3MLSH

Crystal structure of anti-hiv-1 v3 mab 2557 fab in complex with a hiv-1 gp120 v3 mimotope
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
226
structure length
226
Chain Sequence
b'EVQLVESGGEVKQPGQSLKISCKSSGYNFLDSWIGWVRQIPGKGLEWIGIIYPDDSDAHYSPSFEGQVTMSVDKSISTAYLQWTTLQASDTGKYFCTRLYLFEGAQSSNAFDLWGQGTMILVSSGTTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 226
sequence length 226
chains with identical sequence I, J, K
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlsH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlsH01
1RZ8B 3BP7A 4DGYL 3P0GB 2EDBA 1HSAB 4ZFZB 4I3RL 1MLCA 1JZ6A 3UTOA 3D2UA 3K80A 4MZ2A 1Q38A 4EBQL 1EFQA 1G7LB 1H3XA 1AKJB 3UTSD 1EMTH 4WJ5B 3BN9D 5B8CB 3W11C 4RBPH 5EZJB 2CR6A 5D1QB 1TJIH 2BOBB 4QHLA 5GJSL 3EO0A 3MRNB 3EDFA 5F7DA 1DE4A 5JXAH 1V7MH 2PO6B 2NY6B 1S5HA 2NY1D 4KAQH 4KUZH 4L3EB 5E00A 4PJFB 4M02A 4N8PA 4HUKB 1TZHB 3EJYC 4XPFH 1BBDL 2XQYG 4XP1L 3AXLA 5FO9B 5E08L 1QSVA 1QBAA 1MI5D 3QFDB 1SYSA 3ARDC 2F54A 1KXVC 5GSVA 2VLJE 1RZJC 1PG7X 4JJHA 4FQJH 3MNWB 3DX7A 2DIBA 3IDYB 1JTTA 3CH8A 2CKBH 4U1JA 3EZ8A 2GY5A 2ICWA 5E8NA 3R06B 3ZZ1A 5BOZG 2IH1A 5C09A 1INQA 1JIBA 1NSNL 3HPJB 4U1MB 3CU1A 4PJBA 4LSPL 2DTMH 4DVBB 2X70A 3RGVA 3BZFA 1MIMH 2BVQA 1U58B 3MTRA 3OKMA 1DL7H 1NKOA 3DBXB 3LKRA 1WBZA 5DURD 1WAAF 3QFJA 5KSVB 5C08E 2ZZUT 3MNVA 3O4LB 2DI8A 2YZ1A 1F8TL 2ARWA 4LLVB 4G6ML 4P5TD 4M5YH 1IGJA 4MXVF 1ZE3C 3MRJA 5MEND 1VGEH 3DYPA 4ZXBD 4APQA 1JYXA 1AHWB 3DGCR 3OAYK 4PTUA 2ZUQC 4TVPE 4ZTPL 2IQAA 4R6UA 4NKQB 4Y4HD 1OW0A 2HFGL 3F62A 5JXEC 5CWSB 1I85C 4E9LA 3GSOB 3OAUH 1VFAB 2WUCL 3BDXA 4WFHD 2ZNXA 2APTA 4UIKH 1AKJD 3IDJA 1RHHA 2CLZA 3OKDB 4TSBL 5C0CD 3DETC 3D0LB 2WWKT 2MMXA 2QHLA 3TLRA 3KXFD 2F8VA 4QRRA 1NGQH 3A67H 4H26B 4HXAH 2PO6D 1RIUH 5D1ZB 1DQJB 3UTTA 4YC2C 1NCAL 3KJ6H 4XT1C 4P46A 1QRNB 1UH4A 4RX4A 1T0MA 1E27A 3DO7A 1ZK9A 3QQ9D 4OQ1A 4M43L 1MRCH 3V5KA 4Z95L 4XNUH 2DMBA 3OKOA 4PJAE 4P23A 3KLSA 4XPGH 3QWRD 1WSST 2VDQH 2Z8VC 4JB9L 5DK2B 4X9IA 3RNKB 4FG6D 4ODWB 5CEYA 1H5BC 5I1KL 1EBAA 3P30L 4C58B 2XKNB 1D6EB 5KS9A 5E0QA 1YN7A 5ICYB 1BX2A 1TCRB 2UV3A 4JQIL 2YBRA 4I77L 2X89A 1OTUD 1P84K 3ULVL 3AB0C 4GAJL 4LLAA 3CDFA 3QNXB 3MRDA 3VDCA 5J3HC 4G6AD 2HT2C 5C0ND 3ZHLA 2IPKA 4PGEB 1YJDH 4HZLA 3GIZL 3RUGF 4PJCF 1Q0YH 4AEIL 1FN4B 3N1FC 5F7YC 3E2HC 3QDMB 5F9DC 3EFFB 3WIIL 5CJXC 2ZOLA 3FAWA 2CDEB 3WL9A 1ZLUH 3OAZH 4CRPA 2OBGA 4K3GA 4UDTB 1XGTB 1S9XA 3ZL4H 1UB6B 1VADB 2YD5A 5DHYB 1H8NA 1IM3B 1FZKB 2XZAL 1A9BA 1D9KA 5EIQA 1J88A 3MJ6A 2VL4A 3DUSA 4TVPH 3UTPD 1A0QH 4LSDA 4LGSB 4QRPB 1HQ4B 5E5UB 5I8EA 1S5IL 2IQ9L 2IH3A 1MJ8L 1JWUB 2R2CA 5IHUH 1X5GA 5DR5H 1TVHB 5B38B 1P4LB 1WTGT 5DVLA 4QCIB 1KTKE 5EU6D 4JGUA 1BVKB 5GGSB 3FOLA 2M1KA 3CD4A 4NWTL 4RGNC 4RMRA 2Q1EA 1QRND 1W0WB 2Y36H 1QNZH 4I4WA 1XIWB 1LO5B 4EXKA 5EBGA 3WBDA 2GFBA 2XQBH 3QJFB 4EVNB 3O41A 5KTEL 3BN3B 3NZHL 2JIXB 5GGSY 3QO1B 2ERJB 5EIIB 3NFPA 1S3KL 1JPGB 1U8KB 1BQHG 5SWSE 4UUJB 2XTJC 4UDUA 2YSSB 3R8BB 2P8LA 1RURH 5A2FA 5GRVK 2YKLL 5CSGA 3W0WD 5C6PB 2JELH 1LD9B 1R3LB 2MJWA 4OUUA 1RU9H 5E70A 5EORL 1R3HB 1FAIL 4H8WH 1U3JA 1OQXA 1KNOB 3TJEL 1NLBH 3JWOH 5FGCE 3E1F1 3LOWA 3QEHB 3QXAA 3HG1B 1MCNA 2C4FT 5AYQA 3GMNB 3QUYA 1GGIH 3TP4A 3DVFA 5HHMD 3SDYH 4TTGA 1DN0B 4OT1L 4P49A 3HMXL 2ESVD 3T0BA 3PUCA 4MB4A 4R3SA 4JREB 1G1CA 4P2OA 1A6UL 1EGJA 4NZUH 1F02I 1UM4H 2F8XC 4RISH 3QP3A 2EH8L 4MJIB 4NO5A 5AWNL 1SM3H 3VH8A 2CLVB 3DMMA 4HUVB 2JTDA 2R23B 1G7HB 3U7WH 3Q48A 3ECBA 4Z9KB 4L4VA 5I1DA 1B0RB 3LRSA 1S7UB 4YFEA 1EIBA 1YEHL 5JTWA 3QCTL 5TE4L 3WIFA 5D7KE 5GZND 2QR0A 5C0AB 1JRHH 2OTWB 3TC9A 4OBRA 4YFDB 2YD9A 4UQ3B 5JW3H 2FD6H 5L88H 1S9KC 1HHHB 5C2BL 2AXJA 1QHOA 3UO1L 3QCVH 1XIWD 3DIFB 2FBJH 2Q7NA 3T0VA 4JDZA 4Q2ZB 2D7NA 2J7LA 1HHGB 1SJVA 2FJFA 4XCCL 5FYJU 2FGWH 4FZEH 3MSPA 1NBQA 3IDUA 5D1XD 1J0JA 1B0WA 2D7PA 2FCBA 4DAGL 5HD8C 3X17A 4KI1A 5KSBF 4NUGH 2YD8A 1RULL 2PYED 4LCIH 1CQYA 1FRGH 2Y9RT 3PDOB 1YN6B 2F5AH 2B4CC 3X13B 3FHAA 4DOHE 5FGBA 1QG3A 4ZFOB 1A3RL 2DQHL 4U2ZA 5DRXB 1M71A 1AR2A 1BGXH 2APFA 5IGXH 4PGCB 1DLFL 5DS8A 2OP4H 4N0CC 3RWDA 4LRNH 3TN0D 3QIBB 3SO3C 4GKNA 4BYHA 4YHLL 2R8SH 3O3AB 1MAMH 1A14L 2A74A 3RGHA 6FABL 5IBTH 4QXWA 2OYPA 1FFNB 4MB3A 1KJ2L 4ZFFA 2Z0BA 1GGTA 3ZTJH 2FO4B 1I8KA 1MJJB 3S34H 3DGGA 3L3KA 4PP1C 2LU4A 4O2CB 4XC3H 5E8EB 4CMHC 4PD4J 3GSNA 1WGOA 3KPSE 4AL8H 3ARFC 3WUWB 1BF2A 3S5LB 5HGAB 5DD1L 4I3SL 2YN3A 3TA3C 3OX8B 5C07A 1JL8A 1YY9C 2VQUA 5F7EL 5ISZA 5E8DH 2FJGA 4OAWB 4Q9QL 1U92A 5KSUB 4K2UL 5CUSH 2IANE 1I1AC 2RIKA 2W07A 1D5IL 1WCBA 1LDPL 5GGTA 1GGBH 5A3IC 4NM8H 4UILL 2MPAH 5HJ3A 2JKXA 2D0GA 5K9JH 3LKNA 4EDXA 1G0XA 1FNGA 3MJ8A 1A1MA 4LKXB 4EUPB 2EE2A 4HIEA 3GSQA 2VUYA 1YYLH 3ROLB 1JNNH 1I8MB 2NY4C 1EHAA 4K94H 4R97C 5L9DH 4FQXB 5GHWH 4BSWA 3UTSA 4IM8A 1KXTB 1TNNA 4HQQH 2HKHH 2LTQC 4YDVB 2HVKB 3G04B 1AE6L 5L2JB 2FZ3A 4WGWB 3MLYL 3TM6A 1U8IB 1WBXB 3QNZB 2FECL 5DD0L 3QIUD 3VFPB 4O02H 2ZCKL 4KMQA 3TO4A 4OLUL 4Y5VC 5DJYB 4NWUL 1ZXQA 1KIUA 4YUEH 3WIHA 3BHBA 5D7SH 3IRZA 2KH2B 5FB8B 4PJ8D 4NZTL 1MI5A 4UOW1 4X6DB 1FO0B 3GUTB 2CD0A 5DQJA 4ZD3L 1IQWH 4XMPL 3MBXL 3FO0H 3GI8L 4TQEH 3NH7H 4EDWL 5DWUH 3O3BA 3IF1A 3D1MC 1UWEL 2ZUTA 3NCJL 1EA9C 4Y5YB 4WFED 5JLZB 2Q76A 3QXWA 5HHOD 4HFWA 4NO2B 4U1LA 4RNRB 3I6LE 1D6VL 1P2CA 4HG4K 3V52L 4HHAB 1E4WH 2E6JA 1MCSA 5E2TL 1OGAD 3KPNB 5H94B 2XPGB 3QUXB 5F93C 1J8HE 3CU7A 5ITFB 1IQDB 3SDDD 4JZOB 2X4UA 4Y19D 1E28A 3TNNB 3JV6B 4ELKA 4BFBD 5DMGD 2F54E 4XCFH 3NCYP 1LEKA 5MENA 1OT1A 4WEUD 4X80L 1RZ8A 5DT1H 5L2KB 2YPLD 1HSAA 4ZFZA 5EH1A 4PG2A 2QTEA 1C7SA 1E4JA 1RVFL 4Y4HA 3NCEB 4ZNCD 5IESL 1MFEL 1G7LA 3FN0L 1PKQB 5CJOL 5C09E 2LABA 3N85L 3L1OH 4PJBE 2J8HA 4ZUSA 1AKJA 1BFOA 1U8HB 5KZCB 1QFPA 3OKYA 1U3HB 5C0CA 4PS4H 4C55A 4QTIH 5EZJA 1MVUB 3LS4L 1G9MH 2VDLH 5D1QA 4G43B 5KJRL 1OAYL 3QFJE 5GS2D 2BOBA 3O6FB 2WSKA 4YHZL 2W9DL 1OPGH 1WZ1H 1EO8L 5HGGS 5ACZB 1E6JL 2PO6A 1FC1A 5LQBL 1DCLA 2IFFL 5DHVH 3MV7D 4L3EA 4PGDB 1TZHA 5HTSA 3ULUC 3MZTA 5FO9A 1G6RL 2WP3T 3SGJC 1HE7A 3IAPA 2RAMA 1CGXA 3QFDA 3LV3B 3WNNA 2YD4A 2XI9A 4A6YH 5E08H 2V9TA 43CAB 5MP6L 1FYTB 4XI5C 5JHLL 1T66D 4M9OA 1FCGA 4K23H 3R1GH 4U1MA 1OY3B 3T1WA 3TT3H 4OFYD 4DVBA 4MD4B 5F7WC 5I1JL 1IKNA 2FEEL 5EULV 3QUMB 2A6IB 1U58A 3UTTE 1XGYH 5DJXB 4QOKD 3RWGB 4GG6F 3HHRB 4F9PA 3PXHA 5KSVA 3PJSB 2GI7A 5EUOF 5F9JA 3UJIL 3ABZA 3CCHB 1J18A 1SJEB 4LLVA 2H26A 3UPAA 2ARJB 2VLKB 1Q9WA 2XWTA 3K2UL 5TF1L 2ORBL 3NABH 1AHWA 5DEZA 3IS0X 4HFUH 1YY8B 5E99H 5T3XE 2MOVA 3GSOA 1UKQA 4GBXC 1VFAA 4TRPL 3F58L 5F7KC 4Q97A 1MH5B 4H0HB 5KS9E 4OCXL 1AD9B 1U3HD 1J05B 1YNKL 1P7KA 2VH5L 3QH3A 3RKDC 4I18B 4GG6B 2VR9A 1C5CL 2DLFL 4LHJB 2NNAA 4OCYL 4H26A 4ERSH 1MFCL 3E8UH 3AS0A 1LHZA 2YWYA 5C2UB 2R56H 5I73B 1XGUB 3X3GL 5DC0A 5FM5O 1IGTA 4Z0BH 1QRNA 5F7FA 4D9QE 5D93C 1JHKH 3RZCD 1NEZB 4AY0A 5JMOC 2CJUL 2WMPA 2VDPL 2UUDK 2WUBH 5DC4B 4DJMA 4MHHI 2OSLB 4FMKA 4M43H 1KIPB 2HTLD 2JB5L 3RNKA 5K93A 4C56B 4TTDC 1QVOB 5EZLA 3W0WA 4G8EB 3BPOB 2LU3A 4DKEL 5AG8A 2GTZB 1MCCA 1OB1B 3MROB 3U7AA 2D3VA 2EC9T 1HK6A 5ICYA 2PTVA 1TCRA 4HJJL 2HLAB 3PQYE 4XNXL 4XMLH 4RQQB 3PGDA 1MCKA 4PGEA 4TNWK 2JJUA 2VIRB 1DVFB 1FN4A 3VXRD 2WQ8A 3QDMA 3VFOB 1MWAL 4HBCH 3EFFA 4L4TE 3GEWB 3T0EE 1A5FL 2F5BH 2CDEA 4LPYA 1KGCE 4YHPB 1KBGH 5ACMA 1I9JH 4UDTA 1XGTA 3FQRB 1MFDL 1UB6A 1VADA 4BQ9A 5DHYA 4NUJB 3B2UC 4X4XA 3MV9B 1IM3A 1BD2D 4RIRA 3VI3F 3FT4B 4GJTB 1FCCA 3K7UA 4MS8C 1DTUA 4QRUB 2ZPKL 3MODL 4JO4L 5C0BB 1HQ4A 3SOBL 2R39A 3IDXH 5T3XH 4UV4L 1JWUA 4Z77B 3GJFK 1CK0H 3EYFA 1OM3H 2CUMA 1URLA 2VAJA 4MSWB 1TVHA 3I9GL 1P4LA 5B38A 5IEKA 4QCIA 4D9RE 4NQVB 5GGSA 1HEZB 1OAQL 1TETH 4O51B 4F7MB 1WQVT 4PRDB 5IF0B 1KV3A 4IRSD 2X9YA 3CK0L 5JDSB 5F8QC 1XIWA 3MRPB 4EVNA 3QJFA 2J3SA 3RWCB 4Z0XA 3T0WA 5L6YH 4KQ3H 2JIXA 3QO1A 1MQKL 5EIIA 3ULSA 4MMZC 5BV7C 1JPGA 3RVVC 4HS3B 4DN3L 4XPAL 1LK2B 3NZHH 4UUJA 4P0DA 4WY7H 4ODSH 2PYEA 4YQXL 1QD0A 5D7IE 5JW4N 1UGNA 3UJTH 1IKFH 2Z92B 1LD9A 3SGKA 4FFYH 3SE3C 4LCUB 1R3LA 1NAKH 4JQXA 1R3HA 1VDGA 5DSCB 1KNOA 1H3GA 4L4JA 1Q8MA 1F4YH 3K8LA 5E2JA 4O2EB 1Q94B 3QEHA 3HG1A 1KLGB 1CXFA 4YZFE 1JWSB 4NQXA 3TJEH 1U6AL 4XC1L 1WF5A 4Q0XH 3ZKXC 2FWOA 3KHOA 1DN0A 1XH3B 3T8XA 3BKYH 1K5NA 1L9NA 4MNHB 4X5WB 3TBWA 5AZEH 2GEEA 4S10A 4JO2L 3PL6C 1BWMA 3NFNB 1KN4H 4MJIA 3V5HB 1UM5H 5CEZL 4Q6IC 5KVDL 2XNAB 2CLVA 4F7TB 3MV9D 2R23A 1G7HA 4X9GA 4ZO7A 2X6MA 4LSTH 3BZEB 1D3CA 1B0RA 2Q86A 2CRZA 3HR5A 4KHXL 1AR1C 5AWNH 3O9WC 4QRSB 1J12A 3T65B 5TE6H 5CCKH 3U9PH 2X1XR 1T80A 3LD8B 2O5XL 3ZDZF 2VZVA 1IEHA 3ZT7A 2OTWA 2HT4D 4LGRB 4N0YL 3P2TA 1HHHA 4WI4A 4QHMB 1S7WB 3DIFA 4Q2ZA 1MFAH 2P5WD 5I0ZA 1RZJL 4OLXL 1HHGA 3PWVB 3DHMA 4Y4KD 4JCLA 4OLWH 4MXQC 5ISZE 3B5GA 1AO7B 4U6TA 3NACL 2DL2A 3VXNB 5L7XH 5I1CL 4R7DB 2IBZX 4DGVL 1J5OH 1R6VA 3MRIB 3PDOA 5IR1B 4YIQB 1VEPA 1YN6A 4HCRL 4BQ8A 4OI7A 3X13A 5FK9B 3ZYZA 4F7PB 3ZE0F 1C5BL 3U0TB 2OM5A 5ELIA 4XP9H 3VWJB 5GISH 3QIUA 5DRXA 3B3IA 2EZ0D 1QLFA 3MC0A 4I0PD 4PGCA 4BFIA 1KJ2B 3RA7H 1XGRB 1EHLH 5D2NC 3FOMB 3CFEB 1P69B 3QIBA 1BQHA 4PJ8A 4P4KB 4Z7UB 3GNML 3QUZC 3VMPA 1J1PH 2HMID 3UTSE 2IPTL 2DQEL 4JZNB 1FFNA 1IM9D 4J6RL 5HHNB 3LS5H 3O3EB 4HBQA 5F9WC 4OZGF 2R4RL 2AXGB 4YHLH 5I19L 2FO4A 1MJJA 4OLVL 5KSBA 2CQVA 4M7JL 2E9JA 4O2CA 3TVMB 4YHIA 5E8EA 1T5WB 1UZ6E 4EI5C 1CL7H 1ZV5A 2OZ4A 3S5LA 5KOVC 1PDKA 3QDHA 4UB0L 4K07A 2IJ0C 3KDMA 1TPXC 2XT1B 1GHFL 2GJJA 4OAWA 5C0IB 5KSUA 5MEPB 1CD8A 2Y5EA 5KG9B 1IRAY 1CVSC 2ZG2A 4JVPA 3NCCB 4OCWH 1MI5E 5IB5B 2DLIA 2EO1A 5D9SB 2VN4A 3WEXB 1A4KA 1W72L 3LPFA 1U8QA 1FHGA 4D0CB 2HH0L 4RMUA 3EYQD 1D5IH 2BNQB 5FA4B 4Z8FL 4TOYL 4LKXA 4OZGB 4EUPA 1S78D 2N7AA 3TT1L 5J11B 4LGPB 3ARSA 4YHMH 3MRFB 3ROLA 3VWKB 1I8MA 3ET9F 2ZP0T 5B3JE 4FQXA 1T89A 1Z9SA 2C3HA 1MCWW 1F42A 4YDVA 3G04A 4L3AA 4TSCH 5JW4Q 4JQVC 5L2JA 3MCLH 4WV1C 3K4DA 2VTFA 4I3GA 4J3VA 1FNFA 3AVEA 1U8IA 4IEFB 1WBXA 3QNZA 4I5BB 4F57L 4YBHA 3VFPA 1TLKA 5MENE 1T6VN 1G1YA 4HKBB 2DQTL 5TFSL 3KYKL 5A2JH 4GXUM 4V1DB 4WDIB 4JFQA 4UT7L 5DI8B 7FABL 8CGTA 1X5YA 2VDRL 1YC7A 4G7VL 4DKDC 4X6DA 4XB7A 4WFHE 1LNUB 4Q9RL 1B0GB 5KOMC 3SCMB 3WFBH 2YK1L 3DVNB 1JGDB 1R3JB 1HCFX 5C0CE 2X5PA 2BHUA 4PJ5B 2I27N 4Z78B 4X9FA 4P3CL 4F37K 3MLXH 3C60C 1A3QA 4Y2DC 5E2VH 4Y5YA 4UIMB 3G5YB 3KXFE 4P9HC 4LCYB 3T4AB 4CMMA 4QEGA 5HYSG 1JGLL 5JLZA 5FYJD 5IEHB 4NO2A 4HHAA 1UYWH 3QXVA 4QOKA 4DGIH 1HHIB 2R15A 2F15A 4IRJC 2DQCH 3KPNA 1D5BB 5H94A 2XPGA 3QUXA 1MVFA 5ITFA 1IQDA 1CYGA 3ARGB 5EOQL 4DCQA 5LXGH 1DUZB 5EU7E 5GGVL 3HI5L 2NXYB 5J4MA 1CFBA 4G7YH 2X41A 3OG4B 3SJVD 2BNQD 4LSSL 2C9AA 3TEUA 3WIHH 4POZC 2W9EH 3Q1SH 4DKFL 4JR9H 1EVTC 1Q72L 1PY4A 4PRPB 4KKAD 4HIHA 3WO4C 2XN9D 5IK3B 5JPMB 1U8HA 3RTQB 2SEBB 2PTUA 4PLJC 2VSCA 4H0IA 5LCVL 4UV7L 1CQKA 1T21B 4JDVB 1U3HA 2Q8AH 3VGDA 1WFTA 2PW1B 4XBGB 4DEPC 3B2UD 2VXSH 4D8PB 1A64A 4M6AA 4LOUD 4GS7C 3WKNA 3HC4L 4LAQL 2JJTC 3O6FA 2AVGA 2F19L 5JMRA 4K7FB 4ZPTB 3C5JA 4X7SL 3MRRB 5ACZA 1G6RB 2IMMA 5DQDH 5BZWA 4N8CH 2QQNH 2OTUA 3EUUA 4PGDA 5E8PB 2EDOA 3UC0H 4WWKC 3BP4A 3S4SG 3RZCA 4B7IA 2DKSA 2VUOA 3LV3A 4KROB 1G9NH 2ARJQ 43CAA 5E2WH 3JVGA 2DBLH 4HSQA 3UTPE 5IKCA 3PWPD 4U0RC 1UVQB 1CLZH 1SEBB 1NDMB 3MZGB 2DKMA 3RVVD 1WAAE 4LVOB 4XWGH 2XA8L 5D7JB 5IB1B 1MY7A 1Z9OA 5L8LB 5IVXF 4YHYB 2LAAA 1PSKL 1BQUA 2AEIT 4MD4A 4XPHL 3VG0H 5EU6E 3UBXI 3KJ4C 3QUMA 3D6GA 4NN5C 4MXVE 5D8JH 5C0EB 5JHDB 2A2QT 4P57B 4JPKL 3V6FB 1H3WM 3D87B 4B0MM 3EYVB 3GFUA 4YGVB 5GJTH 3RWGA 1QRNE 1T22A 5FGRA 1VEMA 3PJSA 4M7LL 4AEHH 5HHXH 2C7UB 3ARGD 3ARBC 2QQKH 1SJEA 4HXBH 3ZSSA 2ARJA 2CUIA 2VLKA 2CR3A 1DDHB 5IQ9B 4OCSL 3WFHB 1EPFA 2FNBA 3ARZA 1CDIA 4TUOB 5CP3A 5H37H 3GM0A 3UAJC 1YY8A 1MFBH 1FL3B 2ORBH 5TF1H 3W0WE 1NMCB 4KVCL 1EO7A 1MH5A 3ROOB 1CFQB 3DUHA 1NFKA 2P8MA 1J05A 2R0ZL 5I18H 1BZQK 1U8NB 1RZKH 4I18A 4GG6A 2B4CL 3V4UL 4YX2H 1IAOB 3I02A 2C3VB 2P24A 1OP9A 2ED9A 5C86A 4MD0B 5HHME 3CSPA 1XGUA 2ESVE 1JRHI 2W0FB 3MFGB 1U3YA 2JLLA 3FFCB 4LHQB 4ELMF 4PR5B 1NEZA 3VW3H 2BNRB 3X3GH 4KJQD 3PHQB 4OFIA 3VJ6B 2OSLA 1IZKA 1U8JA 1CI5A 2B7DT 2FX7H 4ZAKB 2CJUH 4O58L 3CXDH 5GZOD 1NAMH 4E5XA 3KG5A 4C56A 3SQOH 1QVOA 5D7JD 1RIHH 4G8EA 4NRYA 1YQVL 2GTZA 4R0LC 2H3NA 3MROA 1FFRA 4FFZL 3H9ZA 2J8UF 3RUGE 1X5XA 4PJCE 5E4EC 5JHDD 4FFVC 4EZMA 1I8IB 5FO7B 2BSRA 4NFCA 2G5BB 3LQAC 3B2VL 5ADOL 5DUMH 1UKTA 4YDIL 1KIRA 5AZ2L 1Y6KR 3VFGL 2EO9A 4GKZB 3TYGL 4WHTB 5KSAB 3VFOA 4LASH 1GRWA 2G60L 1JV5B 3K3QA 1G6VK 2PYEE 3KNBB 2Z35B 2Q3AA 2UZXB 4YHPA 5DJDB 2ZUSA 3MLVH 4DTGL 3FQRA 3CDCA 4NUJA 2J12B 3MV9A 1H15B 1SEQL 1MREL 4QRUA 3E3QC 4PJ7F 3QG6A 4JFHD 3PIQB 5SX4H 5C0BA 4HW6A 3TV3L 3L3OB 4KTDL 4Y1AD 4OLYH 5HI4C 4Z77A 4M6OH 2E3VA 4MSWA 2Y1VA 5ESAA 3C6LB 1JF5A 5ICZA 4NQVA 2VABA 1HEZA 4PJEB 5GIRB 3MO1B 1UB5A 4UV4H 3TBVB 1V5JA 4PRDA 3FFCD 4ISVB 3ARTA 1RZIB 5JDSA 3O6KH 3MRPA 5TDOB 3RWCA 5CINL 3BQUD 2P5WA 2XRAH 4QHKJ 2NPLX 1YNTB 5JA8B 3CK0H 4JDTL 5CZVH 5I8KH 2AQ1A 4HS3A 1A6WH 1LK2A 4K9EH 2OS7A 4OFPA 2IC2A 4PIRF 5HI5D 4Y4FC 4JRYD 2NXZC 5IHBA 3CVHL 2PW2A 3AM8A 4IOIB 3TO2B 2Z92A 5F9OH 1CDGA 3MRBB 2HKFL 4YEEA 2KQMA 2NQCA 5IROA 3WXWL 4I0KA 4KV5F 2MQ0A 3MLSL 5DSCA 4I0PA 1QBMH 3QPXH 5GRZA 1UJ3C 2YR3A 1ACYH 1XEDA 1R0AL 4O2EA 1Q94A 3FO2B 2YD3A 2I9TB 3HMXA 3WS3B 4S2SA 1SYVB 1FGVL 1JWSA 1CLYH 5J9PB 3GHBL 3RIAK 3P4LA 3IXTB 3BT2L 1PJ9A 4BFEA 1M4KA 4M7LT 1AD0B 1N6UA 5TQ2H 3P11L 3N0PB 3WN5C 4X5WA 1PVHA 3U48A 2WWKO 5EZOL 3DJ9A 3QNYB 5TE7H 3NFNA 2P5EB 3VE0B 5HDLA 4F7TA 1KN2H 1OAKH 4LBEB 2DN7A 2C1PA 3O4OC 3BZEA 4HPYL 3OKNB 1NGYB 3DNKA 1N5YH 1NUNB 3MBED 1KJ3L 3UMTA 4PB0L 4QRSA 1Y6MR 2EIZB 2NY0C 3T65A 2E7LA 1A22B 1KFAL 3O8XD 4UNVA 4XGZB 5EC1A 4FTVD 5KVGL 1I7UB 3ARDB 1JPSH 3ULUL 2ZWLT 4HIJB 1B4RA 2ADIB 2NW3B 4CVXB 1NCCH 3KR3H 5IBLD 1KOAA 4OF5A 4OZIF 4BQ6A 4J3UA 2ICCA 2V5YA 2I07A 5F70A 4QHMA 5KSBE 3BZ4B 1S7WA 1DLHB 1A7OH 4OFVA 1T20B 4WFEE 5H2BB 1GYAA 2IGFH 4DZ8B 4S1SH 5HHOE 2EICA 3PWVA 3DLQR 3HUJF 3LAFA 4BK5A 2H32B 3MLRL 3WLWD 1AO7A 1RZJH 1IILE 2FIRT 2KBGA 5KANG 4G5ZH 1OGAE 1QYGH 3SKJL 3M8OL 3VXNA 4R7DA 1FVCB 2VLLB 2VWEE 3MRIA 4PUBH 5IR1A 4NKMA 4YIQA 4Y19E 1YEEH 5FK9A 4OGAC 4F7PA 3UJJL 3FT2B 3U0TA 3VWJA 1MHPH 5E2UL 4X99B 1JF1B 1UJTA 5F1NB 2YPLE 2ZUQB 3O2DL 4WHYG 1KJ2A 1XGRA 3STZB 3INUH 3FOMA 3CFEA 3KAAA 4OZHF 1DFBL 4Z7UA 4F2MB 3BOVA 4OD2B 4PREB 1YEIL 1T5XB 5HHNA 3O3EA 3HUJB 4IRZL 4MNGE 5F7MC 3WFZA 3U4EB 1AI1H 1KPRB 3GJFB 3FHQA 2R0LH 4PRHD 15C8L 4H20L 2DQEH 5GRYA 2YD2A 1FNLA 5J6HA 1U8OB 4UZGA 4U49A 1OF2B 4MDJB 1ODAA 5FM8A 1LE5B 3MV7E 1YC8A 3ETBF 4YC2B 1W72B 1H3UA 2HRPH 4NZRH 5FV1L 4FQIL 2J4WH 1AP2B 5MEPA 1RUKL 4RGNE 1UH2A 4G8GB 1AXIB 2QJDA 4LF3B 5IB5A 1KG0B 4HGKC 4OZFB 5D9SA 3WEXA 3U1SH 4D0CA 4AEFA 2BNQA 4D9LL 5FA4A 5IFHL 4OZGA 3WHE0 1ULVA 4L8DB 1CG9B 4DN4L 1QSED 4KKCD 1OHQA 3MRFA 3VWKA 2XWBB 1JGVL 5SWZD 4CNIB 4EN3C 1NFIB 3NTCL 1KXQE 2NY3C 1ADQL 2CMRL 4HKJB 4QOKE 1IC7L 1IEBA 3AB0B 4LL9A 1MHCB 3C9NA 1P4BH 4U6YB 1ZLSH 4JKPH 1GZPB 4N90D 1A9EB 2OZ4H 4J4PC 4MAYD 4I5BA 5BVPL 5DC9B 4XNMB 4U31A 3E2HB 4LLYB 3HAEG 4HKBA 1FPTL 4V1DA 4WDIA 5DI8A 2EKSB 1W0VB 2R9HD 5LGHL 3VD7A 4J12A 1LNUA 3RAJH 3SCMA 3DECA 2V7HB 3DVNA 4WHCA 1JGDA 1MCOL 3KWWB 1R3JA 2XZCL 2BFVH 4HJ0D 4W70A 4EUPH 3P73B 3PWPA 3LDBC 4PJ5A 1TZGH 2M8XA 4Z78A 4MA8L 3GMQA 1BHGA 4LCCC 4UIMA 2D7MA 4HK3J 5JQ6L 5I75C 3RPIB 4KRPC 1NL0H 1AXTH 4KUCF 1NH6A 5DJ2B 2V5TA 1HHIA 1XF1A 4QXTB 2EDJA 1NEUA 2NY7H 5GS2H 2R29H 1D5BA 5DLMH 1ZHNB 1XR8B 1FL5B 2EIEA 2ZOKB 3BMVA 3REVB 3ARGA 4UBDD 2AK1L 1DUZA 4OJFL 2EDLA 3TWCL 4L9LC 4ODVL 3BPNB 1K4DA 5JR1L 5GGVY 4GXUN 3SKOB 4EXPX 1RD6A 4NN7C 3W5NA 3BVNB 1S7VB 1DJSA 2R4SL 5I1EL 2XTJB 4R90H 4RWHA 3NZ8A 2VXUL 2DMKA 4LSRL 4OQTA 3I50L 1F4XH 1V3KA 4PRPA 5BV7L 4G8FB 2FR4B 4QNPF 5FCSH 5T3ZD 5IK3A 5JPMA 3FQTA 1YJDC 3RTQA 1JHTB 2DDQL 1I3GL 1T21A 4RGOL 4HZAA 4JDVA 2BSTB 2PCPB 2PW1A 2OMNA 4D8PA 5HYJD 2P1YA 1FV1B 1JI2A 2GT9B 1P53A 5E95B 3IU4H 1EK3A 4UV7H 4KKLD 2X4OB 1HHJA 4KVNH 4JANB 4JPWL 4K7FA 1NCWL 4ZO9A 4ZPTA 1CGUA 4YAQA 5DA0B 4HF5L 3H42H 3TZVC 3UZVB 3PXJA 3VXRE 2AKRB 1QSFB 4ONGH 3V4PH 2YZ8A 3G08B 1CGTA 5I1GL 3K74B 4KH2A 3VDBA 2KZWA 5FYKU 5FKAB 4RRPG 2MKLC 5JIKA 4F7EB 5SWQB 4HMEA 5I76B 2ZJSH 1NMAL 3NFSH 5M7QA 3K2MC 4MCZB 1BD2E 1FNEB 3UP1A 2YXMA 4KK9D 3UZEA 3MV11 2JJSC 1DQDH 2AV7B 4Z5RB 3LIZH 4JY5H 1UVQA 1SEBA 1NDMA 3KS0J 4GG6E 1GOGA 3GM8A 5D7JA 1C5DA 1VESA 3P9MB 3A6OA 3I75A 4Y16C 5IB1A 3WYRA 5JUEH 5EUOE 1TJHL 2QSCL 4PJ9C 3S37L 3WNOA 1C7TA 5JHDA 5C0EA 4HT1H 2KZ1B 3V6FA 3CLFL 3RVXD 4XP6H 3EYVA 4YGVA 4HDIA 4HGMA 2OXHA 2EH7H 4PV9B 2P48B 2C7UA 4NGHL 3SBWA 4X9HA 4Z7OF 4N8VB 1DDHA 5IQ9A 3RL2A 3WFHA 5GS0D 4U1HA 4POYA 1K6QL 4H8WC 1JNHA 4TUOA 3FO1B 4FN0A 1QKZH 1FL3A 3JWOC 3NGBC 1MJ7L 2EE6A 4G6JL 1CT8B 5IVXA 4K8RD 3TH4T 4ZNEA 4O9HL 3ROOA 3SDXB 1CFQA 3TPUB 3FONB 5E6YA 3VFMB 4KUCD 1NBZB 2DTSA 1CIUA 1IAOA 4ODXB 2C3VA 3S3SA 2AXHA 3F5WA 4Y1AA 5I8OH 3SO3B 4XRCB 4H25A 4E41D 2A1WL 3QUMH 4MD0A 4PP2B 5F6HJ 3MA9L 4UNUA 1QPPA 2W0FA 1F11B 3FFCA 4KK5C 5MEOB 1J1XH 1G0DA 4HIXL 3DV6B 4PR5A 3BQUA 3RVWC 4MJ5B 4R8WL 5CIPB 3PHQA 1BOYA 1RI8A 3ARFB 1X3DA 1T1WB 3MV9E 5DMJB 3VJ6A 1IGYB 3TA3B 1P4IH 3WNKA 1PG7W 2VZTA 4ZAKA 4KPHH 1UACL 3GIVB 5I8CB 1LO2L 2E27L 4JKWA 5D5MB 2X4PB 2E9BA 1I1AB 1X44A 5D6CB 3S4SA 5CGMA 1MCWM 4ZODA 1GIGL 1I8IA 4KJYB 3G6DL 2DQJL 5FO7A 2DI9A 2H2SC 3RHWF 5GRUH 1B2WL 2A0LD 4ALAH 4EJ1C 4N9GB 2P5WE 2HTKD 1MCRA 1Y18B 4MNQB 4R97B 4X7FC 3QQ3B 2XY1A 1MCHA 1WZMA 5GRJL 3K8MA 3SDCC 4HMCA 1A6PA 2LTQB 3LZFH 4W4NA 1JFQL 4XXCC 3VI3E 5AZ2H 3LN5B 1JV5A 1KIQB 4Q9BA 1JGEB 2V17L 2UVEA 2Z35A 1IGFH 1A7QL 5DJDA 1OLZA 3TYGH 3JUZA 1QOKA 3I3EA 2XV6B 5FUZH 4LHUB 1BBJB 2AS5M 4XBPB 1A6ZA 1CL7I 3L3JB 1H15A 2J8UA 3O6LL 1TJGH 3CVIH 3MV8D 1RZFL 2AQ3A 2DQGH 5JPNB 2ICWJ 5IFAL 3ILPB 5IWLA 1SEQH 1T83C 3L3OA 4P2QE 4CADB 3O8XA 1PLGH 4HPOH 2WP3O 2DQDL 1FORL 2R0KL 3U9UB 3T77B 4R4FL 3BISA 4RMSA 4FQQA 4LSUL 1M05B 4PJEA 1NBVH 3MR9B 5GIRA 3TBVA 4IMKC 3G5XB 2HJFB 3VGHA 1RZIA 1FGNH 1UWXK 4EI6B 3ALPA 5TDOA 3SN6N 3QDGD 3MOAL 1YECH 3QG7H 3CLEH 1YNTA 1TTFA 1Z3GL 4OV5B 1A6VH 1OTSD 3OXRB 1ZS8B 4HS8H 1DQMH 3E0GA 1F90L 5C71A 4P9HL 4JRXD 1MIEL 4XPTH 2H9GA 4Y5XA 1BF8A 2O5YL 2HT3D 3TO2A 3MRBA 4S11A 5DFVD 5BVJB 5DMIH 1W8OA 1L0QA 3ZE1F 4K94C 2DIAA 4YWGH 5A2LH 4GUPB 4YXKL 4JN1L 2EECA 3FO2A 2I9TA 5HDOA 2VDML 2Y6SC 3WS3A 2VDOH 1PZ5A 4AIZB 4NDMB 4KJPD 4MNQD 2YRPA 3ZYJA 4W4OC 4L3CB 3IXTA 3MOQA 1EFXB 1AFVH 1AD0A 4QGYA 3S96B 4CKVX 4LFHG 1BAFL 3CX5J 4JZJC 1BMGA 1KCUL 2FYYB 3QNYA 4XWOD 4LSQL 2EEDA 4LHUD 5DO2C 3MJ9H 3VE0A 1VHPA 2XKUA 4G6KH 4LBEA 2I24N 4NJ9L 3HNSH 3ZDZE 1DBKH 1VGKA 3OKNA 3TNMA 3V0WH 3MOBH 1SMOA 3QPQD 1N2RB 5EU5B 2EIZA 1CR9L 1FIEA 4XGZA 4N1CA 3D18B 1I7UA 2MSPA 3TJHC 3ARDA 2XZZA 1WIPA 1OD7A 2ADIA 2NW3A 4CVXA 1N4XL 4WW2F 1LO0H 4JFYB 1AJ7H 1HNGA 3OKEB 4DFHA 5TGBB 3SDAD 4MAUL 3ZTJG 4M62H 4MJ2A 1DLHA 1NC4B 3C5ZB 4KK8D 4XP4H 2GJ6D 1DSFL 4ZFGL 1T20A 3D3VB 5H2BA 4NNPL 4DZ8A 3BXNA 1X5JA 3ZE0E 2CO6B 4HCRA 2APXA 4MQXD 4O4YH 2H32A 3L3GB 4PGJA 3ALXA 1CU4H 3OB0H 5E7FA 3PWLB 4U7KA 1FVCA 2VLLA 4D3CL 2Z31B 3SO5A 4MAYA 1D5MB 4WI7A 5F1IB 2DOCA 1HYRC 4KQ4L 3FT2A 4TNVK 4YHNB 5KVEL 1Q1JL 2FB4L 1X9QA 3SJVE 2Z8RA 1JF1A 2BNQE 4HD9A 5F1NA 4OZGE 5D2LB 5FA3A 4OZIA 3FN3A 2X4NB 2IALA 3K1KC 4P4RB 3TFKC 2OR9H 3VGFA 2E7HA 1G9MC 5JXEA 5L0QB 4ZQKA 3U30C 1INEL 1KB5A 1N26A 2XN9E 2HJKA 3OZ9L 4OD2A 4PREA 1EFXD 2QHRL 3IGAA 5F7HA 1IC5H 3HUJA 1ZT1A 1DFBH 3THML 3I6GB 1KPRA 3GJFA 3CAFA 3O2WL 5CZXD 1N6VA 3BAEH 1YEIH 5DHXB 1HKLH 4YEFA 5DA4A 1Z9MA 3QCUL 1U8OA 1WISA 1OF2A 4MDJA 4U6XB 4NYLB 5IVZB 3L5HA 3WUZA 1LE5A 3HE7D 1QUNA 2J88L 2XKSA 5FKPB 4KY1H 3GKWH 4ZO8A 1AP2A 2DL9A 5D93B 3EOYG 4DW2L 3HPLB 4LF3A 4OZFA 1LO4H 2R0WH 5LBSL 1WIUA 1U41A 2QSQA 5JZ7C 4N1EA 3PE9A 1T03H 2A73B 4KKNA 4QXUH 3C8KA 3PWPE 5C9KA 5ESVB 3GJEB 4L8DA 1CG9A 2NY2D 3MRCB 3C5ZD 4ZO6A 2L7UA 4JFFD 4UT6L 3WFDH 3WHE1 3R0MA 4ZS7L 1EDQA 2XWBA 5IFHH 1NGPL 1EXUB 4CNIA 5F89B 1PX4A 4K3DL 1NFIA 2YWZA 4DN4H 1EAPA 4PRIB 4M5ZH 1B4JL 4HKJA 1CGWA 2R2BB 3AMLA 3OBAA 5DD5H 1MHCA 2BVOB 2C3WA 3TESA 1CDUA 1GZPA 3T2NH 1AY1L 4LQFH 2Z31D 1JHLL 1P9MA 4MCYB 4WUUB 1A9EA 1IC7H 4HLJA 2DF3A 4XNMA 3MA7B 4MWFA 2O5ZH 3LQAL 2E7BA 3L5JA 3NVQA 2DWDA 4IOFC 2RHEA 25C8L 2JJVA 4UAOC 1NJ9B 5CJXA 1JNLH 3RVTC 3ZYOA 5FUCE 2EKSA 1W0VA 1G9EA 1ZWIB 3B5HA 4GMTL 4M7KH 1WFNA 2XICA 3ARED 2V7HA 1SY6L 2I25N 3RGVC 5T33H 1VA9A 5HHQB 1VKXB 1ZANL 5I71C 1ZT7B 3P73A 3X12B 1N3NB 4LVNC 5I1LB 2A6DA 3WXVL 3MUY1 4GFTB 5DVOA 3PP4L 3QEQB 1KJMB 4LEXL 4OCLC 3RPIA 3BKCL 3QEGH 2VZUA 4FQLH 3OKLB 2F58L 3FRUB 4QWWC 3VMOA 5DJ2A 4QXTA 3LB6D 3IDGA 2UY6A 4YR6B 1ZHNA 4IMLB 1OW0C 2ZOKA 3REVA 1WICA 5ALBH 1GH7A 3DURB 1OSPL 4LFHD 2ZUUA 5J06A 2FHCA 1FH5H 2LVCA 4X5XB 3D25B 2JE8A 5BV7B 1P7QB 3BWAB 1XZ0B 1ZA3B 3BVNA 1MLBB 1OAUH 1NUFA 4U1SB 3HE6B 2AV1B 4PRBB 3W9DB 2LAGB 3OGOE 2NZ9D 4RAUB 1NGZB 2X44D 3GMRB 1CICC 3WHXA 4GAFB 3VXUB 4G8FA 1XF3B 3D9AL 2NR6C 2RQ8A 3O11B 3WSQL 1OARH 1ZHLA 2JCCB 1JHTA 2VXUH 3B9AA 5JHDE 1C12A 2AEPH 4PRID 4ZS6C 1RUML 2BSTA 2PCPA 3WMSA 4YFLF 5FOJA 1KACB 3BE1L 1FV1A 4P46C 5C0DB 2GT9A 5SX4I 3H3PH 4K3EL 1I3GH 2X4OA 1CLOH 1KTLB 4E41A 3QI9C 1H3TA 3ZKXB 4R2GD 2AKRA 1QSFA 3LPWA 2B0SL 5K9KA 4ENEC 4HF5H 5FKAA 2B1AL 3PL6B 1P5VA 8FABB 1NC2B 5IT2H 1HYSC 5SWQA 4F7EA 3MRKB 5KN5B 5I76A 2VRAA 5IVXE 4G80B 2EE3A 1HH6B 5EC2B 1MJUH 4ZNEE 1GL4B 4MCZA 1FNEA 4M8QB 1I75A 2AV7A 4ODTH 4Z5RA 4G6FB 2BHYA 4JFHE 3O9WB 4XNZC 1B88A 4S1RL 4OQTH 4LPVA 1AIFA 3P9MA 5MI0C 1B6UA 4Y1AE 4WVRA 4AG4H 2B5IC 2XIDA 3PP3H 4M8VA 2PKDA 2O61A 3EOBB 1YMMB 1IT9L 3I84A 1KCVL 2AXFB 4X7EC 1F4HA 2QSCH 4U1IA 1LK3L 1GGUA 3V7MA 4PV9A 5JOEA 4JKKA 4JG0H 4OI8A 1JMZA 4NHUB 4BUGA 3M17A 5ANMB 2ICEB 1OTTD 2IG2H 1KF9B 3HE6D 1KJVB 4HULB 1QBLL 3O0RH 4JRYE 3QRGH 4JCMA 3JZ7A 1EERB 3VXUD 3QHZL 1CT8A 5FM5M 4MXWH 4RMQA 3VXMB 4Z7VB 1KB9K 3UYRL 3TPUA 4ZG1A 3MV8A 1M7DB 3FONA 2R1YB 1FZMB 3BEWB 3VFMA 3BX7C 1XF2B 2DLEA 4NHCH 3MRMB 4ELME 4BH7A 1PYWA 1CFSA 5IQ7H 2C5DC 4XRCA 5CBAB 2PXYC 3QUZB 1KCKA 1MHEB 4XVJH 4PP2A 3QIWD 2DM7A 1N0XH 1EMTL 4P2YA 2OX5A 1ZLUK 1ROWA 3OAZK 5CKGA 1F11A 5BRZB 1JWMB 4JM2F 5F9WB 1UFUA 1TJIL 3T0EC 5H35B 1PY9A 2MQCA 3DV6A 1RK0B 3CJJA 4P99A 4MJ5A 4EI5B 3C09B 1G7MB 5CIPA 3OTTA 1KYOK 1DZBA 3ARFA 1V7ML 5JXAL 3OL2A 2DMCA 4LKCB 1YQ2A 4KUZL 1IGYA 2J8UE 3TA3A 2EDHA 5EBWA 4R8WH 5FIEA 5HVHB 3QULB 2DJSA 4P2RB 3GIVA 4PLKC 5I8CA 1X5HA 2X4PA 1MNUH 1P6AB 2WBJB 3FTGB 4FTVE 5D6CA 3BGMB 1BVZA 1RPQA 3QUYC 4U0QB 3UEZA 4FQJL 4RRPA 4AT6B 3JWDH 2HWZH 4HUWB 3GBMH 3SQBA 4KJYA 1BJ1H 2CKBL 2AEQH 2F53B 5AUMB 2YA2A 4MB5A 1IC1A 1H0DB 4P2OC 5TPWH 4N9GA 4OSUH 2DTML 1Y18A 4MNQA 3EYSH 1MIML 1A8JH 2R1XB 5EO1B 3DMMC 2NW2B 1DL7L 2AABH 2PTTB 1Z5LB 3RIFF 3EIFA 1PFCA 3LN5A 2XXMB 1JGEA 4PJ7E 5FYKD 4PJGF 4M03A 4XVSL 4WV1B 1RJZB 3NA4A 4NN6C 3SKNB 2X4SB 4M5YL 4LHUA 3VXMD 1BBJA 3DXAB 4OD1H 4XBPA 1VGEL 2CDGB 2YUVA 3VGAC 5E8OB 1VB9A 1I3RB 1I1RA 3CDYA 4KXZH 3ILPA 4X7CC 3ALWA 3O2VH 3GSUA 3OAUL 4CADA 1GGCH 3HC3H 3BDYH 4UIKL 3C5SB 3D2UD 2Y72A 3U9UA 1FLTX 3ZT6A 2HVJA 3T77A 4KDWA 4HEPG 4N9OB 4RFEB 1M05A 3LPGA 3VRLF 5BRZD 1BWWA 3G5XA 2HJFA 1MRFH 3BP6B 2X4QB 2R0KH 5TDPB 1U91B 4PRHE 4F8QA 4XAWH 4KMTH 1NGQL 4HXAL 1U0QA 4GAYB 3D39B 4OV5A 2UWEF 5FGBC 5DJ8B 1U95B 3OXRA 3KJ6L 1ZS8A 2RCSH 1EHNA 5T1KB 4KV5E 5B3NA 3F7QA 4IRJB 3FFDB 4KJWD 1J10A 5FHBH 3RBSA 1I3VA 3T09A 4ZOAA 5BVJA 3EFDH 1MRCL 1FL6A 5E7BA 4X6FB 2Q8BL 5BMFH 1WCQA 5GQBA 2HG5B 4XPGL 2E7MA 1NGXB 1NDGB 3RRQA 4P5MB 2F53D 2VDQL 2BJMH 4GUPA 4JM2D 1MRDH 4WI8A 4NC0B 1J11A 5FYLL 1WVZA 1QSEE 2L7JA 2V5SA 4AIZA 4NDMA 4K7PX 4D0BB 5SWZE 3WO4B 5BCAA 2D31B 4K7PH 3S88L 4OKDA 4L3CA 1EFXA 2UWEB 3IFPA 2QKIB 4W6YB 2DAVA 3EDJA 3HZYB 5CS7A 2EKJA 2FYYA 1YJDL 1BZ7B 4KZEH 2YPVH 4N5EC 4N90E 5GS1A 4O00A 1LP9F 3RDTC 1XR9B 2YHGA 1Q0YL 4GW4A 3FRPA 2NYYC 3VH8G 5EB9A 3BUYB 1A7NH 4AEEA 3HE7A 4XHJD 3IFLL 4OB5H 4WWKB 1N2RA 5EU5A 4OZIE 2VZOA 3DX9A 4LQ1A 4AIOA 4X6EB 4APQD 2DI7A 4JPVH 2WBWB 3EHBD 2BVEA 3KHQA 1KLUA 2Y06L 4KMLB 4MA3B 4TVPL 4AQOA 3HUJE 3VMNA 5GGQH 2ZUWA 3BN9C 3OKEA 5TGBA 5CD3A 2A77H 1NC4A 3C5ZA 4JFFA 4QYOB 1OWRM 5IHUL 5DR5L 3V6ZA 2VXVH 5IMOA 1A3LH 1LP9B 1J86A 3Q6GH 3L5XH 4JKMA 1RJCA 3KJ4B 5C0RL 2NR6D 2NY1C 1KTRL 4QRRD 4ODHH 3P0VH 2Y36L 5HHPA 1QNZL 1VPOH 2XQBL 3CPLA 3PWLA 2NZIA 2Z31A 4YLQT 5IW1B 4OZHE 5ID1B 2X4RB 3OR7B 2YS4A 1DANU 4WW2A 1RURL 5CJ8A 5DZLA 1T3FB 5D2LA 1K4CB 2IAMB 5I6XC 3EYOB 2X4NA 1GPOH 4P23D 2JELL 3GRWA 3S35X 4GRWB 1AQKL 4M7ZC 5GGRB 5T3ZE 3S35H 1T7ZA 1RU9L 4H8WL 3MLWH 1NLBL 3JWOL 3A6BH 3BP5B 3I6GA 5HYJE 3IAGC 3U4BH 4M6MH 3V5DB 5GGRY 3V6OA 1GGIL 5FDWA 3CFDA 2BY0A 1MF2H 5DRWB 2K3TA 3SDYL 1FVEB 4P5TC 4U6XA 2VAAB 5IVZA 5FKPA 1G9NC 3P9LB 1S7QB 1YYMH 3FJTA 3WNLA 1A6AA 1EJ6A 4NZUL 1UM4L 2G75B 4PG2C 4Y4HC 4X6CF 4RISL 4JO1H 3A0OA 1SM3L 2NTSP 5BW7C 1T1YB 1N59B 3U7WL 1AGEB 4YDLC 1NCDL 5FDYA 1RUPH 1T1ZA 3EOAA 1QFWM 5LBSH 3GJEA 2VLRB 1Y6NR 3Q0HA 3SGEH 1D9KD 4GKSB 1KB5H 4NKOB 4WW1B 5F88B 1OL0A 1EXUA 5F89A 1C1EH 1JRHL 2Z9TA 5CLTA 5E4EB 2PO6C 5JW3L 2DM4A 1JPFB 1MPAH 4PJHF 4PRIA 5L88L 1H8SA 2R2BA 3QCVL 3GMLA 3T08A 2FBJL 1FAKT 1JVKA 4TUKH 3H9SB 5HXMA 1UENA 4WUUA 4MCYA 4LP4A 3MPCA 3U0WH 4L8CB 2FGWL 3QQ9C 4FZEL 3MUZ1 3MA7A 5EU7C 5HY9B 3F6LA 4CN1A 2A9NH 3T4YB 2VO5A 1ED3A 5DTFB 3CFBB 4G9FB 4NUGL 4K55A 4LCIL 1NJ9A 3H7BB 1FRGL 4Z76B 4H1LB 4FG6C 5CGYD 1RZKC 4OZFH 2F5AL 4OF3A 5LGJB 4JFOB 1PEWA 5BS0B 5F3BB 1IKNC 1BGXL 4FQPA 5HHQA 3RBGA 5IGXL 4PJHB 3F7VB 2E9WA 2W59A 1ZT7A 2J6EA 2OP4L 3KYMB 1N3NA 3X12A 5I1LA 1OTUC 3TGXA 4LRNL 1JJUA 4NQCB 4U1KB 4F9PC 3CXHK 3QEQA 1KJMA 4G6AC 4PJXB 5C0NC 4PRAA 5T5NF 5T3ZH 3T0DA 2R8SL 1MAML 4E41E 3OG6B 3QHTC 2FATH 4N0UA 3HFMH 4WO4B 2D4FA 3OKLA 2HP4A 1HHKB 3FRUA 3B9KB 3MRHB 4NRZB 3S34L 4XC3L 4YR6A 3JWNC 4AM0B 5D7LB 4IMLA 1CDJA 4AL8L 2F58H 3DURA 1A6TA 1AGCB 4QNPE 3WE6A 4X5XA 2FH8A 3D25A 5E8DL 1P7QA 1EEYB 2CK0H 2HYMA 2FH6A 2Q20A 1PD6A 1T04B 3BWAA 3ILQD 1ZA3A 2UZIH 1LILA 2BHZA 3HE6A 4PRBA 4Y4FB 3W9DA 5CUSL 4JHAH 3BKMH 2NXZB 3CX2A 1U8PB 1NGZA 1N7MH 4L4VD 4RAUA 4HGWB 3GMRA 3IYLW 1Y0LB 1GGBL 3VXUA 1XF3A 2OQJB 3H9YA 5EU4B 4L8SC 4WI3A 2JCCA 2MPAL 3SE3A 3T1FA 3H0TB 4NCDA 5EZIH 5K9JL 1CTNA 4X4ME 1UJ3B 1J1OH 3V95A 1YYLL 4IDJH 3O3DB 3TCXA 3H9SD 2OI9C 1KTLA 4K94L 5L9DL 5GHWL 3RWFA 4E0RB 3BE1H 3E6HA 3QIWA 3WJLC 4HQQL 2HKHL 5J89A 2FDBP 5IBUB 4S0TD 1QFUH 4NC1E 2PYFB 4U6VH 1Q9OB 3LEVH 3FQWB 3JV4B 4G9FD 3VFTA 1QLEH 4U7SA 1I9RH 4GSDH 1GC1C 3NIGF 2DKUA 8FABA 1NC2A 3MRKA 5KN5A 1NCBH 1VFBB 1G7IA 2QBWA 3IFNL 4G80A 2QADB 3GI9H 1HH6A 4O02L 5EC2A 3FL7A 3ZDXF 3JTTB 1U3ZA 3O4OB 5GS0H 4EEEA 2B1AH 3MV8E 4F15C 1LO3H 3LN9A 5F71A 1JGUH 5FOBB 4YUEL 2CRMA 3REWB 3HMWH 3OPZH 2NY0B 5D7SL 1F3JB 5DJ0B 2GTWB 4I48B 3GMMA 2V2WA 5T1LD 1IQWL 1IAKB 3EOBA 1YMMA 4KK6D 4TQEL 3U36B 3NH7L 4WO4D 4Z7OE 5AD0A 2YPKB 3Q3GB 3B9KD 3KPMB 4K9EC 2B2XH 3FAXA 3QDGE 2H1PH 2DM2A 4F9LA 2CXKA 1E4WL 5ANMA 2ICEA 2AJUH 2I60H 5LGKA 3KYAA 3MV01 4JRXE 4U3CA 1T7WA 2ATPA 3RIFK 1KJVA 2BMKB 4TVSa 5C07D 3VD4A 2BRRH 1A4JA 2Y07H 1N64H 4ZSOB 3VXMA 4HWEH 5T1MB 1HDMA 4XCFL 3VU2A 5GZNC 4AYFA 4Y89A 5DT1L 5I16B 1M7DA 1IARB 2R1YA 1FZMA 1V7NH 3BEWA 3K4ZA 1EUUA 2FL5B 1XF2A 5C6TL 4PJFF 3UYRH 1WWWX 5D70H 1XIWC 1RFDH 1XF5B 3L1OL 1MHEA 3KPTA 4MNQE 2C4FU 1K9TA 2EEBA 2ERJC 4PS4L 4QTIL 2YEZB 5D1XC 5BRZA 3CX5K 1G9ML 2VDLL 2MCPH 3U82B 4OF8A 3RY6A 3PHSA 5H35A 4GOSA 1KC5H 1RK0A 4D94A 4EI5A 1GXEA 1OPGL 1WZ1L 1G7MA 3MCKB 5KVFH 2RB8A 2H6PB 4JO3H 4LKCA 3SGKC 2QADD 5JOFA 1NCTA 4PGBB 2QV2A 1U8LB 3P4MB 4L8BB 4JQXC 4JHBA 5FUOH 2EIBA 3QULA 4P2RA 2VE6B 4WNQB 4J2XA 3FO9B 3SE9H 1JNJA 3DRTB 5E4IA 3TO4D 2CKBB 3TN0C 2WBJA 2ADGB 4HWBA 3MGOB 3FTGA 2W1NA 4A6YL 4QT5A 3BD4A 4AT6A 5IB2A 4XCEA 4HUWA 2A6JA 4CVZB 3EDKA 5FYLE 2GK0B 4K23L 2J8OA 4WTWA 2F53A 4JM2A 3U0PB 3R1GL 4XCNB 1JMXA 1H0DA 4JREC 4LPCA 1L9MA 2GJ6E 3TT3L 5KVMC 5GS3A 5EO1A 2E8YA 3BH8B 4HUNB 1XGYL 3LN4B 4DWHA 2ZCLH 5HGDB 4NJAH 1ZEAH 1Z5LA 2NY3B 4B50A 2A9ML 3MLUH 3U83A 4OD3H 1CF8H 3DTXB 4WV1A 2MWCA 5CIPH 4JLRB 2YA1A 3SKNA 2X4SA 1BFVH 3DXAA 3WS6C 1OLLA 4FXGB 4KTYA 3NABL 4LAJH 4XVSH 1NFDF 4MDIB 5E8OA 4HH8A 4NNYB 1I3RA 4HFUL 1DEDA 3JTSA 4R4ND 5E99L 3GDBA 1EVUA 3HLAB 4LLWB 1JE6A 3C5SA 4ZOBA 5B38G 1IAIH 4KHTH 4XVTH 4NIKB 4UTBH 4RFEA 3H2WA 4M1CD 4PLOB 4DFIA 1IGIH 3LDBB 4J3OC 3BP6A 2X4QA 3F12B 1U91A 5TDPA 4W68A 5IUSA 4LCCB 4PJGA 5DUPH 5IMLA 4ERSL 3E8UL 5I75B 4KRPB 5D1QD 4GAYA 3D39A 5ICXB 2ADJB 2R56L 3L95A 1KEMH 1U95A 1FSKB 3ZE1E 3QIUC 5T1KA 1MHHB 1NFDB 4Z0BL 4KTEH 3QUKB 4XVUD 4WFFD 3FFDA 2AW2A 3V0AC 2NY6D 2G2RB 5C7XH 2WK2A 2BSSB 3P4OB 4U4BA 1JHKL 1HH9B 2YD6A 4L3ED 1IBGH 1R5IA 1FVDB 4RFNB 4PJ8C 1R3IH 5LJYH 4L9LB 2WUBL 4X6FA 2OL3H 1BVLA 4Y0GA 4K71B 1ERNA 3P77A 2VLJB 3AS1A 1NGXA 3KLDA 4NN7B 5JOPD 4FQCH 1T7VA 4A2LA 2Q8BH 3QXUA 4JFFE 2YRLA 4D0BA 2YXFA 1D7FA 4WUKH 5FYLH 2UWEA 4YO0B 1SJXA 4P59L 4XMLL 5DDHB 4URTB 3PGFH 5IHLB 3ELAT 2C1OB 3S88H 2E6PA 3HZYA 3QDJB 1BZ7A 4H88H 3MACH 2VWEC 4JG1H 4MGXA 1XR9A 5EG6C 3SDDC 2DQFB 3M07A 5DMKB 4PYHA 1CBVH 3TZVB 3DO3A 3BUYA 3O4LD 5DMGC 4HBCL 2VLMD 1WLHA 4HUXA 4TULH 2F5BL 4WWKA 2AERT 2O26U 4NPYB 4CU7A 1KBGL 4Y7MA 3QHFH 4O5LH 4X6EA 1I9JL 1RUQH 3IFLH 1KPVA 1T89C 2BVYA 4MA3A 2VN7A 1ZGLM 3C08H 2HFEB 3RX7A 3IDXL 5T3XL 1XCQB 2KDGA 1IGMH 1DBMH 3D69B 2Y06H 3MJGX 3V6OE 1OM3L 1CK0L 4QYOA 4PJ9B 1LP9A 2BK8A 2WZPD 1V3LA 3QBTB 1TETL 3G6JF 3HZVB 1T0NB 4DUWA 1UM6H 3JXAA 4U05A 4OCRH 2CUHA 5D1ZD 3MX0A 5C0RH 3MNZA 5L6YL 3CFIC 5IW1A 4KQ3L 4OM1H 1NMBL 4NT6B 1I7RA 1S7TB 5ID1A 3UBXB 2V7NB 4BZ1H 2X4RA 4Q58C 3C2AH 3MREB 1OAXH 3OR7A 4PJAB 4WY7L 1YPZF 4ODSL 4PJDF 1T66C 3BPCB 1K4CA 1WZKA 2FRGP 2IAMA 4GG8A 3EYOA 3UJTL 1IKFL 2D7TH 1F3RB 3NGBB 2AI0H 4Y5YC 4FFYL 5GGRA 3TH3T 1QP1A 1C08A 4YE4H 1NAKL 3AS3A 3T3PF 3NAAH 4HKXB 4PRIE 3G6JB 3SHSA 1F4YL 3BP5A 1AQKH 3X14B 4QRTA 4HC1A 3QDJD 2VKWA 3V5DA 1ZTXH 3TBSB 4X7TA 1KTDB 1S7RB 4LVHC 4Q0XL 3WUWG 1GJIA 1FVEA 3S5LG 2VAAA 5DD6B 2HFFB 3BKYL 3CDGB 3P9LA 1S7QA 3I85A 3I2CH 1YPZB 5AZEL 4PJDB 3RQ3A 4WIQA 3QDMD 3GMPB 1KN4L 3W39A 1UM5L 3KPQB 2MKWA 2LQRA 3OF6D 1T1YA 4LSTL 1AGEA 2W65A 4J1UB 2QLVB 1RAMA 4QO1A 1U3HC 3FB7B 4CN6A 1ZAGA 4EUPG 2DJUA 1S7XB 3UYOD 3IJSB 4ORGB 2VLRA 5TE6L 5CCKL 3QWOB 3GRWH 3U9PL 4RCAA 4GKSA 1NCDH 4NKOA 4WW1A 5F88A 1LGVA 4N0UE 4QRPD 3U4AA 1CGYA 3BGFC 1JPFA 3WCYA 4F7CB 5I74C 4LPUA 2H8PB 2N4IA 5A43C 4DUVA 5B4MD 2EDDA 1MFAL 3H9SA 2ITCB 3RZCC 4X6CA 5CZKA 4L8CA 3S98A 5HY9A 3SDCB 3SY0B 5C9JB 3UTZB 4OLWL 1BQSA 5E6IB 3QRFM 3T4YA 1EGJL 2JIXD 3CFBA 3JVGC 1SY6A 4G9FA 5SWSB 5L7XL 3EOTH 4Z76A 1J5OL 2HTLC 2P4AB 3VXUE 4X4YB 2OK0H 5CBEB 1E6OH 5LGJA 5J1AB 4JFOA 4XP9L 5GISL 3HS0B 5BS0A 5DUBB 4PY8I 4PJHA 1INDH 5JQHC 4WENB 4WI9A 3RA7L 1EHLL 4M1GL 4NQCA 1K8IA 5FGCB 4U1KA 2GSIB 1P84J 4PJXA 3ES6B 1YEKH 1J1PL 5T1LA 2XWJA 5T1DH 2BXZA 3HG1D 3LS5L 1BJ8A 4WO4A 1I4FB 1HHKA 3CUPA 3B9KA 4NRZA 5CEXB 3NMEA 4NO3B 5DD3H 5D7LA 3JSSA 4OF7A 5D6DA 2DQUH 1CL7L 1J0YA 1OAZH 1AGCA 1TQBB 2ADFH 1EEYA 4MJID 4IIQC 1T4KA 1PX3A 4B41A 4Y4FA 5FEBA 3QQ4B 4I18C 1U8PA 3MLZL 4OCWL 4HGWA 4PB9H 4X98B 1HXMA 2OQJA 4MLIA 5EU4A 3QEUB 4TPRH 1HI6B 3ORJA 3H0TA 2CIIA 4KDTA 3CFKB 4XXDB 2EC9U 2VDKL 2Y25A 4MQ7B 5C0AD 4YHML 4IRSC 4KXZI 1UZ8A 1UWGH 4OF0A 4AH2B 3AAZB 3O3DA 4ZUVA 3CMGA 1F2XK 3MYJB 4ESKA 3EJZD 3S97C 3IDMB 4FFWD 4X6DF 3S6CA 1Q9OA 5GRVL 1KEGH 1ORSB 3BJLA 3EJJX 3NIFF 3FQWA 3ARYA 3JV4A 4TSCL 3GSVB 2P47B 1R5VB 3MCLL 5FYKE 1TDQA 3F65A 3LQMA 2D7OA 4R7NB 4JZJB 3FZUD 1JTPA 1VFBA 3VXME 1T6WA 3GSWA 5IMKB 3JTTA 2F8OA 4RA0C 4QXGL 5FOBA 3REWA 3IFNH 1X5ZA 3NPZB 5DJ0A 5GGTL 4GT7A 2XG4A 5ALCH 4I48A 2W91A 5B39B 3WFBL 5EBMB 1BIIA 4BM7A 3U36A 3OQ3B 5F7LB 2EXWD 4XBEH 3RX5A 3QIBD 4LU5H 3TIEB 3E6FB 1UA6H 5BRZE 2YPKA 3Q3GA 2PF6A 4ONOA 3KPMA 2IBGA 3MLXL 5DVKA 5E2VL 2E8ZA 3QAZC 2VSDA 5E5MB 1ZGLB 1J87A 2X40A 2ICES 2CKNA 3KS0H 1UYWL 5E9DB 5BZDB 5DFTA 4DGIL 2DQCL 1WT5C 2NLJB 2BMKA 4KKBD 2DLTA 1WWAX 3BI9X 5LXGL 2IANB 5CHNB 4ZSOA 2QSVA 5T1MA 1K3ZA 4G7YL 5D72H 4FZ8H 4LEOB 4JHWH 4R4BB 4BSVB 5JNYB 5I16A 1NLDH 2HT4C 2GAZA 1QHPA 5DRZB 3WIHL 2W9EL 3Q1SL 4I9WD 2F53E 1RZGA 4MA1C 3VFNB 2AJSH 1JZ5A 2FL5A 1KELH 4JR9L 5ENWB 1U36A 1W0YT 1XF5A 3U30B 1XGPB 2KL6A 5C6TH 2Q8AL 2YEZA 3RPKA 4Y4KC 2VXSL 2FSEB 4RFOH 5DHVB 4FQXD 3RL1B 1GAFH 5F1SA 1ONQB 5GGUB 4WJ5A 4HEME 2H2PD 5BQ7B 1NEZG 5B8CA 3ARRA 3MCKA 5AG9A 3AM8C 5DQDL 3GK8H 2QQNL 4N8CL 3LSOB 2NX5B 4PGBA 3LEXB 3O81A 3P4MA 3MRNA 3UC0L 2EZ0C 3FN9A 4L8BA 4A6YB 2XQYK 5FYKH 4G8IB 4I0PC 2VE6A 4MZ3A 3B43A 3FO9A 2IF7A 4U7MA 2APVA 2CKBA 4PJFA 3B8YA 2ADGA 3MGOA 3HI6L 4PBXA 1G9NL 1XFPA 5T5FH 2BC4B 1JPTL 5E2WL 2HMIC 1F3DJ 2DBLL 1CD0A 4CVZA 1WBYB 1FBIH 2GK0A 4WI2A 1FZOB 1CLZL 1ZSDB 3U0PA 4XCNA 4XWGL 2OJZL 4PJGE 3MNWA 3ZE2E 1NKRA 4J3XA 3VG0L 1WJ3A 5F7DB 3U6RB 3BRFA 5DJZB 5D8JL 5SX5K 3R06A 3LN4A 5E9DD 1S5HB 3HPJA 4QRRE 5GJTL 2YUWA 4BA8A 4P9MH 3FQXB 2EXYD 3DTXA 3AXLB 4AEHL 5HHXL 4JLRA 2E7LC 2QQKL 1J8HB 4HXBL 3S3PA 3DBXA 2A9MH 3K4AA 3QUXD 3LD8C 2FHFA 3O4LA 4FXGA 1MAKA 2F54B 4MDIA 5HPOA 3EYQC 3VRLE 3BPLB 4NNYA 3DX7B 1SVZA 2CDFB 1S78C 5HI3D 1MFBL 3AMKA 3J7HA 4HWBH 5L2KD 5E8NB 3WD5L 1FYHB 3HLAA 4P3DB 4LLWA 2IH1B 5C09B 2GITB 1ITCA 1INQB 1FLRH 5C92A 2D9CA 4LVEA 2Z91B 2X70B 2UWEE 5CWSA 5I18L 4M3KB 1IMHC 5I71B 1RZKL 4LVNB 3V4VH 2R69H 4YX2L 5KZCD 3F12A 3MGAA 4LCCA 3OKDA 4FQ2H 3MNVB 3SGEI 3SGDH 4O2FB 3D0LA 3N9GH 4PY8J 5ICXA 1GGYA 2ADJA 3ULVF 2NX5D 3O6FD 4BUHA 2VISB 3MRJB 1MHHA 1NFDA 3QUKA 5DEGB 4CGTA 2G2RA 4N1HB 4PTUB 2BSSA 5D1ZA 3P4NB 1HH9A 1DQJA 2DYPB 3VW3L 1TNMA 1UEYA 2P7TB 2EE9A 3OMZA 5A1AA 2FX7L 12E8L 1BJ1J 3MLTB 3CXDL 4RDQG 1NAML 3SQOL 2YD7A 1RIHL 3GMOB 2EDEA 1CICB 1FYTD 3OV6A 1LP9E 3HNTL 5DK2A 4ODWA 3QB7C 4HH9B 4YO0A 5DDHA 2XKNA 2MCG1 3UTTB 1J0HA 1D6EA 1U93B 4P46B 4HG4J 5ETUB 2C1OA 5DUML 3QDJA 3BO8B 1ZGLP 4P59H 1T0MB 3IU3B 3QNXA 3QI9B 4TSAH 2EIDA 5DMKA 5E5RB 5ERWB 2B39A 3TZVA 1AGFB 1MCDA 4LASL 3AUVA 3AU1B 2VLKD 4ZUTB 4WGVB 3MLVL 4BK4A 1YA5A 2YA0A 5HDQH 2YN5A 5IB3B 2EDNA 1A21A 2AP2A 5EOTB 3WLBB 3U7YH 2UZYB 3OF6A 2HLFD 4KKAC 1HXYB 4UOJA 5KS9B 4JFEB 2JJSA 1GC1L 4HLZG 5JW5B 1REIA 4WWID 3ARVA 2HFEA 5ILTH 3K81A 1FZKA 1XCQA 4LOUC 2AJYH 4OLYL 3F7YB 4M6OL 2B5IB 5KANI 4PJ9A 3G5ZB 4QRPA 2J2ZA 1RZ7H 1KUMA 3HZVA 3FB6B 3D5OF 3RWJB 3VXPB 3O6KL 4GRLB 1TXKA 4W81A 4NNXB 1BVKA 2XRAL 4H0GA 4RDQF 1M6OB 3SEPA 3QQNA 4S1DD 1S9YB 1W0WA 4FABH 1LO5A 5CZVL 2V7NA 5I8KL 4M1DH 4IDLA 1CZ8H 5IB4B 3TBTB 1A6WL 4K9EL 4I0CC 1NMBH 1YEGH 4PJAA 3DUSB 4X6BB 3BPCA 1BECA 4BFGA 4NZJA 1BQLH 4L4VE 1VACB 5F9OL 1U8KA 5I8EB 1G7QB 4BKLB 2YSSA 3VGBA 3BIAX 4C56D 4LLDB 3ULVD 4HKXA 4QKXB 3G6JA 2GK2A 1SHMA 1A1OB 1QBML 3QPXL 4U6HB 4NO0B 1ACYL 3PQYB 3X14A 4UT9H 2HA1A 3TBSA 4I4WB 1CLYL 3H9SE 4LRIC 2GFBB 4X6CE 1KTDA 4LARH 2BVPB 3ARGC 2PXYB 1UEMA 2FEDD 4UINH 3NFPB 1FE8L 2HFFA 3CDGA 1ETZB 3GMNA 4JGJA 4FQ1L 5TQ2L 1C8PA 4G9FE 4L4TB 1YPZA 1DVFD 2D7QA 4PJDA 3T0EB 4HS6B 3UDWA 1X5KA 5INDB 3JUYA 5TE7L 1P6FA 2K1MA 5FUCC 4ZDHB 5I30H 1KPUB 1KN2L 1OAKL 4W6XB 3B83A 3RTQC 4JFED 1N5YL 1EAJA 4PJHE 4ODUB 3FB7A 4HUVA 4ORGA 2OR7A 3QWOA 5DGRA 3L7FB 1S7UA 3IS1X 1KT2B 2ITDB 5C0BD 1JPSL 3QUYB 5ADPH 2XZQH 1NCCL 5CFHA 3KR3L 4NZDA 4F7CA 1MCPH 1RIVH 2H8PA 4GRLD 3RNQB 5C0AA 1ZHKB 5L8KB 1A7OL 4P2OB 2JK5B 4UQ3A 2ITCA 1IGCH 4XNYL 2IGFL 4S1SL 1EZVY 4KJQC 3IJHB 3GSXB 4NO5B 3SDCA 3SY0A 1EZVX 2VXTH 3UTZA 5C9JA 5E6IA 4Z7UF 1FFPB 2QL1A 4J8RB 1BFSA 3OJ2C 4G5ZL 1QYGL 5I1DB 1GZQB 3WFCH 3IB4A 5GZOC 1XMWA 5C07E 4PUBL 1P7HL 5D7IB 5D7JC 4LVOC 4NN6B 1QPXA 4L5FH 1YEEL 4X4YA 1EGJH 2IBZY 4HX1B 5J1AA 4LPTA 4YHYC 1MHPL 3WKMH 4EIGB 3HB3D 1OWWA 3V8OA 4U2YA 3T0AA 2E5EA 3PQYD 1JUFB 4ZFOA 3INUL 3U46B 1JYVA 4XP5H 3U79A 2GSIA 1EEZB 2RFXB 1T83A 3ES6A 3B8SA 2WW8A 3SBWC 4M1GH 3CFCH 2FJFB 2MQ3A 1AI1L 4MD5B 3O3AA 5D96B 5CEXA 2R0LL 4NKIH 4NO3A 5F7NC 1QO3B 4I1NB 4JVWA 4OV6F 1FIGH 2BY1A 5I2IB 2BVTA 3CGTA 3B9DA 3H6JA 3WUWA 2HRPL 4NZRL 2Q87A 2J4WL 3JWDC 5HGAA 5DS8B 4J7RA 3Q5YA 3QQ4A 3RWDB 3OX8A 5HYFA 4PLNC 1TVBB 3U1SL 3CSYB 1LWRA 3QEUA 5FXCH 1EJOH 2DQIH 1HI6A 1RMFH 1SJHB 2A74B 3MLZH 3F6IA 1P5UA 2IPUG 3UXFA 3CFKA 3FQNB 4ZFFB 4MQ7A 4U1GC 1ZVYA 3OWEA 3EYUH 4AH2A 3KLAB 3P40A 3DGGB 3L3KB 4AK1A 3NIGE 3BQUC 2VDKH 3GO1H 3FT3B 3C6SB 1T7YA 4W4OA 3IDMA 3HKFA 1XCTB 3ZDXE 1IAII 1M7XA 3GSVA 2A38A 1P4BL 1R5VA 1ZLSL 5HI5C 3CMOH 4JKPL 4R7NA 1Z2KA 4PGZA 2HVKA 2OZ4L 1AO7D 4KI5F 4ZSOE 3RDTB 1WCBB 2I5YL 4HMDA 4KZDH 2DD8H 3KYOB 3GSNH 5BJTB 5IMKA 4JFXB 4XTRD 1QZ1A 3LKNB 4IS6B 1A7PH 3VWJD 1A1MB 4U3XA 3A6CH 4LPWA 3GSQB 5DJYA 1HOCB 3RAJL 5K59F 5EFIB 4QXGH 2EDKA 5EBMA 1L4IA 3B5TA 5FB8A 5K9OB 2BFVL 2Z8WC 5GGTH 3TIEA 3UTSB 4P4KD 2VERN 3E6FA 1FO0A 3GUTA 1J0IA 1TZGL 4YHOH 5M95B 4LIQE 5I1AB 1JYNA 4J3TA 4QHKI 1CE1H 5E5MA 4RMWA 1ZGLA 2FZ3B 1NL0L 4YXLH 1YDPB 1BEYH 2P44B 3TVMD 3BEVB 1EEUA 1AXTL 1MFNA 5E9DA 5BZDA 3EO9H 5CJQH 2NY7L 1DBAH 2R29L 5DLML 5L8JB 4WFFE 3MBEC 2AJVH 1S8DB 4RNRA 3V7AG 3KPOB 2EC8A 1NGWB 4L3EE 4PJFE 3EZJB 2IANA 1MEXH 5CHNA 2A83B 2WQRA 1BM3H 3O8XC 1MI5B 5DQJB 4LEOA 4R4BA 4BSVA 5JNYA 5KW9H 5HYQB 4JZOA 4C59B 4R90L 3TNNA 3O3BB 5JOPE 3JV6A 4POUB 5IBLC 5ENWA 1JPST 3S36H 5ITBH 2Y7QB 4WEBL 1F4XL 5L2KA 2CO7B 3LMJH 2VNCA 5FCUH 5J13B 3VWKD 1PKQA 1MY5A 3SE8H 3DPBA 3WLWC 4IOSD 4MVBD 3RL1A 1F4WH 3IU4L 5DURB 4KVNL 5GGUA 5BQ7A 4Y5XC 4ETQB 1GSMA 4JJ5B 1UG9A 4EIZC 3SPVB 1MVUA 4G43A 1CFVH 3H42L 4P5TB 1I1FB 3LSOA 2NX5A 3QWQB 3O4LE 1IC4H 3LEXA 3VD5A 4ONGL 3DYMA 2VLME 4DVRL 3V4PL 5MENB 3UPRB 2WBKA 4ZXBB 4A6YA 4G8IA 1WEJH 4Y4HB 1OSZB 4AMKH 2ZJSL 1S9WB 3NFSL 4V1DD 2BC4A 4FP8H 2XY2A 4ZUSB 1DQDL 1BFOB 4YDLB 4CAGA 3DVGB 1WBYA 3LIZL 4JY5L 1FZOA 5C0CB 1ZSDA 3SCMD 4I8DA 3HI6H 2ZCHH 4OGZA 1JPTH 5JUEL 1FYTA 1MCEA 1DBBH 3KXFB 4X9BA 4PJ5D 3PABB 3U6RA 4KI5D 1QRKA 5DJZA 4HT1L 1I9IH 2OJZH 3ZKMD 4XP6L 4LIQH 1X4ZA 3QZWB 1NFDE 5DRNB 5DK0B 2OMBA 4N0RA 4JY4B 3FQXA 4ACPA 2EH7L 1IZJA 2A6IA 4QHUB 4EOWH 2OLDA 5DJXA 1CXEA 2P8PB 1J8HA 4WU5B 3X3FH 1T2QH 3VG9C 3VA2C 1TTUA 1HIMH 3KYNB 4Q9CA 4Q74A 3CCHA 1TFHA 3O45B 1PG7H 2CDFA 2NXYD 4DZBB 4YBQD 1QKZL 4KKCC 2ZKHH 4P3DA 2GITA 4EQ2A 4NKDB 5SV4A 2VXQH 3L3DB 3S8WA 2Z91A 3ARPA 3MUGB 4PRPD 2NY5H 3WD5H 3NPSC 2EDWA 4XAKD 3RTQD 3BSZH 3I3DA 3QDJE 3V6BR 1AD9A 5I8OL 2YUZA 1OCWH 1QFWH 2BZDA 3IETB 4O2FA 3QUML 5F9JB 2N56A 4MAYC 2H26B 1HZHH 2BY3A 1Q9WB 1N8ZB 2XWTB 1UKSA 2VISA 3IXAB 1W8NA 4DQOL 1J1XL 1IAMA 5DEGA 3SE4A 2E7CA 5F97E 3P4NA 1BJMA 4NP4H 2DYPA 3QDME 4G3YH 5DJCB 4S1QH 2P7TA 1NAMB 1U2CA 2R9HC 4F58H 3NA9H 3DWTA 3HNVH 1P4IL 3MFFB 2EDRA 4MJ4A 43C9B 5KBNC 4U1NB 3IDIB 1UC6A 4KPHL 2EYTB 3MLTA 4BZ2H 4HJ0C 1AXSB 4KROD 1P7KB 4FA8A 3QH3B 1UQSB 3GMOA 4RWYH 5I1HH 1OQOA 3BDBA 3QR2A 1CICA 12E8H 1KIPA 2NNAB 2AJZB 4QRPE 1UCTA 4L8SB 3RVUD 4OCNC 4HH9A 3OB0K 5EU6B 5I1IH 1QLRB 3WFEH 1OB1A 5EWIH 4GXVH 1CDCA 1PBYA 1U93A 5F1KC 3HNTH 5ETUA 5GRUL 4ALAL 1IGTB 5BO1H 3BO8A 1DBJH 2HLAA 3UPCA 1HWGB 5CD5D 2OI9B 32C2B 5EA0H 3IU3A 4UBDC 2WWMD 2APWA 3QI9A 4RQQA 4P3WA 3T2QA 1MWAB 3DX6B 5ERWA 3RWHB 1AGFA 2ZUVA 3LZFL 2X1WL 3ZTNH 4WI6A 3AU1A 4D0DB 4C54A 2VIRA 1DVFA 4ZUTA 4PJEF 1IGFL 2XXCB 3BKJH 5FUZL 1ZHBB 3VFSB 1A02N 5IB3A 5EZLB 1F58H 3W0WB 3D85B 5EOTA 3WLBA 4OBSA 1JK8B 3MXVH 1N6QH 4QTHB 1TJGL 1HXYA 3CVIL 5A2IH 4JFEA 5FFLA 2DQGL 3G6JE 5JW5A 4F15B 4C83B 4WTZA 1YNLH 1X5AA 3PV7A 3UYPA 3FT4A 1QR4A 1M7IB 1PLGL 3F7YA 4HPOL 3PGDB 1GC1H 1DQQB 4KKLC 1P9MC 3G5ZA 1JP5A 1V05A 2WNGA 3HG1E 3R0NA 5HHMB 5IVNA 1NBVL 3FB6A 4KGJA 4XZUB 5CILL 3RWJA 1FGNL 2ESVB 3VXPA 4GRLA 1YPZE 4PJDE 4GH7B 4NNXA 5C6WH 4O51A 1YECL 4F7MA 1M6OA 2VDNH 3QG7L 3CLEL 5IF0A 4PD4K 1S9YA 3VXOB 3H3KA 1A6VL 5JW4M 4HS8L 4X4XB 1DQML 3T3PE 5IB4A 2BNRD 2VZSA 4RIRB 3TBTA 4KK9C 4MA7H 4MJIE 4XPTL 4YXHH 5D71H 5FV2A 3DV4B 4X6BA 5DQ9B 2DIJA 3FB8B 1CFNB 3MQIA 1VACA 4ZAKD 1G7QA 4XPBH 5SX5H 4BKLA 3EO1B 5DMIL 5TQ0H 3EYFB 5K9QG 5IEKB 4LLDA 3HZKB 3GKZA 3MRQB 3RUGB 4PJCB 4YWGL 2W60B 1A1OA 4U6HA 5AYUH 4F3FB 3RVXC 4NO0A 3PQYA 4LCUA 5C0AE 3N06B 2VDOL 1OP3H 2BVPA 4Z0XB 2PXYA 4ZPVB 4CVUA 3BPNC 4ZYKB 1KLGA 5F96H 5CJ5A 1AFVL 1MCBA 3ULSB 5B22A 2EDXA 4RGMC 5D1XB 1ETZA 3RI5F 4KC3B 5GS0C 4L4TA 3T0EA 4HS6A 4XMKH 5INDA 1ZKAA 4NFDA 1DR9A 1XH3A 2PYEB 5KSAD 2CGRH 1FE8H 1X6NA 4ZDHA 3MJ9L 3D85D 4FQ1H 4OZFG 1KPUA 1XAUA 4G6KL 4MNHA 4XX1G 3HNSL 1DBKL 4K8RC 4HUUB 1VEOA 2BRQA 3EDDA 3V0WL 3MOBL 3V5HA 1BPVA 4ODUA 2D4DA 2XNAA 3ZYIA 1ZA6B 4FRWA 2FX9H 4DK3A 3WJJA 4TNWF 3TN0B 3L7FA 3CH1B 3QYCA 4CU8A 3TBYB 1KT2A 1H3PH 2ITDA 4NQXB 4JGMA 3OJMB 4PJIF 1YEFL 2FWOB 1LO0L 1OD9A 1AJ7L 1PEZA 4OM0H 4DK6A 3C6LD 4M62L 3RNQA 3T8XB 4YFLI 3RZWA 1ZHKA 2X4TB 1K5NB 2VC2L 4ZTOH 4XP4L 2JK5A 3TBWB 2J1KA 2D03H 3IJHA 3GSXA 5E1AB 1FNSH 4O4YL 1FJ1B 1FFPA 4J8RA 1E4XH 1CU4L 4XNYH 1NUGA 1CGVA 1GZQA 2Q86B 3HR5B 1LEGB 1CXKA 3L3HB 3FCTB 5BOPA 5D7IA 4NM4H 2EYRB 4HX1A 1KCRH 1UCBH 3RJDA 4PJIB 5EU3B 1I7TB 2Z4QB 2XACC 4I9WE 1DQTA 1JUFA 2FX8H 5HGHB 3U46A 2OR9L 5JA9A 4YHKH 3OGCB 2A0LC 4FNLH 1EEZA 2RFXA 5F6HI 2HTKC 2AGJH 3FMGH 4NOFA 4GW5B 1IC5L 4X4ZA 3PF2A 4P4KA 3BJ91 4NC1C 3RWIB 4MD5A 3BESR 2C4XA 3BAEL 4JZNA 1QO3A 1HKLL 5CEZD 5HHVH 2AXGA 4CBPA 3W11D 4UTAH 3TVMA 2BDNH 5EDXA 5I2IA 1T5WA 4RMTA 1MCJA 3W2DL 3QIUB 4KY1L 2P5ED 3B3IB 3GKWL 4WCYH 1QLFB 3PP3K 4BFIB 1FC2D 5FHAH 2IPUK 1LO4L 3EJYD 2R0WL 5C0IA 1TVBA 1CWVA 1BQHB 4PJ8B 2GSGB 3CSYA 4EQ3A 4RAHA 1M1SA 4CVWA 5KG9A 1SJHA 3ZHDA 2BOCB 1T03L 2IEPA 4QXUL 4X6DE 4Y88A 3QJHB 4X8XA 3FQNA 4ZMAT 3NIFE 3ARDD 4KU1A 3O6MH 3GHEL 3KLAA