP2A 1R5VB 1ZA6A 1TQCB 4MNQD 5D5MF 3BPOB 3UTQB 4N8CL 1ACYL 1MI5E 2H32A 2WIIA 3KWWB 3AS2A 1WGOA 3REVA 1F42A 4LK4A 4PJ8C 2R9HD 3MR9A 2VLRB 5D1XD 4TNVF 5HYEA 3D87B 4XPFL 1X4ZA 5GGTA 1NGWA 1LK2A 5FM4A 2X4PA 2DDQL 4XCFH 2AKRA 4YHKH 1YJDL 2G2RB 3RUGB 2KQMA 4CBPA 4PJEF 3V6FA 3IJYA 2Z9TA 1WBYA 2FBJL 4I1NB 4UIMB 1QSFD 3STLB 1OAKL 3KPNA 1FZOB 4Y7MA 1BF2A 4XVUD 2XOTA 5I1AB 2IGFH 1D5XA 5SWZD 1NAMB 3JZ7A 2HVJA 3LEYL 4Z7VB 3GSUA 2DQEH 2V9TA 4YX2L 1H3VA 5C0FA 2R8SH 1JHKH 1MUJB 5BO1L 5C0BE 1PEWA 3ULVD 1LGVA 3VFUB 5JIPA 1FAIL 2GFBB 4IMKA 1KELH 2ZUSA 1U93A 5CLTA 5F3BB 3MUGB 1AO7E 5CUSL 5HHXH 3RTQD 3KXFD 2XZCL 5DSCB 1UA6L 2JIXB 3T0EB 2DQGL 3ZSSA 3ARFD 3L9RA 3VI3F 1KENL 2AXFB 2NMSA 5CGMA 4HKJB 4N9OB 1UM6H 4PLOB 3O0RH 2WBKA 2R56H 2HTKD 3G5XA 5L2KD 1S7VB 1ZLWK 3ES6B 2D7QA 4E9LA 4KRPD 4NN6C 4YK4C 3RBGA 1U8NA 2YZ1A 5DYOA 4XHJC 4X7TA 5MI0B 3T77B 2GCYA 3WJLC 4BUHA 1UADC 4PJIE 1UQSA 4N8CH 4FABL 1CQKA 1UM5H 1J0JA 2EZ0D 2NY5L 1IQWL 2P5WB 5F3HB 2ICCA 3TZVA 1MWAL 1CD9B 1NEZB 4U1HA 5BRZB 7FABL 1A21A 1DVFB 1QFPA 2BVOB 3RRQA 3QULB 5JLZA 3VFMB 4POZD 2XI9A 3BYYA 3MZTA 2DDQH 1RUQL 5HDBF 1YJDH 4NWTL 1CL7L 3PIQB 1M7IA 5KN5B 3OKMB 2ATKB 4DK6A 4PRHB 1YMHA 2PETA 5SWSE 5HYQA 3HZYA 3QEHB 3CU7A 3B83A 5JORA 3IFNL 2K3TA 5EU3A 2G60L 4C56E 1H8OA 4U1LB 4NQCE 1EO5A 3KPQB 3V7AG 4U49A 3TWCH 1KV3A 1HHHB 1T4KB 3OR6A 3V8CA 1MWAA 1HSBA 3M8OL 2W65B 2X4OA 5AZ2H 4JZJA 2HRPL 4KK8D 4YX2H 2PF6A 2YBRA 4NIKB 3GM8A 5T3XE 4TVPL 3EOAA 5BO1H 4GW5B 4UU9A 4L29A 1IGMH 4XH2B 3MMEB 3BP4A 1CGWA 1KIQA 2PTVA 4D0DB 5KSBA 2V9RA 2A38A 1JGLH 5JPMB 5ACMA 1AR1D 5CUSH 4OZGE 2XZCH 1ORQB 5C07A 2DQGH 3CLEH 4FQ1H 2JJVA 3C5JB 3DARA 1EJ6A 3I75A 1HQRA 4CVUA 4FZ8H 4KTYA 3QJHB 4OGYL 4NN7C 3ARGD 3MOBL 3RX7A 3WKML 2Z91B 5DK2A 1MI5D 3O3BB 3E2HB 3VXUB 4U1NA 2H1PL 1K5NA 4ZS7H 2J8UE 5KSUA 3K2MC 4D8PA 1HQ4B 5FUCC 25C8H 3HR5B 4DVBB 4EI6B 4HSQA 3VGBA 1AP2B 1MNUH 3LIZH 1HE7A 1IQWH 4M43H 5DWUL 2AJXH 2FEEI 4F37F 4K3DL 2KL6A 4JFXA 3L7FA 2WIIB 2CLVB 1CD0A 5C0EA 4YHNB 3BH9A 5HI5D 4RRPG 1CL7H 3MR9B 1G7LA 2YPLD 2AW2A 3O41B 5J3HD 5DC4B 3IFNH 2G60H 1QFWL 2A6DB 3EDJA 1TZGH 2AEQL 4YDIL 3BD3A 2VDQH 5C0BD 4XNMA 3PWNA 4M8QB 4I77L 3KPNB 4Y4FC 3QEQE 1AO7D 4LP4A 2FZ3A 3NCMA 1CQYA 1FRGH 2J8HA 4YHZH 3PGFH 1R3LB 1RZ8A 4FQCL 2FRGP 3WD5H 3GSUB 1Q9WA 3U30C 1QBMH 1QSEB 2HFFA 5D1ZC 2Q7YB 3UYRL 4FQHB 4I0KA 4U1KA 4IJ3B 1J0ZA 5CAYB 5GRJL 2GJ6A 3DGCR 3MXVL 2Z31D 3JXAA 5IBUG 1U93B 4JM2C 3MCG1 3UPRB 4TOYH 3WL9A 2V6HA 3BZDA 1MCFA 4EOWL 4X4MA 1QP1A 3VMOA 2FNBA 3K74B 3L9RB 4JFYB 4O9HH 1FNSH 4MA7H 3QPQC 4Y0GA 3NFSH 5EO9B 3EDKA 4GUPA 3O2WH 3KYNB 4JY4A 3G5XB 1E4XL 3UDWA 4G3YL 5DRNB 3P11L 1ZS8A 3QT2A 4AIOA 3PHOB 4NNXA 4Y1AB 4C58B 2VIRA 1ZLWH 5D71L 5C71A 3S88H 3W11D 1P4LA 4YAQA 1MAML 3WXWH 5SWSD 4LF3B 2Y5TA 1CE1L 2FL5A 1NPUA 4M1GH 3HZVA 4OLZH 4C56D 4NNYA 2FSEA 4MNGE 2R1XB 3CFEB 4NQCD 4PRDA 4GAGH 5CZVL 5JHLL 3MV8A 3VDBA 1V3LA 5JLZB 1EK3A 5BMFH 1CK0L 4H5SA 4X5XA 3TJHC 4UBDC 4ZAKA 5IQ7H 1OD9A 1QFWH 4L3EB 4Y5YA 4YC2B 2CDGA 5HJ3A 3SDCD 5T3XD 3H9YA 4ODXB 4OAWA 1OQOA 3HZYB 4K2UH 5EU3B 2VRAA 2P49B 4I77H 1OTUD 1RJCA 2CDEA 1YNLL 3VXME 2DIBA 2PW1B 5FXCH 1MWAB 4CNIA 2W0PA 3X13A 4JZJB 1DFBL 1U3YA 4QHUA 5DO2C 3LKOB 4JJ5A 1PD6A 1QVOA 4NJAL 3MXVH 2IPKB 1FZMB 4PJAF 3QO1A 3QR2A 3BP4B 4ZFGL 3VFPA 3RZCC 4ORZC 1DUYB 5I74B 3T8XA 3NPSB 4KDWA 1NCBL 3HRZB 4GQ9H 5FGRA 5GJTL 1MFNA 2A73B 1A1MA 3QWRA 3RNQA 5MENE 1J10A 3I75B 5F93C 4EN3A 3BP7B 4HWBL 5D2LA 1MQ8A 3DMMD 3ZT6A 2WK2A 3VGGA 2GT9B 5DK2B 2VSDA 4XXCA 5DMIH 4P59H 3QWOA 2CUHA 4U1NB 2PXYD 1XFPA 4LARL 4LOUC 2YWYA 1D5ZB 2DQFB 5IG7A 4TUOA 1TMCB 4IMKC 5IVNA 1I3GL 3VFGH 4OZIA 2NX5E 3L7FB 5GRVL 5FYKL 2AJSL 4HWBA 2Y1VA 1ZK9A 3AXLA 4J23A 4IEFB 4X6DB 3MNVB 3O2DH 2HYMA 3OSKA 3NIDF 4G6AC 4QRQB 3QEQD 1KTLA 3EYSH 2NZ9C 3TT3L 1NBYB 1QQDA 3QEUB 1N8ZB 1OGAE 2ESVE 2J6EH 1KBGH 1Z3GH 4GRLB 4M6NH 4HXAL 4I2XB 5CHNB 4UV4L 3F6LA 4P5KA 3ARWA 4OIAA 4GG6E 1EGJH 5KVDL 4AIZA 4P2RE 5J0BA 4GBXB 4N5UA 4N0CD 3PWNB 2NCMA 1D9KA 1VFOA 5HYSG 4I18A 3U1SH 5EO1A 2EO1A 1BFSA 4PJ5D 1CBVH 4NO3B 3PNWA 2NW3A 2BHYA 1QNZH 3FRPA 3TZVC 2NY3B 4Y2DB 4HX1B 4IS6B 3U4BL 3GIZL 4JAMA 1SYVA 5GJTH 4MD0A 1MFBL 2V7HA 4JCMA 4JHWL 4MD4B 4LHJB 2JB6A 4X98B 1YN7A 3MV7A 1GGIL 1IAOB 2X4TB 5K9KA 1ZA3B 1HZHH 1X3DA 1SBSH 5TQ0L 3IT8D 1SBBA 4PJFF 5FKAA 1KGCE 2VSCA 4X5WA 4JM2F 4QOKE 1FH5H 4AEIL 1R3JB 3JTSA 3ZT5A 1E0OB 4JZJC 5ISZB 1R5WA 4RWYL 4PJ7E 3RPKA 5C09E 4CKVX 1SJXA 1H5BA 4V1DA 5I1CL 4MA8H 5AYUL 1G9MC 5FDWA 4R3SB 2Y5TB 2AJSH 3BGAA 1EHLL 4L3CA 4U6HA 2ZOLA 4J1UA 3VW3H 2IPTL 1C5DB 4PRDB 1IAKA 1J0IA 4S1DC 3TT3H 1PAMA 3VXMD 4AMKH 4B41A 5IVZA 1S7RA 3MPCA 1FV1A 1X7QA 4X5XB 2ZG3A 4BQ9A 3ILQD 4GRWB 3BHBA 3OX8B 4Y16A 1WWAX 2CDGB 4TSCL 1HYSD 1AHWB 3GKZA 1CFTB 2D7OA 3QG6B 3QHFH 3N1MC 3F7YB 4MAUL 4JDVA 1F4YL 5DUPH 1RZKL 2CDEB 3WLWD 5CILL 4UT6L 3BP5B 2AGJL 2FLRT 1XF4A 1MREL 5HGHB 1MHHA 3X13B 3DV4B 3H42H 3QNYB 5MEND 4KGLA 1Z9OA 3PABB 4JJ5B 1QVOB 2NY6D 4LHQB 3O6ML 2ZCLL 3QO1B 1LO0L 3SKMA 1BX2B 4G7VH 3RI5F 4HWUA 2RCSL 4P57A 4J3UA 3VFPB 1AKJA 1Q9OB 2FEDC 4P2QE 2AEWA 3QRGH 4AT6B 5HI4D 3SGEI 3P4OA 4WW2A 4PLKC 3MLYL 3OKDA 2KZ1B 5TQ0H 4GJTB 4WGVB 1PQZA 4LIQL 3RVUC 1CFNA 4R8WL 3OGCB 2CK0H 5D2LB 3GSRB 1A1NA 4J2XA 4S2SA 2ITCB 2NX5D 2XTJC 3H7BB 2Q6WB 1TITA 4P46B 4Z7WA 1JCKA 2Z0BA 5IBTL 5I1KH 1NH6A 1QFOA 4IOFD 5TE7L 5I1CH 1YEEL 1V5JA 4QRRB 5AYUH 2C3VA 1FORH 3N85L 2ESVD 1OGAD 4IRZL 1U0QA 3U4EA 4OGAD 4CVWA 2NXZC 4Z0XA 4LDEB 3FMGH 4ACPA 4P23D 43CAA 4P2RD 2CMRL 4OV6F 3AREA 2V5RA 4P4KD 3QJFA 2HTLD 3ZKQD 3QEGL 4R7NA 1ZOXA 2IAMA 1XF1A 1P6AB 4NO2B 3U9PL 2ZCHL 4XBPB 4M1DL 1FL5A 3G9VA 4FFYL 4O2FA 4U1SA 3WN5A 1F11A 3UDWC 4AIZB 1UJ3A 2HT3D 3QUYA 1ZLVK 3DNKA 1T20B 1VACB 2BDNL 4MWFB 1BMGA 1DN0A 4ZDHB 2GJJA 3TN0A 4OCXL 4ETYA 3P0GB 1JYVA 1IC7H 2VWEC 2VXTH 3PNWB 4KGJA 1AH1A 4D0CA 2FJGA 5F72S 3H6JA 4HMDA 1I1YA 2ZCLH 2RGSA 3SJVE 4NKMA 3AS1A 1DANU 4G8GE 1S7XA 3IDIA 4XWGL 1SM3L 4JAMB 1WTGT 2IJ0C 4WFHD 4QOKD 3VFTA 1EO8L 1FL3B 3QXWA 3L5XH 4WTZA 4ZAKC 4Y5YC 2O26U 1JZ4A 3MLYH 1A6ZB 2XKUA 5D93C 4NWUH 2JB6B 4LCWE 4D3CL 1KCSH 3PV6B 4XXDA 4OGXH 5EZIH 5C09D 2AVGA 2DQIH 4FS0A 3TV3L 3TVMB 4YHPB 3VD4A 2ZCKL 1CDIA 4RAUA 1KC5H 4CDGC 3WKNA 5FM5O 3JUZA 4LGSB 3MC0A 3GHBL 3EYUH 3NCEB 4NNPL 4NUJB 5DFTA 1IL1B 1PGRB 1IAIH 4MNHA 5HGGS 3K2UH 1L7IL 1H5BB 5F7KC 4MJ4A 1FCGA 3O9WA 4V1DB 5CMAA 1Q0YL 1N59B 3WO4B 3RQ3A 4U3XA 3PF2A 3RJDA 4U6HB 1MJJB 1FSKC 3QEGH 5J1AB 5DEFA 2V2WA 4LFHG 1IAKB 4LVEA 2D03H 2DYPD 3QXTA 5KSBF 3U9PH 4EN3C 1MIEL 2ZCHH 4M1DH 4FFYH 2FR4B 4JFDA 4WU5A 3RX8A 3FN9A 4XCCH 3KLHD 4XXCC 3HC0A 2BDNH 2VISB 4OCXH 3MRNB 1FN4A 5E99H 3G5YA 4NCC2 4JE4B 4MXQC 5DZLA 2UWEB 4P2QD 1P53A 3BKCH 3MUY1 4YXLH 4WWKC 5EZOH 2R2BA 1DBMH 2LAGB 1T0PB 4XVJL 4X0KA 2VABB 2J5LC 4HUXA 4TTDC 4L4VB 3F5WA 1DL7H 4JREB 1HYRC 3VXTA 1LO2L 2GI7A 1JIBA 2VXQL 5C0AD 4A2MA 3SKMB 1A6WH 4GLRI 3N1QC 2BVTA 1SJVA 4ZUWA 1DQLH 3SKUD 5EOQL 3SO5A 2YPKB 1NLDH 5DVMA 1XAUA 4MQ7A 3QAZB 1HI6B 4WW2B 5I76A 1GSMA 1W0VB 5DJ8B 1NDGA 2DAVA 2IQAA 4ODSH 1D9KC 1A6VL 2VB5A 3QDJA 4I18C 1T0NB 1JF5A 1NFDE 4ONFL 4BSVB 4P3WA 1NCAL 4JG0L 3C09B 1ULVA 3TA3A 1ZEAL 1NBZB 1RFDH 3BIKA 4WUKH 5LG1A 4K9EC 4WUUB 4PJXB 2V17H 3OXSA 2I5YH 4KUCD 2PTUA 2HRLA 4OD2B 5F7LB 1Q1JL 5T1LB 5HVHB 4Z0XB 2K1MA 5AWNL 4JVPA 4N0FB 2CXGA 3LKSB 15C8L 4YHIA 1NMCC 3HKFA 5C9KA 3GRWH 1HH6A 2V5TA 5AG8A 4P2OD 3P0VH 1Q9LA 5IV2B 3MRJB 2ZG2A 4XPBL 2K7QA 4S11A 4JPIB 5FGCB 4BZ2L 4PP1C 2V2XA 1I3UA 3IXTA 4F8QA 4EJ1C 1YY9C 1RHHA 4OUOA 3HAEA 4PYHA 4O2FB 1ONQB 2WQ8A 2YA0A 4JQIH 1HHGA 3JV0A 1ZKAA 4X4XB 4ZO6A 4F9PA 5GISH 3VXOB 3QUYB 2AQ2A 2DM2A 4RFEB 3LN4B 3SDDA 3GK8L 1HHKA 5EC1A 3T4YA 1ZLVH 2EH7L 4TNWF 2CLRB 1A7PL 4LAQH 4D0CB 2FJGB 1U8KB 2D0GA 5F7UA 4MQXD 4Y4HD 4N0UB 5JTWA 4P5TA 1P5VA 5C7XL 3PL6D 4PBVC 4KTEL 1KTRL 4N0YL 4QRTB 1M05B 1GC1L 5ICZA 4P9HH 4WJ5B 4WEBH 4GFTB 5EOCL 3GUTB 1NFKA 3FFCA 4Y16C 3I02A 1WBZB 5HDLA 5EU6B 4DZ8B 4DW2L 4FMFA 4MJIE 4FQJL 4XXDB 2B39A 3VMPA 5EUKA 3O6FD 1ZVYA 5FHAL 1S9XA 5J11B 3GSVA 1UENA 1I1AD 3L3OA 3INUL 1C16A 2IANA 3K8MA 2EIZA 3HE7A 5LWYL 1UH3A 2BOCB 2P7TA 3LEVL 4MD5A 3CSGA 3NCJL 3WNLA 2AEIT 5AWNH 1IGTA 4JEGB 2C3HA 3QDGE 5CEZL 1BIHA 5C0CA 1WFTA 2BP3A 4NDMA 1IT9H 3RKPA 3P77A 5DR5L 3DETD 5E2VL 5KS9B 3GJEB 5B4MD 1RZKC 4TPRL 2V2WB 4YO0B 5T33L 1FCCA 3QUZA 4EDXB 4XPBH 4M00A 2OXGA 5HHMB 1K2DA 1JYXA 1EEQA 3HA0A 3O11A 1ODAA 4IHOB 1LO3H 3QDHA 5JNYA 1JNLH 1G7QA 4FNLH 2OJEA 5D70L 1BGXL 1I7TA 1MIML 3BKJL 3G5YB 5F7FA 1IQDA 2IBGA 3QUKA 2Z4QA 1J8KA 1A3LH 3FT2B 4O58H 2A0LD 4J6RH 1C8PA 3O6LL 4F80A 2R39A 1G7JA 1OAUL 3AREC 4JGMA 2XQYK 1ES0A 1YEKL 1GCFA 3NH7L 5EO0A 3FRPG 2IAMC 3U0TA 5M94B 4CMHC 4Z7NF 4OZIF 4G8IB 4FQJH 2X4RA 3WN5C 5F1OB 1ADQH 1UJ3C 2R69L 2WQRA 3N1PC 3QUXD 3RWCB 2AJVL 2ZSVA 4G9DA 1Y18A 2QJDA 3KR3H 3TN0C 1OLZA 2OP4L 2R15A 4XBEH 3TYGH 2AK4A 1E28B 4RMQA 3I3DA 1QHOA 2JELH 4MVBC 3FHQA 2BNQE 2VE6A 5GGUB 4S0TD 1NEUA 5I8KH 1U91A 3ARSA 4M93C 4H25A 3EAKA 3S3JA 1DJSA 4KTDL 1JZ6A 2VXVH 2B20A 5SWQA 2A9NL 2BNRB 1EUTA 2WMPA 4XGZA 2KQNA 3HZKB 4HWZA 4YHIB 5T33H 2H26B 4YGAB 1VA9A 1P1ZA 4BSJA 4MNQA 1KXVC 3VRLF 2NY4B 3VH8A 2V5SA 1DR9A 5CS7A 5DFVD 1A6TB 2NY2D 3PGDB 4YWGL 1XR8A 4LVNC 4OT1L 4IMLA 3IXTB 1S7TB 1RHHB 2ADGB 3X3FH 3R06B 3S8WA 2PYEE 4K3GA 1BGXH 2QQNH 5CCKL 1NGQH 4PTTA 3ULVL 1TNNA 4MS8D 1QO3B 1H15A 1HHKB 5GGQL 2X9YA 4QRPE 3S9DB 3OKLB 5FO7B 4NPYB 5EC1B 3T4YB 3O6LH 4H0HB 3O9WC 3EHBD 1NANH 4QXUH 4HIHB 1MQKH 1VEOA 3M1BA 4MJID 1ZT7B 3LRGA 3O8XD 2XN9E 5SX4H 3VXRE 1YEKH 2VITB 4ZPVB 1GZPB 1IGFL 1J8HD 4P5TB 5DVLA 3VGAB 4YEFA 4DFHA 3C8HA 1VPOH 5D7SH 4MAYB 4POUB 4Z7UE 5KZCB 4EQ3A 3B5HA 1A6UH 4G7YH 3FFCB 4F7MA 4U6VL 1EBAA 5EBMA 2NTSP 1T83C 2QQKH 3D18B 1ED3A 4FTVE 2H2SC 3KXFA 5KSAD 1T0MA 1LMKA 1VADA 4I4WA 4Q2ZA 4QHNA 3NTCL 3ARFA 2XNAA 3L3OB 3Q3GB 3LKNA 4G6ML 1T2QH 4JQVA 4HT1H 3SDAD 5IB4A 4PRIA 4NJ9H 3NN8B 2YS4A 3MODH 1VCAA 5L2KA 2BVEA 2A1WH 1ZVSB 1A47A 5DRZA 1JL8A 2F53B 3OJDB 3T3PF 3WYRA 1EVUA 4AL8L 5I9QC 4KWUA 4NDMB 4W6YB 1P4BH 4TULL 4G6FB 3GJFK 2Y72A 2XWJA 4QT5A 1F6AA 4B7IA 2O5YH 4U1GB 3V52L 2B7DT 4JB9L 3F7VB 5ADPH 4M6MH 4LBEB 1UCTA 4LKXB 3GMLB 5CCKH 2NXYB 3TA3C 4NQUA 5DA0B 2R1YA 4HGMA 4G42B 4HAFA 3UJIL 3UYOD 5K59E 1I7TB 3QDMD 1IQDB 2Z4QB 1MHEA 2WINA 2RIKA 4HGKC 1CGSL 3N9GL 1A4JA 2EDHA 3ZMRA 2HT4C 3U46A 4Z7WF 4LSTH 3VI4E 1RUAL 1J05A 1CGXA 4C4KO 3OKNB 2C4FU 4QXTA 2W0FA 3HE6D 3AROA 3QCVL 4U6VH 5CD5C 3QNZB 3LN5B 3GMNB 5D5ME 2BNQD 1A5FL 1IEAB 4KKBD 4F9PC 1ZSDB 1MCHA 1HINL 2DIAA 4WTZG 2VJXA 1YYMH 4DKAA 5MEOA 2PR4L 3HN3A 4XNZC 3SDDC 3NTCH 2BSRB 1L7TH 1HHIA 4EBQH 5JW4Q 3KPRD 1FLRL 4KK6D 5DJ2A 5IHZB 3P9MB 1NGXA 2OI9C 5BS0E 3ARGA 4DK3A 1F4HA 3HC3L 3EKCA 5CEXA 1D6EA 4P5TC 2XRAH 3VGHA 5FB8A 3IAQA 1U91B 3HHRB 1PX4A 2CLZA 2V5MA 4NC0B 2BY3A 3RHWF 5SWQB 2VC2L 5CJXA 1LO4L 4ELKB 5I30H 4JDTL 1T7WA 5C9JB 3ZYJA 4M7JL 4XCEA 4FP8L 5E1HB 5LGHL 4WY7H 4MNQB 2WBJD 4ODHL 1BAFL 6FABL 1ORSA 3WMSA 1T21A 4MMXC 4ZYKA 1MEXL 5GXBB 3ALXA 4IMLB 2WWMD 2W07A 3BN9D 2XN9D 5DA4A 3VXRD 5D72H 3UEZA 5D1XB 2YPLA 4NOBA 4OCSH 3HE7C 5HHNA 4GOSA 2VDKL 2O93L 1I8IA 5EOCJ 1H15B 1TTFA 1YA5A 3DXAD 3KG5A 1UVQB 2Z93B 2MCG1 3VI3E 2DQHL 1W0WA 4Z95L 4PLJD 3FCTB 4GW1A 1F4AA 4RFNB 1FAKT 3M1BB 4XP6L 1QSFB 1I8KB 3HNTH 4B7LA 3RGVD 1J87A 4FTVD 2YZ8A 3KPPB 5SWZB 3QUZC 1R24B 4KK9C 4JANB 1FG2A 3C6LB 4U33A 4G9FE 4XRCA 1HNFA 3LMJL 4MZ2A 3MQIA 4E42A 4MYWB 2ZOKA 4RSVA 1G6VK 3SO3C 1LE9B 4OM0L 1NGPL 2QLVB 3JV6A 3RTQB 3KXFB 1QSZA 35C8H 4KHXL 1HXMA 3B2VH 3FQXB 3CVHH 4ENED 4QHNB 4YXHL 3ARFB 5HDBE 3WFEL 2WUCH 4OFPA 1MCCA 1JPTH 3RDTA 5DUML 3D85D 1MLCA 2J4WL 2X1PA 4LSSH 3LV3A 5EORL 5TGBA 3RNKA 2EDYA 3REWA 4YPGA 2XIDA 2VC2H 3VXQB 4KRPB 1FFQA 1J1PL 5F44A 4S1SL 2BCKB 1JPSH 3U36A 5T3XL 3B4NA 3SE8H 1JI1A 4PRNA 4M7JH 2JB5L 4M7ZC 3SE4C 5A40E 1IGJA 5ERWB 1NJ9A 1OF2B 3UTTD 1QYGH 2HLFC 1BAFH 4XBGA 5D7IB 4DKFH 4AENA 2M26A 1OPGH 5DD6A 4XX1E 4LCIL 2DTSA 3GJFH 2CJUH 4NQCA 4I5BA 2GKIA 4MA3B 2WBWB 1B0WA 1KLUA 1BZ7A 3ARPA 4HWNA 3ULUD 3MACH 3U0WH 1BBDH 3SDCA 5IHUL 3QQNA 4RA3A 3HAEG 1MHEB 2WINB 1GHFL 1OVZA 4KAQL 1A4JB 3U46B 4QHLB 2VAAB 3ZE2F 5FGBA 2Q8BH 1BPVA 2XKNB 1J05B 2MMXA 3SDXA 2V5YA 3BW9A 5BZWB 3S35L 3GHEH 4HLZG 2OS7A 3WFHB 5T1MA 1NGPH 3B9VA 4HZAA 2R9HC 2EC9U 1ND0B 3BJLA 3O4LD 3DVGB 1LD9A 3KLAA 4GAJL 3MJ6A 8CGTA 3HC4L 1JPGA 3TO4B 5MEOB 2JJSA 3DX6A 2HT2C 4IRJD 3BDBA 4S10A 5J4MA 1BD2E 1D5MA 1T5XA 2DJSA 1NBVL 1HH9A 3WEXA 3LKPA 4UAOB 2GJZA 5DJ2B 4KKLD 5ANME 4Q0XL 2BY2A 2I9LA 5EORH 3ARGB 5GHWH 5I1DA 1F4WL 3ARBA 1XR9A 4X6EA 4PG9B 4R4ND 1MI5B 4S1SH 5T3XH 3OKOB 3T0DA 1TQBB 5D96B 4QY8A 4ZSOE 2UZIL 1R0AL 2Y9RT 3HG1E 3L3HB 3Q2CA 4RCAA 4I0PA 4CJ1A 3NA4A 4D9QE 4XCEB 1PYWA 2H6PA 2DWEB 3BP6B 5DJ6B 3D39E 1CE6B 1KCKA 1XGPB 4JZNA 1T21B 4LLMB 1EERB 2EICA 3P4MA 1MJ7H 3KPTA 3CVHB 2CIIA 5HD8D 5AUMB 2X4QB 1PZ5A 2X1QA 2JE8A 3MA7A 2YK1L 3KPMA 2ADJB 2A74B 1EEZA 2YPLB 1PY9A 4JQVC 1CR9L 4WU7A 4AM0B 2MQ0A 5DJCA 3V0WH 3VD7A 2HTKC 5BV7L 4KRPC 3QNXB 4WEMB 1W0WB 4L5FL 4HDIB 3QI9A 5E94B 2G5RA 3SPVA 3QIBA 5C0BB 2J1KA 1L0QA 3VXSA 5HVGB 4BFIB 4K71C 4FQXB 3I85A 4MDJA 2VQ1A 1AO7B 4PJ5A 1ZHKA 3GJFB 5CBEA 3KNBB 1RZ7L 3U7YL 4YDVB 5GRZA 1NGZA 5IVXF 3RWFA 2EDXA 3HMXL 4E42B 1TZHA 2EDOA 2Z31B 1S78D 2P4AB 2EIBA 1J7VR 2AI0L 2PTTB 3OF6A 4Y8DC 1VFAB 5TF1L 5KOVC 3QQ4B 2ZKHH 1DSFH 1HXMB 4Z5RA 1K6QH 2LVEA 1F4WH 4PJIB 2V2TB 5MEPB 3OPZL 4BQBA 3CNKA 1MLCB 3STBA 1GGCL 1DBKH 1ZT4B 2BVPA 1G7MA 3RNKB 1R0AH 5EC2A 4JPWL 1S3KH 4KK8C 4GXVH 5CJQH 3HMXA 3BO8A 4PJ9D 4YHYC 1JNHA 1NJ9B 1L4IA 3O4OC 2CIKA 5C6TH 4RISL 1A4KA 4R97C 3TO2A 1N64L 5SWSB 4E41D 1XGTB 2YEZB 1I4FB 2FB4L 4PJAE 4UNTA 4C56B 2DI7A 4R26L 5A16B 4TTGA 4NQCB 5F9AC 1E4KA 3VH8G 4NQXA 1MCEA 1N5YH 1Q9KA 2CH8A 5IFHH 4MJ2A 4JZOA 4OIBA 3SDCB 3RGHA 4LLVB 1RD6A 4K3HA 2O5XL 4EUPA 4QF1B 2VDPH 4Y88A 2P24B 2WAHA 3EO9L 5T1DL 4OZGB 1N0XH 1JFQH 4G6KL 4NO5B 3SDXB 4D9RD 1O7SA 3U7YH 2FECL 3LB6D 3BW9B 4JFEE 1BD2D 3RY4A 1AC0A 3DO7B 1OAQL 2VNCA 4FQQB 2X10A 2AI0H 1NEZG 5GRUL 3BDYL 1A7RL 3ARVA 3EO1A 4KUZH 3RKDD 2ZUQC 1U36A 3FRUA 5L8JB 2DL2A 5FUCE 1LO5A 4PJ8D 3DX6B 3TIEA 3MRIA 1A0QH 1E4WL 3NIDE 1CDJA 4OFYA 4M6OH 1MF2L 3LKPB 4RAVB 2GJZB 3O2VH 4D9QD 3OPZH 5DMJB 3ZSTA 1UCBH 2ICEB 3CPLA 3DMMB 2I9LB 3HPJA 5D6CA 1N2RB 4NBYB 3RPIA 5HPOA 3BD5A 1XR9B 4X6CF 4RMSA 2NX5A 2Q1EA 5L88L 2CUIA 2Y6SD 2OR7A 2YR3A 1H3PH 4QY8B 2PXYB 3FT3A 1WISA 3FT4A 4UV7L 5E2UH 1V05A 3WCYA 3KPLB 3KDMB 1OGAA 2HFGH 3OKKB 1I85A 4PPTA 2F15A 4OTXH 2OBGA 3C6SB 4F7TA 1AC6A 4PRPE 4O02L 2AK1L 3CFJB 4ZUUB 2YD1A 5DMKA 3V5KB 3RWDB 4P23A 1KB9K 2ZG1A 2X7LB 3RL2B 5L0QB 3I3EA 2HKHH 4P4KA 5JIIA 1T3FB 5FCUH 4DWHA 3B8YA 1PZ5B 4PRAB 4LSUH 4YUEL 2KPNA 5L7XL 5LQBL 4KVNH 4M1CC 4WHTB 3QEQB 1A7QL 2VR4A 4MDIB 3RDTC 1UZ8B 4WU7B 2MPAL 4OV5B 1C7TA 3MRMB 1MCWW 4TSBL 3HLAA 3MLPA 1JNNH 3EO9H 3SPVB 3SHSA 2DI8A 2BVQB 2CDFA 1WTLA 2FDBP 4JFZH 4JLRA 5E24E 3TNMB 1QRNE 4XHJD 1I7UA 4YLQT 3GMPA 1WZ1L 4I3RL 4L8DB 2EIEA 3NABH 1MFEL 4DJMA 1A7RH 1U95B 3RWFB 3CDGA 1TZHB 3MRHA 2I07A 4RQQB 5HHVH 3MLXH 3V5HA 2H3NA 1E4WH 3AS3A 2YMXL 3S5LA 5E6IC 3SDCC 1MF2H 1RMFH 4L8BA 1AFVH 4RGMB 1K4DA 3DGGA 1EX0A 4CGTA 1ZLUK 1OTUC 5H94A 3FQWB 5FGBC 1OCWL 5IW6B 1ITCA 1G7MB 5GRYA 5EC2B 2CR6A 4MNGB 5D1QA 1OM3H 1S5IH 4WFED 3K1KC 4NKIH 3BUTA 3E1F1 2YUXA 3O3DB 3CZJA 3KHQA 5C2BH 3ILPB 3DUHA 2CO7B 1RJYA 2O61A 3TO2B 2M1KA 1Y0LA 3TBTB 3WIFA 1WIUA 4FN0A 4Z18A 2JJSC 4OIIL 2XWTA 5LGJA 5ESVB 2D31A 4TUJA 3VXMB 5FM5M 1KLGB 3NAAH 1JGVH 1CZ8H 1I9RH 5DHXB 3WO3B 1Q9KB 4KFZC 3ARBC 1J5OL 2YXFA 4GMTH 2OK0H 3DROA 4KXZI 3LD8B 2L7UA 5EULV 3K80A 3ZTNL 1T7XA 3FONA 2YRPA 4I0PC 2AJUH 3O81A 5DD1H 4JKPL 1JWUA 2X9WA 4LRNL 4BQ8A 1GGBL 4NO0D 4NQTA 5MENB 3JWOH 4ISVA 1XF2B 3LPGA 4F15B 2AXGB 4WI3A 2NY6B 2N7AA 2IBBA 3BJ91 1FYHB 3ZLQC 5C0AA 4JO4L 5K93A 4LVOB 4O5LH 2R4SH 5FECB 3SQOL 2QADD 3IDMB 4PJBA 4W70A 3HNVH 4OBRA 3NCBB 5LXGL 1BJ1J 1P84K 3MZGB 3QISA 2C5DC 3QI9C 1YDPA 3QIBC 3CPLB 4QRSB 4PRPD 2OM5A 2NQCA 1RIUH 5D6CB 3H9HA 3F8UB 32C2A 4XVTL 2NX5B 5I15L 3MUZ1 4KQ3L 5C0JA 4WFGE 4Y4FD 1FL6B 4JRXD 1KYOJ 1ZMYA 3FT3B 4YR6A 3GDBA 4R0LB 2AJYL 2P8LA 2ESVB 1OGAB 4NQVA 4F7TB 5D1ZD 4MCYA 1P69B 5BV7C 4GG6B 4P23B 5C0IA 3QCTL 3KLDA 3HCVA 1KUMA 1YNTA 4P2RB 3WHXA 3C60D 3QH3B 4Q9QH 1INEH 4BSWA 4P2OA 1I7ZA 4OD1H 4Y19D 1QRND 3C2AL 1C5BL 3P0YH 2H2PC 4QTIL 3BGFC 1FE8L 1HOCA 5GQBA 4NQEA 3G5VA 1I9JH 4JKPH 4KJYB 4A6YL 1IE5A 3U79A 4LRNH 3WNMA 3BEVA 1GGBH 4EVNB 5ETUB 2DMBA 1MCPH 2P8MB 2AQ1A 3MJ9H 5GS1B 1Z2KA 1ZTXL 3I6GA 3U2SB 5E4EB 3PL6A 1SY6L 8FABA 3EGSA 4HMCA 1I8LA 1CFSA 4KY1L 2X1WL 4QOKB 4F7CA 1JHLL 5CIPH 5B8CA 3MOQA 1Q72H 3V5HB 2H3NB 5TF0A 4C59B 4X8JA 5DHVA 5F89B 3MLVL 5EZLA 3RIAK 3TJHD 2A6IA 3TGXA 5A2FA 3Q48A 4PJ7B 2ZUWA 5KSBE 1B6UA 3QIUC 5C09B 3ISWA 2NTFB 3DGGB 2R0KL 2VN7A 3MYZA 1AY1L 2BJML 1PY4A 3K8LA 1NUFA 2Q76A 5C07E 1OHQA 2DLEA 5FA4A 2LU4A 4LCYB 1I1AA 1RULL 1EA9C 1SY6A 1YEJH 1GPOL 4UZGA 2Z35A 3QPXL 2AJZB 1BP3B 3IJSA 4TVPE 5DO2D 5K33A 4L4TA 5INDA 1IM9A 3E6FA 1AXSB 1WT5C 3EW3B 5C0RL 1S9YA 5HGAA 5IR1A 3RZCD 2B2XL 3LKQA 4ODVL 4G5ZL 5F7DA 5JPNB 2DYPB 5HHQA 4WV1B 4XC3L 4JFPA 1BOGB 3RY6A 2Z8WC 4ODWA 4OFDA 4AK1A 3FAWA 4RGOH 2PCPA 5JO5B 4H8WH 1UB6A 1OTTC 3DROB 5BOZG 1N3NA 2JK5A 4GW4A 4A6YH 3WNKA 1MCBA 4P2YA 4MMZC 4IOFC 2RQ8A 2R23B 3GBLA 5FOBA 1A2YA 1WITA 4ONGL 4PGEA 4LOUD 4P2QB 1I85C 4PGBB 2MOVA 4IOIA 2J8OA 1NCWL 2IH3B 2X42A 3DWTA 1VGKA 3ORJA 2VXUL 3GMOB 1K8DB 4ISVB 2FX8L 3Q0HA 5HDQH 1S7UA 3S96B 4P4KC 2MKWA 3W82A 4KY1H 1MFAH 4TYUA 5C0AB 4AG4L 3R0NA 2XTJE 3NOIA 5FO9B 5HPMB 2OXHA 3H9SE 5L9DL 2ZUXA 5GS0L 1WVZA 4G6AD 5A1AA 4WFGD 2NZ9D 5AEAA 4PJBB 2R0KH 1DP0A 2GJ6E 3P4NA 1KEGL 4WCYH 1AY1H 2HT3C 3T04D 1YDPB 2E7CA 5ALBL 4RWHA 5IEKA 2PYFA 1GAFL 1MRDH 1RULH 1NBQA 1S9WA 2E5EA 4UTBL 4ZUSA 2O5ZH 3GSOB 4U1JB 3S97C 4X4ME 3OAZK 1PG7L 1J1OL 2ZJSL 2P8LB 1F58H 3TZVD 3BKYH 5HY9A 2FH8A 2HAZA 3DUSA 1VFMA 2DQDL 3IDXL 1GZQB 2YC1B 4DVRH 1CGUA 4MCYB 1BZ9B 3RWGA 3OB0K 5DXWA 3GI8L 4R4BB 1GIGL 1DANT 3I6KB 3GMQA 1T1ZA 1SEQH 1G0DA 4OD3L 4P2OB 3WS3B 2Q8AL 3P30L 3DTXA 4PREA 2VWEE 1LEKA 5KSVB 1W72L 1KG0B 3SCMA 4YBHA 2F54D 2DQJH 3U9UB 3QZWB 3SJVB 2C1PA 3MV8E 2ARJQ 4LSPH 4KKAC 5D1QC 5EN2B 1M71B 4G8GB 2VDOL 3O3AB 2UVFA 4XNYL 3RFZC 3IU3A 5E8OA 3VD9A 2NYYC 3EJJX 4XHQA 4XAWL 1BJ8A 4HUVB 3MFGB 3DBXA 3TH4T 4EUPG 1JK8A 1I3VA 3PWPA 5AD0A 5IT2L 1ADQA 2X4NA 4MJIA 4KZDH 3OKEA 3I50H 3O8XA 3CMGA 3I6GB 4Y4HB 1QLRB 1J8HA 3IFLL 3THML 1LHZA 8FABB 1QLEL 5C07D 1ROWA 4H20L 1B0GA 1IBGL 5J13B 4S1DD 3ZDYF 1QPPA 2HMIC 1KB5L 5DHVB 5EZLB 2A6IB 4YFLF 4PGCA 2NY0C 3D6GA 4A6YB 1I9IL 2MNUA 4JDZB 1GAFH 5I2IA 2X40A 5F88B 5DK0B 5HGBB 3O6FB 4KHTL 4J8RA 5JMRA 5KSAA 1PSKH 5ADOH 3S36X 4U1MB 4JHBA 1CIUA 4R4FH 5GS3A 1BVZA 4NCDA 1T66C 2APFA 5K9JL 1NUDA 4KU1A 4Z7OF 1ZHNA 1OT2A 1CLZL 1KULA 4K23H 4LFHD 4JO2L 4MXWL 5D2LE 2XZQL 5DUBB 2VDNL 1G7HA 3W5NA 2ERJB 1ZE3C 1KB5A 3GI9H 1FGNH 3L1OL 1AJ7L 1FNEA 3MRBB 4OD3H 1YQ2A 5I1HL 2E9JA 4ETQB 2HWZL 3UJTL 3Q6GL 1Z9SA 4I9WE 4OQTL 2FEDD 4YXKL 3ZDXF 5DJDB 3GSNL 1DBAL 3CCHA 4ZD3L 3IDNB 4Z7NE 4OZIE 3RVUD 2IG2L 4KMLB 4M8VA 2GIYA 2PCPB 2R0LL 2VDOH 2UZXB 3EIFA 2EKSB 1S9VB 4JHZA 2XTJD 3LKRA 5ID1A 5KOMC 1MLBB 2UY6A 3H9SD 5JW3L 3QDMA 4EDWH 5DJ0A 1NFIA 4OM1L 4ORGA 5INCA 4J7RA 4LLWB 4OQTA 5EH1A 5L6YL 4LLYA 4IOIB 4BZYA 1VEMA 2GJ6D 3GSNA 3GSQA 2N1KA 2NXZD 4O2EA 3NPZB 1S7UB 4Q9CA 3D69A 5EIIA 2DM4A 5JOFB 1IBGH 3VFRB 1HILA 5FYKE 2HLAA 1NFDB 1NCNA 5JHDA 1SYSA 1V3KA 2QEJA 1U8IB 1N6QL 3QBTB 4LCCA 4G8EA 2OZ4H 1K85A 4FQLL 4TSAH 1FNLA 2D4DA 3VRLE 3NGBC 4NRXB 5I8OL 3P4NB 5DJAA 1RUKL 2VMFA 4XP4L 4DZBA 3V4PH 3QUXB 2LU3A 3VFVB 43C9A 1KJ2H 1T89A 3S5LG 5IEKB 2VLKA 1S9WB 4F58H 1HXYB 3KPRA 3MV7E 4ZXBD 5MEQB 2GUOA 4MQTB 5C2UB 2AQ3A 3MOAH 1T04A 3WXVH 4MQXC 3BIBX 3CD4A 1HDMB 3PL6C 4ZFFA 3OAZH 1TCMA 5HY9B 3MJ7B 1I8LC 5IESH 2RR3A 3NIFF 4HAGA 4UDTA 5E03A 5B8CC 2OSLA 2Y06L 3JVGA 3MV8D 5TFSH 1T1ZB 2YD5A 3BKML 2NW2A 4ZAKD 5LAXA 1U8QA 4V1DE 3OB0H 4Q9BA 4ZD3H 2ARJA 4TNVK 3UAJD 5IB2B 5A2JH 4LU5L 4WO4A 2EXWC 3IDGA 4KQ4H 4YFLI 2NY2B 3SKOB 1IILE 1EIBA 3I9GH 5F1NA 4JO3L 1OARH 5CGYC 5FV1L 4ERSL 4O2CA 4UIKH 4NZRL 1I1AC 1KIPA 2C1PB 3BUYA 1FFPB 4PS4H 1RPQA 4NZTH 1Q94B 4HBCH 5I71B 3DXAA 2AV1B 3IXAB 5CJOH 3IDYC 3VRIA 5IB1A 3VWJA 4MJIB 1NL0L 4AYFA 3O8XB 5E2JA 3RGVA 5B4MC 4B53A 3ROOB 1W72B 5E8PA 3FQUA 4DN4L 4M9OA 2XQBL 1CTOA 1S7WB 3QWRD 3IGAB 4L8SA 5I66A 4HULB 3ZKXC 3RY6C 2BSTB 1BEYL 1RIHH 2HVKA 4XVSL 4EN3D 1U8HB 3CUPB 3QQ3A 1T80A 5F1IB 4XP4H 4PGCB 1DDHA 1H3XA 2KKQA 4F7PB 4L1HA 4P9HC 3FB8B 4JRYA 2GAZB 1YPZF 5J7CC 1RUPL 4M02A 1XT5A 4M7LL 4MXQD 2HJLA 4I9WD 2VLJE 5D6DA 1ZHNB 2LU7A 4K94H 4WWKD 3D85A 3SDAB 4MB4A 5F7NC 1ZLSL 2Q3ZA 3IYLW 4MX7B 2BOBA 2L0DA 1JBJA 4JFOA 1UYWL 5B39A 3ULUL 4Z7WE 1WZKA 1S7QA 5FKPA 3RU8H 1TVHB 1BREA 3UTTA 1U41A 3JBG7 3L5HA 4P9MH 2EE3A 4L8CB 3W39A 5L2JB 3CCHB 1CDGA 1B88A 1LP9A 2FH6A 5CINH 5FO8A 1G9EA 4ERSH 2I60H 4Z8FH 4LIQE 1T1YA 3EYFB 4CU8A 1K4CA 2HP4A 1OGTA 3LZFL 1D9KD 5MP6L 3ARXA 5DQDL 3MRLA 4HKZB 1NKOA 5JIHA 1T5WA 2R0ZL 3G5ZA 5MHSD 3DX8A 4LGPB 4AH2B 2X4SA 2AAVA 2GITA 1S8DA 3S4SA 3QDMB 1Q8MA 5LBSH 5GS0C 5JA8B 4K7PX 3U6RA 4PY7A 1FVEA 5DI8A 3BRFA 4HG4K 4CVXB 3A0OA 5EIQA 2JJUA 3CSYA 2ZSWA 3HFML 4HZLB 3VG0L 1F3DJ 2BRRL 3MROB 4XZUA 2VR9A 1F8TL 5EIIB 5DS8A 3NACH 4O51A 3MLSL 3WUWA 3RWEA 1KN4L 3HE6B 3DX9A 1YEFL 1NC2A 5IW3A 3MV7D 1BVKA 2G5BA 1SYSB 3SCMC 2JJWA 2FEEL 2Q3AA 4JQXA 2BNQB 2VUOA 3K46A 3UPAA 4PP1D 5IFAL 3O4LA 4PJEA 4AIXA 4N9GA 1RJLB 4DZBB 4UQ3A 5CZXC 4OLXH 4J3WA 3TBYA 7CGTA 1RUPH 4PGZA 2XA8H 4ZODA 3EFFA 1ZWIB 3FO1B 1I3RB 1RK1B 3G6JF 2XZZA 5F1KC 1OP5K 5GSVA 3WJJA 1MVUB 4ALAH 4ODTL 4HQQL 1UYWH 1F00I 5HHPA 1WEJL 5CFHA 4MA1B 1ZHBB 4KK5C 4NRYA 4F37K 3GBNH 2OSLB 4WI7A 1DCLA 2R4RL 3B8SA 1P7QB 3H0TA 4RFOH 5ALCL 3LHPL 2NW2B 4KI5D 5DT1H 1U92A 3CLFL 4Y16D 5DRXA 2WBJB 1S5HB 3L6FB 4OKVA 1SVZA 4FXGB 3IDGB 5IJKC 1G0XA 4WWID 4ZOEA 5F1NB 2N56A 5KSAC 4YFEA 4CMMA 1JGUL 4I3GA 3MYJB 4OZFH 3T2PA 2XN9B 3VXRB 5I73B 3LQMA 3IFOB 5GIRB 1NLBH 1BLNA 2VH5L 4LHUB 1EZVX 4JFDE 1W8NA 1AI1H 4BH8A 1OB1B 4Z7UB 1FBIH 3L5WA 3VFNB 1UWGL 5TDOA 2C3WA 5IB1B 1EAPA 4Z78A 4OCWL 5GGSA 2YPVL 4QCIB 2BMKA 4FTVB 4JM4L 4XB8A 4X7CC 3V4VL 3IVKA 4YHOL 3O3EA 1OT1A 1MFCH 5GSRA 4BM7A 5LCVH 3SY0B 4M7LT 1I1FA 5I17A 3ZDZF 2VLJD 3ZO0A 5H35A 3SKNA 1NMAL 2HVKB 2L7JA 2ZPKL 3JWDC 1AQDA 4BH7A 5CKAA 3GFUA 1UKQA 2Q87A 1MJ8H 5EU7C 1IAII 3EO0A 4IRSA 3K4ZA 2NLJA 3MFFB 5DEGA 2FIRT 4NSKB 1NKRA 4N1HB 1N26A 2HJLB 2KUTA 5KTEL 4XCNB 2BVYA 3D85B 3QDJE 4RMWA 5I6XC 1Q0XH 4XP1H 5ELIA 3ARED 5DD3H 5FA3A 1S7QB 4PJ9A 1XGUA 2Y07L 1TZIB 4MJ5B 4LCCC 1DQQB 1QBAA 4LDOB 2IAMD 4CUCA 1YUHA 4KKNA 1V8HA 2C4FT 3L3JA 5EZJA 3TYFA 1RZJH 3W39B 2MHAB 5KAQG 4O00A 4PV8B 4E41A 1LP9B 3S34L 1BQLL 1XGQA 4NT6B 5C08A 1T89C 3LPFA 1T1YB 4LLUB 3HI5H 1K4CB 1TETH 5HGDA 5EA0L 4DGYH 1NCDL 2QHRL 3D0LA 3S36H 3TN0D 2IQ9H 4KMTL 2H8PA 3MRDB 3PDDA 4LEXL 2P8PB 2Z92A 4XPAH 3N1GC 4HC1H 1NC4A 4E0RA 1XEDA 4F57L 1TPXC 5KVGH 4MVBD 2Y36L 1UH4A 1BFVL 3U6RB 5GS2D 2Y7QA 4OCWH 3DPBA 5DI8B 3F62A 1JN6A 5D5MB 3MBEA 4NGHH 4JM4H 3MRFB 3CSYB 1IZKA 4WI5A 5E8DL 5BQ7B 1TLKA 4GMSH 4O51B 1LVEA 5JW4N 3SGJA 5CSGA 4WO4C 1N5AA 5KAQF 1BVKB 3HUJA 1KJMA 4OZFB 2JCCA 4DCQA 4ZPTB 1VFUA 5E2TL 12E8L 3IKCB 3O4LB 3ZL4L 4NQDD 4PJEB 4M48L 3TBWB 5IJVB 3TBYB 4IRJB 1HIMH 3FFCE 1CIDA 3HTLX 3STZB 3B5TA 1CF8H 3EFFB 1FPTL 5BXFA 5DRWB 5IK3A 1C08A 5IW1A 5IMMA 4MCZB 1CU4L 4XPGL 3VWJC 3CU1A 4RZCA 5DQ9A 3VXNB 3O9WD 5GSVB 1KF9B 2Y23A 3RGVC 4RNRA 3VG9B 1X4YA 1OP5H 3CJJA 1DQJB 3BD4A 4JY5L 2ORBH 1H8SA 3G6DL 3V5DB 3FN0H 2DIJA 4NRYB 5HTSA 5LGKA 1YEIH 2IANE 4L8SC 5I16B 4RRPA 1YECL 2P47B 1Z6JT 1B9ZA 5M7QA 1NDMA 4JFDD 1BQLH 5LVEA 4UINL 3H3BC 1TJHH 4N68A 5DRXB 3B9KA 5C0CE 5EA0H 5IQ9A 3PDOA 1YC7A 5DLML 1XH3A 5EOTB 4WFFE 3VDAA 1R3HB 5J12B 5JW5B 1OAXH 2H2SD 2XPGA 4ENEC 4HK0B 3W9DA 4DGIL 5D6DC 3DVNA 4LLDA 5T3ZE 3AAZB 4R96A 3O6KH 4FZEH 3SGDH 3A67H 4BH8B 1BQSA 3T4AB 4UQ2A 3NZHH 5FHBL 5TDOB 3GNML 2E7MA 2Y4SA 4APQD 4HXBH 5CBAA 1HCVA 1PW3A 4UT9L 5CEZE 2BMKB 3QXAA 3DUUA 2CGRL 3UZVB 1QR1B 1EH9A 3O3EB 4FG6C 4OF3A 4U6YA 4ODBD 2FYYB 1DQML 1LK3H 2DBLH 5I17B 4B0MM 1L0XA 3SKNB 3UO1H 3VGEA 4BH7B 3FOMA 3QDJD 3KPSA 5ENWB 5JR1L 2G9HB 4UUJA 1FPTH 2YOCA 3GMRB 3EO0B 3MRCB 4XPGH 4OCYL 1TXKA 3KJ6H 4U0RC 4WDIA 1DLFL 1I7RB 1KN2H 3QB7C 1LNUB 4ZTPH 4W6XB 3LSOB 5CJBA 4JVUA 1RVFL 2GSGA 3QCUH 5TDNA 2HT4D 2QQLL 3BPLB 2AK4E 1IKNA 1N4XL 2VDML 3AB0C 4NZUL 2OLDA 4HV8A 2EEDA 3C87A 5FA3B 5AZEH 4P4RA 3CXDH 3FO2A 5B38B 5JXEA 1GXEA 2EDKA 1UWEL 4HPYH 2VQTA 4JQXC 1IM3A 1U8PA 3L3JB 3FO0L 3C08H 3MCLL 1U8MA 5E8NB 3GGWB 1MCRA 1XGQB 4P3DA 5JUEH 3FQNB 4V2CB 5EBWA 4DGIH 4PGDA 4XPHL 1FDLL 1IGYB 1KXQE 3QUMH 4JPVL 3SDDD 2EYRB 4F2MA 4KKLC 5DD0L 2XACC 1CXHA 3WJJC 4YIQB 2ZZUT 5HXMA 1W2KT 4E0RB 3UC0H 3VG9C 2I26N 1MRFL 1HKLL 3GNMH 2OTUB 3MRPB 1KPRA 2PKDA 2D7PA 2CUMA 1D5IH 2FX7H 1VDGA 4EXPX 5DF0A 2CGRH 2B1AH 4X6CE 4CVZA 2XQYG 3CFKA 1CWVA 3RY5A 4LQFL 4HUNB 2AP2A 2YSSA 3CC5A 3RI5K 1IFHL 3VFSB 3S37L 5CP3A 1BD2B 5FUZH 3M17A 4WW1B 5TE6H 2W9EH 5C8JA 4JFFA 3EZJB 1I8MB 5ITFA 5ANMB 2F74A 2P1YA 5HD8C 3G08A 4S1RH 2D4FA 4UILH 4Z77B 5BVPH 1CDCA 5I75C 1G6RL 1Q38A 1KIRA 3DI3B 3ECBA 4PJ8B 4ZSOB 2ITDA 1UXWA 4LSQL 2IAND 4NOFA 4HFWB 3HE7D 1BIIB 3ULVE 1N0LA 2QR0A 4XP5L 2GSIA 5IK3B 2A6KB 1IEBB 5IF0A 5IMMB 1V7ML 1RVFH 2FIKA 5FF6A 1XF3A 3KXFE 4C55A 1JGDB 4QXGL 5AYQA 3PJSA 2OL3L 5GGVH 4HS8H 5C0CD 2NY7H 3MCKB 5TQ2L 4WFFD 5GJSL 4PG2C 4JRXA 1TTUA 3QUZD 4KK9D 4PRIE 3BH8A 1NCCL 3OXRA 5L2KE 5T3ZD 4GXUN 2LTQC 3PWJB 1JUFA 1NDMB 2Q7NA 4Y5XA 5E95B 4BZ1H 2X09A 5H8DA 3EBAA 1P2CB 4R7DA 3C60A 1LEGA 1LE5A 4IRSC 3CZFB 4PJFA 2HKFL 4HKXB 5DD0H 3E6HA 5CEZD 5HYSA 2OL3A 2UUDK 4Y19A 3UTZB 2GTWB 4ZOCA 1LEIA 3HZMB 3ZKNC 3CFCL 5SX4I 1A9BB 4YHML 2DS4A 3OG4B 1JV5A 4RMTA 1WZMA 4UQ2B 1LQSR 1WBXB 3BT2H 4OZ4B 4PJ9C 1QZ1A 4S1QH 4NN6B 1GGTA 3S37H 5IBUB 5CJ5A 4NM8H 4HHAB 4DKDC 3TJEH 2HN7A 4NKDB 5ACZA 2BZDA 2HLFD 4U6YB 4JKKA 4WI8A 4G43A 3KVQA 4LPVA 5DJYB 3CDCA 3PWVB 3QUMB 4GKNA 4RMVA 3FOMB 3MNZA 2OTWB 5D7JA 2YA1A 3IETA 4LSQH 1Z5LB 3WFDL 1WJ3A 4RMRA 2AK4D 4FQ2L 4GH7B 1F97A 4XP5H 4QXWA 4JKLA 5DTFB 5C0DA 5I1IH 2VZOA 1V7MH 4JN1H 4X6BA 3T0XA 4XNUH 4E5XA 1BVLA 1IGCH 1ZANH 2IBZX 2OR9L 2F9BT 3MBEC 4QXGH 4X99A 4H1LH 5GGTL 3WSQL 5DJXB 5TQ2H 2C9AA 2LE9A 3CK0L 5TDNB 5HHOA 1A7BA 3MGTB 4PJAB 2EDEA 3LB6C 3SGJC 3L3GA 1JWSA 3X17A 1KXTB 5D7LA 3DSFH 4KZEL 3KYMB 1DEDA 3CVIH 1EJOH 3WFCH 3T0ED 3TIDA 4PR5B 3RKDC 5IKCB 3R1GH 3FHAA 2W91A 1U8MB 3G04A 4EI5A 5IMLB 3IU4L 2ENSA 2HKFH 3CFBB 3RZCA 5JOEA 3WDJA 1U9KA 1UXSB 3UMTA 1L9MA 4OLWH 4HPOL 2HT2D 2W60A 1A6AA 4OSUH 1JRHI 3GSWA 1R6VA 2AJ3B 4JFEB 2VXSH 1M6OA 3DRQA 2F19H 1I1CA 1B2WL 4NN7B 2J2ZA 3LQAH 1AQKL 2Y6SC 4X6FB 5K9QG 1KPRB 2P5WD 2YUZA 5CWSB 2YPLE 1YMMA 3MSPA 3IKKA 3NFPB 4ZUVA 5CIPA 4K3EL 4KI1A 2EDFA 3CFKB 3EFDL 5EG6C 3CC5B 4PJCA 2B0SL 3B9KC 3OR7A 4NO0B 1KEML 4ZFOL 2ZP0T 4OFIA 5J6HA 5A3IC 3BESR 4PRHD 5ABDE 2CD0A 5JA9A 1OWWA 4S0SD 1Y6NR 3OAUL 3PQYA 2H32H 4FQ2H 2RFXA 4K7FA 3BE1L 4PTUB 4U6TA 1KIRB 3ECBB 2GYSA 1UXWB 2DQCL 2XKSA 3GBMH 1SJHA 4PRID 3UTSA 2R1WA 5GGTH 3I6LD 3NA9L 1WC7A 3CMOL 4PRPB 3PWLB 1PG7W 3W0WA 3MLWH 2XFXA 1E6OL 4JRWA 1ERNA 1F6LL 2W0KA 3NCFB 3PJSB 2CQVA 2IADB 4ZFOA 3MJ8A 3IDJA 3C5SB 4M61A 3X11A 3TNNA 3JWNC 4Y4FB 4JRXB 5TE4L 1ACYH 4QHMA 3QA3A 1FVCA 1G6RB 4YZFF 1CFVL 1A3RL 1RZIA 3SE9L 3U30B 5D1ZB 3FB7B 4HFUL 1UG9A 5F1SA 2X4UA 4XPFH 4JKMA 5C86A 5E7BA 4PJFB 4JM2B 4D0BB 1VKXB 2XWBB 1G9ML 1CN4A 1WWCA 4H1LB 1QRNB 2FBJH 1P7KA 3UBXA 1M7DA 3JV4A 1AQKH 1WFOA 2F54A 4FQIL 1OAKH 2UUDH 2DBJA 5A2KH 4BKLB 2YKLL 4M3KB 4PJHA 4G8FA 2FJFB 4C4KT 1IKNC 2E27L 1KPVB 3LEYH 5DVOA 3VWKC 3EFDH 4M6AA 5JXEC 3TEUA 1FLTX 4YHLL 3NZ8A 1FYTA 5KBNC 4IIQA 4YDLB 4IDJL 4OUUA 1FAIH 3ALPA 3BIAX 3MLTB 4UDUB 2XT1B 4Y5VA 3OAUH 4AY0A 4HH9B 1UA6H 1HHJA 3SDXE 2BFVL 4WNQA 1PLGL 2J8UF 1KENH 3Q6FB 2C1OA 2APXA 4RMUA 3LRSA 1FNGA 1MY7A 4MSWA 2CXKA 4M03A 3BZFA 1BVLB 3HS0B 1R5IB 4QHKJ 2FJHB 1CLYL 4AEFA 4NHCL 1CT8B 1QKZL 4UT7L 4FABH 4N8VG 5GZOD 3C2SA 5EU4A 2NY5H 3KYKL 1ZA6B 1JGEA 1MWAH 5F96L 1A3RH 3X3GL 3IJHA 1KCVL 3AM8A 3K1DA 7FABH 2H32B 1FIGL 1G1YA 4OF8A 3REVB 1RUQH 4NWTH 1FGVL 2QADC 3RZCB 1Z9MA 3HUJF 4LRIA 2JCCF 1NGWB 1LK2B 5MERA 2W60B 2X4PB 1A6AB 5KVMC 4KC3B 2AKRB 4QWWD 2Z8VC 4X7FC 2WWKO 1H8NA 3V6FB 4NQSA 3IJYB 3UX9B 3WFZA 5I0ZA 1WBYB 4NCC1 5B3JF 5K9QI 3M8OH 4JFHE 4ZMAT 2HRPH 5D9SA 2AV7A 1HNGA 1D5XB 4TVPH 5IHBA 4ZUVB 3H9SA 2HVJB 1AGEA 2VO5A 3T65A 1OAZL 4JR9L 5C0FB 1KT2A 3A6OA 4Y5XC 3IF1A 1DUZA 4L3ED 3VXSE 5E08L 3C60C 1QR4A 2D9CA 5TH2A 5KG9A 1U58A 4FOMA 4X4YA 4OLYL 4PJ5E 5EIVA 5F9WC 4OGYH 4K7FB 3FKUS 3KYAA 4QKXB 1YEHL 4KPHL 3MOBH 4M1CD 3JWOC 3WKMH 1KCUL 3RDTD 2H1PH 5I1EL 4TRPL 5CEYA 1W0YT 2X41A 3O45A 5IB5A 4NHCH 1PFCA 4UOW1 4UT7H 1U8NB 1XGYL 3ZHKA 5DYOB 3CFIC 2VZVA 3F12A 3KYKH 3MJ8B 4X7TB 4ZXBA 1WK0A 5GRVK 2GCYB 4M61B 4YDLC 5DWUH 3TNNB 2HJKA 1UQSB 4I8DA 4K3DH 4X7EC 2ICWA 1FVCB 3L3IA 2A9ML 3C9NA 4N1EA 3TZVB 1X5IA 4YBLC 4YE4L 3SQBA 4U1HB 5D7JC 1FGVH 5TJWK 3JSSA 1DEEA 1MH5A 1INQA 2UZYB 2WNGA 1M7IB 2AEQH 4YDIH 5E6ID 5IMOA 3ZDYE 1YMHB 3F7PC 5HYQB 5JORB 2F54B 1X4XA 3OR6B 4OBSA 5SX5K 1KB9J 3U4AA 2R2HA 3X14A 1HSBB 5GGRY 5IMKA 1JPFA 3ARDA 4FQCH 2X4OB 2YBRB 3NZ8B 3UYRH 3LEXA 3A6CL 1MY5A 1T22A 3EOAB 5F7EL 5GRJH 1A9EA 4UU9B 1OQXA 4L29B 4Z7OE 2E6PA 3QRFM 5T1KA 4OUUB 2R0WL 1KIQB 5KSBB 4EI5C 2UV3A 4OLEA 4OLVL 3D3VD 1F6FB 1HKFA 1KJ2A 2ADFL 4ZS6C 5C07B 4GBXD 4EOWH 3GIVA 4HJGA 2I24N 3DIFA 1JP5A 1JYNA 3LRSB 1HQRB 1FNGB 3ZDXE 3BX7C 1INDL 3NMEA 2J3SA 1BZQK 4MSWB 1XCQA 1EMTL 4UB0L 2Q86A 1FC2D 4LNVA 1E4XH 3ARBD 4G3YH 4DGVL 2APWA 3P11H 4GRWH 3KAAA 4UNVA 3P9LA 3KJ4C 1K5NB 4GG8A 3VXPA 4WRLA 5KSUB 5D71H 2CK2A 4D8PB 3U0PA 4I0PD 3CXHJ 5EUOF 4D9LL 2SEBA 1MAMH 4K8RL 1CE1H 4YGVA 4WWKA 4JN2A 5IM7A 3EOBA 3WIHL 1J1XL 2CKBL 5J6GA 1AD0A 5CZ