3MLSH

Crystal structure of anti-hiv-1 v3 mab 2557 fab in complex with a hiv-1 gp120 v3 mimotope
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
226
structure length
226
Chain Sequence
EVQLVESGGEVKQPGQSLKISCKSSGYNFLDSWIGWVRQIPGKGLEWIGIIYPDDSDAHYSPSFEGQVTMSVDKSISTAYLQWTTLQASDTGKYFCTRLYLFEGAQSSNAFDLWGQGTMILVSSGTTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light
total genus 42
structure length 226
sequence length 226
chains with identical sequence I, J, K
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlsH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlsH01
1CFQA 3MCG1 3F58H 2RGSA 3D3VB 1T20B 4Q97A 3DX6B 4TSBH 1OPGL 4LLMA 4N90D 2OSLB 4HF5L 2AERT 3CNKA 3HMWH 4OM0H 4QGYA 2XKUA 1UM6L 4BKLA 4MA1C 1JYWA 1SBBA 2EKSA 3TV3H 2P7TB 3LKQB 1QRNE 1JFQL 3IFLL 1WAAA 3CUPB 4RBPH 3NFSL 3QEHA 3SKNB 4OFIA 4X99B 4PJIB 4GKZA 1OSZA 5L2KD 4Y16B 3MRKA 1I3RB 4WI3A 1PSKL 4MJ6A 5ILTH 3WE6A 5JO5A 3LZFH 5DXWA 3EDEA 3HNTL 5E8PB 3NCMA 5FKPB 1S9WA 2KL6A 2AJ3B 3IGAB 1AGDB 4P5TC 3E2HC 3MUZ1 3DVGA 4ELMF 4ZFOA 3TIEB 2EEAA 2HMID 3IFOB 5C0ND 2X4TA 5HYEA 1EMTL 4JN2A 3ARGB 3TBVB 1OVZA 1G0XA 3IDMB 3NN8B 3MV7E 4U4BA 3VWJC 3TPUB 3U2SA 5ICYB 4UT7L 5C0RL 5D1XC 3C60A 2NY7L 3HFML 1D6VH 4HKZB 3AS2A 4JJ5A 2K1MA 3ZKXC 4JREC 1C1EH 4R6UA 4P48A 2E27L 3EYUL 1X5HA 2BFVL 5D70L 3RWDA 3RY6A 4U33A 2EXYD 4XP5H 3RL1B 1KB9K 4JVUA 5ADPL 3MLTA 4UUJA 1S7RB 2VDQL 4XXDB 1J9CT 3UTTE 2ATPB 4ZOBA 5I30H 2CJUH 3CPLA 2A77H 3T3PF 1G0DA 3DX7A 4KFZC 2EIDA 4A2MA 2J6EA 2R39A 1A7RL 1JV5B 2F58H 3CPLB 3ET9F 1T03H 5EIQA 4TSAH 1OQXA 5CLWA 4NHUA 1WTLA 1B2WL 1CVSC 2E8YA 4KMQA 4H0GA 1VERA 2JJUA 2NW2B 2CQVA 4Y2OA 1J1XL 1JTPA 1WAAE 1S5HA 4NZRL 3BHBA 3O3UN 3SCMC 32C2A 1ZHNA 1JPGB 2F9BT 5C07D 4KJWC 4AEIH 4IS6A 4ODHH 4ZUVB 5KANG 1H0DB 4Z95H 2G75B 3FB7B 3G5ZB 5FA4A 1MFBH 5DSCA 1B4JL 3GSWA 2XKNA 3W9EA 1D5BA 2HJLA 1A6WL 3E3QC 3MRDB 3FMGL 4XCNB 4YIQB 3QXWA 3FB6A 3FN0L 1QNZH 3TZVB 3IJHB 3D0VA 3C60D 3QXVA 4LPYA 4M6NL 5TQ0H 3B2UC 1GSMA 4Q74A 4I5BB 5HVWA 3HUJA 3MXVL 5DRWB 3TCLB 1CFBA 3DUUB 4PJBF 3QIWB 1FC2D 3X3GH 4LCWB 2VIRB 2EDHA 3S88H 4H1LG 4ZFFA 4JRYE 1A9BA 1VFMA 2AEQL 4AIZB 2ICWB 4DZBB 5D8JL 5J1TC 3VWJB 5MEND 4YDJA 3IKCA 2FLBT 2R1XB 5D4QA 3MJGX 4J3SA 5IF0B 2VB5A 3WJJA 5I73B 2EEBA 4O2EB 4PRID 3U9UB 2ITDA 5A43C 3TIDB 2EDNA 2G2RB 3PP4H 2J6EH 4X4XA 1OY3B 5KG9B 4IOFC 4PLKD 4U1JB 5E5MB 4MNQD 4AL8L 1OAZL 5F7FA 1BD2D 3HC3L 3O6FD 3DUSA 2MOVA 3FKUS 3LHPH 3RU8L 1HQ4B 2YKLL 1CZ8H 3TFKC 3I6KA 4FQJH 3X3FL 4YWGL 1M4KA 5H37G 3MLXL 4NN7C 3GFUA 4NO5B 2YPKA 4WI4A 5I19L 1X9QA 1H3XA 3U4EA 4NHCH 4Z78A 3PHQA 3CAFA 1RZGA 2PO6B 4OZGF 4X6CB 2MCG1 2MQ0A 3ZE2E 2H3NA 2J12B 4K71B 4YBHA 1R0AH 4JFYA 2VTFA 3P0YL 1L7IH 4MD4A 3JUYA 5E56A 5C0BB 1EHXA 1NCDL 4J3UA 1BM3H 4HK0A 4UIKL 2X40A 5FF6A 4X5WB 5DA4A 1Y0LB 2W65A 3BQUB 1XF4B 1TPXB 4MGXA 4NC0B 5IROC 2HFEB 5CJXA 4YR6A 2DS4A 4KPHH 2FECI 3JTTA 5IMMA 3SE4A 5L9DL 2RR3A 4Z7OF 3SKMB 5D1XB 5DWUH 4JHWH 5CBAB 3QDMA 5C0EA 3IDYB 4W4OA 3OKOA 4Y19E 5TE4H 5HVHB 3JV4A 3WUWB 1NGXB 2B8OT 1F97A 3E6FB 4XP5L 2FJGA 4HIEB 4KTDL 4XX1E 5C9JA 2B39A 3ELAT 4Y1AA 2Q8AH 4EOWH 4KPHL 3BIBX 5CZVL 3CCHA 2FX7L 4QWWC 2P45B 5C0AD 2DF3A 2EYRA 5TDOB 4I2XA 4Y16D 5JIKA 43C9A 1B0WA 4YBLC 3A6BL 1PX3A 3B9KD 1GC1H 2AK4B 3ZE0E 5TQ2L 4BQ6A 5TE7H 12E8L 2EYTA 3QG7L 3KLDA 4RRPG 5K9KB 3TA3A 1F13A 1P7QB 2E3VA 2EYTB 1UJ3B 5BS0D 1QLEL 2F8VA 1QRKA 3MRNA 1Q9OA 5T1MB 5B4MC 2DM7A 3FN9A 2W9DH 4I3SL 4UT7H 2IAMA 1IAII 3MNWB 1OCWL 1HCVA 3Q0HA 2GFBB 5IKCB 4PJFB 3P9LB 5DURB 4MNGE 4MCZA 3QHZL 1PYWA 3V6FA 2YPLB 1GIGH 1CGSH 3QH3A 4UB0H 3ZE0F 1FFPA 4W81A 1EEYB 2AEPL 2W38A 5F3BA 5C2BL 1U6AH 4G8GE 5A2IH 2W91A 3EFDL 3SQOH 4MA3B 3QNXA 4TTGA 1PZ5A 5GIRB 3LB6C 3BIKA 3JV6A 4ONGL 2VDLL 3BO8B 3ESUF 4LKXB 3SDCA 2IMMA 1IGTB 2VLJA 3HLAB 2BVOA 4TUOB 4K7FB 4OZ4B 5EUKB 4YQXL 1P53A 4DCQA 2GSIB 3DO7B 5ID1A 1RK0A 1BFVH 3MSPA 3LVEA 3PDOA 4NOFA 4HKJA 5FM8A 1FSKC 5I75C 1QG3A 3FO0H 3IJYB 2AJVL 3MNVA 4Y88A 1AI1L 1WFTA 4NP4L 3VRIB 1EDQA 3B9AA 4PYHA 3SE8H 2DYPA 1I9IH 1Q1JH 4D9LL 1CTNA 1G7QA 1NEZA 4PJHB 3ZSSA 3DV4B 1QRNB 2OTWA 4OQTH 5GRUH 2BOCB 5C0BA 3KNBA 1U8HA 5LGJB 2G9HA 1R5WA 1RY7B 2DQHL 4ONOA 4IRZH 5D2NB 2VDPH 1E4XL 5ALBL 1RD6A 4JFPA 4CW1B 4DFHA 4TVPD 4K71C 4Z76B 3PJSB 3TO4A 1T0PB 2V7NB 3QIWD 4JY6B 4HW6A 43CAB 4GS7C 1DBJL 2WWKO 3AMLA 1N2RA 3NBNA 1FAIL 4KHXL 1AFVL 1EZVX 1OW0A 2XT1B 4PRDB 4YWGH 1NANI 2YN3A 3U36B 4HMCA 5EZOH 2H26B 3DTXB 1S8DA 1CZ8L 1TZGH 2JCCA 2O93L 2GK0B 4UI2A 3BUTA 4HX1A 2DBLL 4PP2A 4Z7VA 4MQXC 5INCB 4LLUA 3O6FA 3U0PA 3HG1E 1NUGA 1A7BA 5FYLL 5CP7B 2GITA 4ERSL 1AGCB 1U8NA 2GJ6D 2VLLA 3CXDL 3ARFC 5IW6A 4F15B 1IARB 3PP4L 3B6SA 4WI8A 3BKYH 2LE9A 4HXBL 4YFLI 2KZ1B 5JXED 2P5WB 5I8OH 1NDMA 4MX7B 5DJZB 5KOVC 3UTSB 2DBJA 5HHPA 2P5WA 3QYCA 5C09A 3C8HA 1CF8H 2R2BB 3BPOB 1KIQA 3G5YA 4NKDB 4XBGA 4R7DB 5JIHA 3SDDA 4V2CB 5EIVA 3VFOA 1KIPB 2W92A 2Z92B 4TUJA 5F96H 2VXVH 4XPAL 3DARA 4OCRL 5JUEL 4WWKB 5DT1L 3ROLB 2WZPD 5GXBB 2R1WB 2XZZA 1J7VR 3I02B 4OFYD 5CLTA 3LKSB 5H2BB 2R0ZL 5L2JA 1QLFA 1XR8B 4Z9KB 3QFJE 4APQC 1MCFA 4RZCB 1LK3L 4NO3B 3X13A 2PTVA 1J88A 5AWNH 3GMOB 1ZHBA 3BESR 2NW3A 1JWSB 2R23B 4I0KA 1YYML 3LEYH 1X4YA 1AD9B 3NZ8B 4P2QA 5D5ME 1N64H 3RKPA 3O8XC 4F7TB 5C0IA 2C1OB 3K2UL 5HGHA 1LHZA 3DX9B 5IHLB 3PV7A 5KSAA 5DR5L 3D69A 3PWVB 3N1QC 2VYRE 3QDME 3VRJB 3OHXA 2AJSL 5ESAB 3H3PL 3IB4A 4LQFL 2BJMH 3MLRL 3OAZK 4NQTA 1IC5H 3VGAB 4LVNB 1JPSL 2XQBH 3BJ91 4NKMA 3SQOL 2ZUWA 3PGDB 3BE1H 1Z9OA 1A6UL 1PKQA 1YMHA 4WIQA 1JMXA 5C08E 2CLZB 3RWGA 3IYLW 2VZOA 5IQ7L 1RULH 3HMXA 3P73A 3Q1SL 4X4YB 4LEOB 1RI8A 3RIFF 4P46C 3T3PE 2XN9E 3K74B 3CJJA 4JLRB 3VI4E 1CFVH 1GIGL 2QV2A 4L4TD 3TO4D 1EA9C 4JZJB 3IGAA 1DSFH 1YY8A 4MJ2A 5GSRA 4G80A 3O6LH 3ZHDA 2FEDC 2DICA 3KDMB 3RL2A 1YYLH 3MV7B 4N9OB 3TN0C 2ZG1A 2D03L 3KYOA 3NFSH 4L4JA 3UDWC 4KK8C 4KUCD 3MV7A 1J0KA 1SY6H 4YDKL 2VRAA 1FLRL 1P7QD 2HLAB 4P46A 3V0VA 4PJ7B 1NFIB 2R15A 2WLZA 5IP4A 1KLGB 5F7EL 2ICES 3OKDB 3B9DA 4JM4L 1S7XB 1BVKB 5TGBA 3DX7B 1E6JL 3MJ9L 4GW4B 2ZWLT 5DVKA 2GSGA 4XBPB 5DURD 3KJ4B 1H3WM 2BVUA 5FECA 4HH9A 1IM3A 4U1MB 2YD9A 3IT8D 4BQCA 4B0MM 1NGWA 4I4WB 2DAVA 5JMRA 4KUZL 5D7LD 1A4JA 2ICCA 1KCUH 4LEXH 3OR6A 1DZBA 5FDWA 3KYMA 1DQQB 1I7ZA 3PHOB 4E9LA 2H32H 3NIGE 2VXUH 5IR1B 5F6HI 3ARQA 5KS9F 2YWYA 3TBYB 3HMXH 3O45A 5IR1A 3UROR 2E7MA 3W9DB 3HZVA 3IRPX 5C70A 4JPIB 1MRCL 2MQ3A 2I60H 3NCJH 4PJ9A 3AUVA 3C8KB 3IXAB 5D7KD 1JPTL 1UGNA 1XCTB 1F00I 5FHAH 2XZQH 3L5XL 2H1PL 4PJIE 4ZFFB 4UIKH 4D0BB 5GGRA 3FQWA 4HWNA 4XCFH 4ZOEA 1OTTD 1UVQA 2ZSWA 3O0RH 5EU6A 4BYHA 2ZUQB 1AGEB 4RMTA 4O02H 1DQLH 3SKOB 1XCQA 4HEPG 1NCBL 1NC2B 3KXFD 1A1NB 4G7YH 5DFWH 1EFQA 1XMWA 3LV3A 2CXGA 5BV7L 4J3XA 3ARFA 3WBDA 2Z35B 5AG9A 5LXGL 1GRWA 5K9JH 4F7TA 3FT4B 5HYJA 4U1GC 3O6FC 4NZJA 2ED9A 2GJ6E 3FZUD 1CBVL 2UZXB 1QFWL 1BFOA 4AZ8A 5DJXB 2CRMA 1YMMB 1F5WA 2W07A 4X98A 2V7HA 2F5AL 1DEEA 1HHHB 2ADJB 5IFJA 3QUYD 3O2VL 2ZUXA 3ZMRA 3LKOB 2VC2H 2VDOL 4U3CA 5CKAA 2K7PA 1LK2A 3CZFA 4NKIL 4QRSA 3TO4C 3R1GH 2CLZA 1S7SA 5CEZL 1JGEA 3QQ3A 4YHNA 1MSPA 3WS6C 1VHPA 4LCUB 1S7SB 3LQMA 1ZOXA 3X11A 4LGSB 3QHZH 3M1BA 1SJHA 2A6KB 3MJ7B 1NGPH 4NFDA 2APXA 3WIFB 3SO5A 2ILLA 3MJ9A 4K9EC 3NAAL 1B3JA 3V7MA 1JRHL 4FXKA 1RZKH 4C83B 3AS3A 4XGZB 1XF5B 1L7TH 4EJ1C 1R5IA 2AABH 4Z0BH 4ALAH 2JF1A 3HB3C 3EYQC 3HNSH 2X9WA 3L3OA 3M8OH 1KPVA 1I7RA 1GGIL 5GZND 1S7RA 1IC7H 4GFTB 2GIYA 3SDCC 2AJXL 5EA0L 4WWID 2EZ0C 4RGND 5GGUB 1TJHL 3BMVA 1IGFH 4EIGB 2MTPA 1YNLH 3OKLA 2VO5A 5GGRY 2NTFA 2NLJB 5FO9B 4ZAKD 1GXEA 4RGNE 1VFBB 4J6RH 5B8CA 5FXCH 4EDXB 3VWKC 3NGBC 4PJ8A 1FZMB 1ZA3A 1A3QA 3RI5K 5C0AE 1TQBC 3QEUA 5DJCA 4OUOA 3T4YA 4HG4J 2SEBB 4U1GB 5JOFB 1QFUL 3CSYB 4NQUA 4NGHL 1BZ7A 4NDMB 3QUKA 3DI3B 5CCKH 3ZYZA 3MGAA 3VGGA 1BECA 2R2BA 1YEIL 2IAMC 3GB7B 1EHLH 4DVRL 5TE6H 3BWUC 3HAEH 3PWPB 4U1NA 1SEQL 3D9AL 1QVOB 1NAKL 1NPUA 3HZYA 2R0LL 4UNTA 3P30L 5JZ7D 1U8MB 4MZ2A 4YZFF 4N8CH 4JM4H 2B5IB 2R1YB 4OJFL 3L1OL 1V7NL 5DZLA 4GAFB 3MPCA 3O4LE 1BVLA 2R1YA 4LHUB 4XMLL 4TSAL 3BN3B 3GJEB 3X12B 2QEJA 5D96C 1ZLSL 4PJHE 2VLJD 2EIZA 4RDQF 3D0LA 4CRPA 5KW9L 4LPCA 2CRIA 4CNIB 2NZIA 2YZ1A 4OZFA 1I7TB 1OTUD 5IEKA 3KPLB 5E4EB 2APTA 4WHTB 5INDB 5EIIA 5B39G 3PWUB 3UAJC 3Q1SH 1IKNA 4M61A 5HHXH 5F70A 4X4XB 3BP6B 3MLXH 4G9DB 3OKMB 1U58B 1T7WA 4GRWB 2PW2A 2EYSB 2LV4A 3UTQB 3ZYJA 5F89A 3SDCB 3QUXD 1HYSD 4UOW1 8FABA 1QPXA 5KANI 3BEVA 1JUFB 5IFHL 2VLRB 5I2IA 2NY2C 1G9NC 1ZLSH 1UJTA 1EUUA 1D9KC 1U3HB 2QSCH 4M7KL 4Z7UB 5D7LB 1XGPB 3TP4A 3TO2B 4HH8A 3KYKH 3HPJB 5EU3B 4KGJA 3OV6A 4TVSa 1SEBA 1AXTL 4IRJC 2A6JA 2FLRT 1YECL 3K80A 3PDOB 1K8IA 3G6AA 4UB0L 3U4EB 3T0EC 4Z78B 4R0LC 3G5VA 4HIIB 5DHYA 3GI9L 4Z7OE 1N0LA 4KU1A 3G5VB 4HIIA 4U7SA 5E9DB 1WEJH 3M17B 3FOLB 4D8PB 3M17A 1KIRA 4KRPD 3BGAA 3UYOD 4IRSC 2OSLA 3OR7B 1BLNA 1YPZF 1Y0LA 3BQUA 1ADQL 5TH2A 1TCRB 4F57H 3PNWA 5GQBA 2Q6WB 4OGYH 1Q38A 4Z76A 1JVKA 3BX7C 3WIHL 1MJ7L 3MGOB 3MJ6A 3V95A 5LWYL 1NC4D 3BDYH 4WDIA 1I9RL 3ARDA 3U6RA 3ARED 4OZGE 4MQXD 5JW4Q 3BRDA 1QKZL 1ND0B 1NC2D 4QEGA 5GGVY 3H42L 4I77L 4C58B 1FZOA 1CGUA 4ODHL 2JJTC 2I07B 5L8LB 4M1CC 1CDUA 3G04B 2J88L 4L8CA 5A2KH 1U93A 1ITBB 3WJJC 2HJFA 1DFBL 3VXMA 3ULVD 1CFNA 1UWEH 1ROWA 2NX5A 5KAQF 4Z0BL 4ALAL 3EYSH 2VNCA 1CR9H 4GG6E 1CS6A 1DJSA 2NX5B 4H8WH 4OIBA 4S10A 3FRPA 3QCUL 5TE4L 4A6YB 5CD3A 1X5KA 1MCEA 1I9JL 3S97C 5CD5C 1LNUB 5T1KB 1J1PH 3FT3B 1BBDL 3HE7D 5C09E 1QVOA 4QHUA 2D4DA 4PJGB 5CGYC 1JBJA 2FGWH 3L3KA 4KHTH 4JHAL 2GHWB 2Q7NA 4KJYB 3K4AA 1FNSL 3FOMA 3MRBA 2MFNA 1A7NH 2FH8A 3VFMA 2FWOA 3V5KA 3OB8A 4MQSB 3H9ZA 3B8SA 3EOAA 1KJ2H 3PQYE 3ZLQC 5KBNC 1NGXA 1UZ8A 1MFAL 1PVHA 3ARFB 2AABL 1T1YA 3CXHK 1CDGA 5DJ0B 4PRHD 2CUIA 4D0DA 1D5MA 3P0VL 1CLYH 5I1IL 3S96B 3GSXB 4P2RE 3BP6A 4BQBA 5KSAB 4M43H 5E8OA 2OJZL 4NQCD 3F62A 1FQ9C 2WWMC 1SJVA 3RX8A 3JWOC 4AM0A 1BOGA 5DTFB 2LTQB 3O3BA 5IQ9B 1G7PB 2QQQA 2FYYA 4NSKA 3UTPD 1ZLUH 2XACC 3GNMH 5I76A 1FV1B 3FO9A 3R06B 4WO4D 3L5XH 4NFBA 4FZEH 3C60C 1U6AL 3IJYA 4HGMA 3SJVB 1KG0A 5F8QC 1H5BB 3BGMB 4QNPF 5GGVH 5HD8D 1HEZA 3AB0C 4GKSB 2IH3A 2R29L 4HK3J 4BFIB 4DGIL 1XZ0A 4WRLA 4L9DA 1SYSA 4XCCH 5E9DA 3ALXA 3TA3D 2B1HH 2EDLA 4P5TA 3T0EE 4X80L 2DQIL 5EU5B 3AVEA 3BZFA 2VERN 4BH7A 4N1EA 4PJ7E 5F1IA 1NAKH 1UB6A 3I6LE 3O6MH 4LHUD 3HI6L 4WU7B 3TJHD 4XCYB 2VLKE 3MTRA 2DWEA 4FG6D 1X5AA 4FQHA 1N59B 1WIOA 1OT1A 2D7QA 3PL6A 4XP4H 4NPYA 2DQUH 1X5ZA 4ODUA 3UO1L 4DOHB 3OKKB 4FMFA 1VFBA 4O2CB 1CCZA 2CMRL 3SDXA 3MODL 2DQDL 1AGBA 3EO1B 4CVXB 3DRTA 1K5NA 1T2QH 1HHGA 4L3AA 5JW5B 3PGFH 3QUXB 4QNPE 2IG2H 4FMKA 2F54B 5KSUA 1BM3L 2VLRD 3UZVB 3CVIH 1RMFL 4BQ8A 4LIQL 1U3HD 1N5YH 4U6XB 2PTUA 4NZTH 3ULVE 1CLZL 3NN8A 2WQRA 2AK4A 1EGJH 3FQUB 4E42A 1P6AB 5BOZG 1FL5B 3IXAA 5TF0A 4JFQB 4X83A 5A2JH 1INQA 3FT3A 1SQ2N 1PD6A 1JWMA 1KB5B 1G9MC 1DCLA 1N4XL 2AEIT 5L88H 1BQLL 1YA5A 1P4LA 2Y7QA 3RAJL 1A14H 2Y07L 2F5BH 4GW5B 5E0QA 3U9PH 3D48R 1SBSH 1T5XA 4JRXE 4QXUL 1EAPB 4MVBD 1G6RB 2VDNL 1UT9A 3GHEL 4LAQL 4MJ5B 4NHUB 4HJGB 3QH3B 3QG6B 3QHFL 1PKOA 1ZEAH 5DUPH 1MCJA 1GGIH 4LCYB 4NKIH 4GUPA 3QT2A 1SJEA 3PWPE 5MERB 1CT8A 5D9SB 3OKEB 4M61B 1NC4B 3BN9D 1J0HA 2EDRA 2IANE 1X5IA 2Y5EA 3CZJA 5D9SA 4KV5F 3V5HA 5DJ8B 2IADB 3MBEA 5IBLC 2G75A 5DJDA 3RUGA 1FH5L 4WI9A 3BT2L 1TJGL 4DTGL 3PGCB 3U79A 1VKXB 1T3FB 4WO4C 5I1IH 4TOYH 5JW4M 4Q6YA 3IU4H 4R97B 5IM7B 3QUMH 5I1LA 2FGWL 1CXIA 5J12C 3HS0B 3FO9B 3R06A 4KI5F 5E08H 1IE5A 3O9WC 3HS0A 5DHVH 5FYJH 2VKXA 2X70A 4JG1H 1UWXH 3MA7A 4JZOA 5CKGA 2OTWB 4YLQT 2YWZA 2XG5A 1AIFB 1XZ0B 1J5OL 4L4VE 1T1XB 1T5WB 4GRWE 1I8IA 3O3DA 1IAKB 2ZOLA 3R8BB 2X7LA 1CD1B 3FONA 3R4DA 2MCPH 2AEWA 4MNQE 1FNSH 1IAKA 1N64L 4JGUA 4KTEL 2W60A 3VFUB 5HGGS 2VL5B 4PREA 2B2XL 1MAKA 1EIBA 1T21B 3VFUA 4AENA 4P3DA 1WJ3A 1ZT4B 2X4NB 5D1ZD 2JCCB 1P1ZB 5IB1B 4Y5YA 2ED8A 4OQTL 5GRUL 2OTUA 4L3CB 5EU4A 4ZAKC 1Q9KB 4Y4HA 4P4KA 2HT3D 4NO0B 3GSVB 1NGWB 3P4MB 4NP4H 2UZIL 1PBYA 3B83A 1TLKA 4MXQC 3CFKA 1AFVH 2CRZA 1FORH 4X6CE 1EERB 4F15C 1TQBB 1KCRL 2OXGA 4R96B 5F1OB 1T89A 2EE6A 5I9QB 4HKBB 5AAMA 5IIEA 3CFJB 5F71A 3SE9H 2BSSB 5IMLA 5BXFB 1YNKH 4PS4L 5E2UL 4ACPA 5GGTH 4L4VB 4RGMC 1ODAA 3CFCL 5L7XH 1FYTD 4GMSL 5J89A 3HPLA 4PGEB 4UTBH 5ABDE 5GRWA 2HH0L 1KFAH 4LASL 2N4IA 3RWEA 5FYKU 1MCOH 1I9RH 3QUZD 1U8MA 4HWBL 4WWKA 2ZG2A 3L6FB 3NPSC 4NRZB 2ZUTA 1RUKH 4PGJA 1V3LA 4KK6C 2FATL 2K3TA 4FQ2H 1IGJA 1U8KB 4ZS7L 4M48H 2B4CL 4U05A 4BFGA 2CXKA 4PR5B 3ILPA 5IOPA 1S7XA 4D9RE 3RY5A 2BSTA 5F7WC 2FWOB 3QNYA 2GQHA 4IEFB 4MHHG 1GHFH 4P3CL 1I1FA 4M3KB 5IWLC 3EOAB 5E03A 1JN6B 2VH5L 4PJXE 25C8L 1YY9C 1M1SA 3PE9A 1I3GH 3RVUD 2DJ4A 3EO9L 4LCCB 3T0WA 4KDVA 1OT2A 5DO2C 32C2B 2OS7A 2VMFA 3P4NB 3FT4A 3CCHB 3EOTH 4PJAA 2Y5TA 2W0FB 5DRXB 5IMOA 1S7QA 3P77B 3JV6B 1A3RL 5HHVL 5BZWB 4X4ME 3WJLC 1LDSA 2I5YL 2B20A 4XP9H 4L8SA 1KIQB 3G5YB 4IS6B 4Q9RL 3FL7A 3HAEA 3VFPA 1KJ2B 3PGDA 1OSPL 5EC1B 5FYKE 3TZVA 5I17A 4HPOH 4HIXL 4IRJD 4NWUH 4Z7UA 2X10A 3MACH 4DGVH 4XCNA 5K9KA 1QBLH 2UWEF 4WW1B 4OIAA 4KKAC 1WFUA 5F7YC 1DL7L 2HTLD 3MXWH 3SKJL 2DKMA 2IH3B 3I50L 4CJ0A 2GY7B 1HKLL 1UZ6E 4NZTL 4OI7A 4RGMB 5D2NA 5I1JL 5I1CL 4QCIA 5D96B 1FIEA 2CLVB 1F11B 3TJEH 3S3SA 1P6FA 4U2ZA 4HC1H 1CE1H 3RWFA 1ZT7B 1SBSL 3WXVH 5L9DH 4Z7NE 2ZCHH 4OLZH 5DQDH 2Q1EA 3QO0B 1JTTA 3MBED 2VWEC 2G2RA 3WNOA 1A1NA 1AD9A 4P2QB 1N4XH 3BEWA 1RHHB 3L3GB 4MDIA 3O8XD 3ARVA 2EH7H 3JV5A 4RNRB 1YYMH 4OCSL 1L6XA 4KH2A 4Q7DA 3VFNA 2EXWD 5KSVB 4J2XA 5ELIA 4U1MA 5CGMA 1CLZH 5CP7A 4KDTC 3KS0J 3MO1B 1R3KA 1PY4A 4LLQA 3HE6B 5HBBA 3ULVC 5HYSG 3QQ4B 2FL5B 5CS7A 5TFSH 4HAFA 3IDXH 5B39A 1T0NB 3ULUF 2HWZL 5FK9A 5KSUB 1BJ8A 2CKBL 5BS0A 3MRIB 4K9EH 4MD5B 4M8QB 5DYOB 2MMXA 5F1NA 1PJ9A 3IDNB 4JPKH 1U9KA 1EFXB 3WKMH 3H9SD 2BY2A 1P7KB 3DRQB 1NCWL 4H88L 1IC7L 5ICYA 3L6FA 4DOHE 1SMOA 1S9KC 3HNSL 3FFDA 5CMAA 4NHCL 4O00A 3IVKA 4X6DA 5IT2H 5CMAB 2VUYA 1ZXQA 3Q3GA 5FV1L 3ILPB 1NEZG 1A5FL 3FOMB 4G8FA 4OUUB 2X4RB 3HG1A 3MLYH 4Z7WA 4NKOB 1IAOA 5AZEH 2HFGH 3BT2H 4HCRA 4RA3A 4HSQA 1U2HA 1RZJL 4F9PA 3MYJB 4L29A 1I1YB 2C7UA 1Q72L 1MREH 3IAPA 4HUNB 1HSAA 5C0CE 4I1NB 3NACH 5EOCJ 2NY0B 3F6LA 1EJ6A 5DJ0A 1OGAE 5DJZA 3FN3A 4FTVE 5HHOD 4Y5VA 1UH3A 1FPTH 4PJBB 3FQTA 4JVWA 4W6WB 4WFGE 5JW3L 5DUBB 3C6LA 4TPRL 1GH7A 4UAOB 2Q8BH 5HDBF 2YD4A 4PG2C 2IH1A 5HGAB 5I1EL 1A64A 5I17B 1J18A 3MROA 3N85H 4K3GA 3QZWA 2Q3ZA 1QFWH 3H9SA 1EEQA 4Y2DB 1WCBB 2XG4A 3QDHA 2R8SH 4NNYB 4G7YL 4RFNC 4L4VD 5ITFA 1CLCA 3B9KA 4OV5B 1VFUA 4PRNB 4D0BA 3I75A 2F58L 1SJHB 5C1MB 2HTLC 5DJ2A 1OAZH 2Q8BL 4ZD3L 1NLDL 3FQXB 2C3HA 2DM2A 1O0VA 1CWVA 5IT2L 4UQ3B 4XHJC 1CD1A 2HRLA 1EAJA 2C5DC 2OR8A 4MCZB 5D70H 1XF5A 4RFEB 4JM2A 5A40E 3UTTD 4Z77B 5DHVB 4HKXA 5JTWA 1P2CB 5IEKB 1ZT4A 2DLIA 4R4FL 5C0GA 5AYUH 3ZDZF 3QULA 3BO8A 5JOPE 2ZUSA 1EMTH 1TIUA 2YUVA 4G9DA 3W0WA 5EZIL 4X5XB 1JNJA 1AD0A 2I9LA 1KCKA 3U7AA 4G8IB 3DO7A 4P57A 5T1DH 4YDLC 1GGBH 1IGTA 1NCAH 4JGMA 4OD2A 1I1AD 2F53D 3WIHH 4QHKI 2WIIA 1FP5A 3F65A 4NBZB 4XHQA 5F93C 3SKJH 3D39B 3WIIH 1S7VA 5DC0A 4ODXA 3VRLE 5K59F 1UEMA 3HZMB 3VI4F 12E8H 4LVNC 1KXTB 1MH5B 4R3SB 3UJTL 5DRNB 3W9DA 3PQYB 3FO1B 4JKMA 4Q9RH 3IFNH 3A67H 5D5MB 2A73A 1TQCB 3WCYA 5JZ7C 2ZOKA 3GI8L 1FL6B 1ZK9A 4YE4L 1FFNB 4I2XE 4WTZA 5CSZA 1LEGB 2FGZA 3FB5A 4AEHL 5BZDB 3BXNB 2YPLE 4N0RA 1G1CA 1HQRB 3HNTH 2X1QA 1U8JB 2VITB 5EZLA 4LHUA 3TJEL 3SE3C 2VOTA 3WD5L 4PRDA 3VFMB 4F2MA 5JHLH 3I50H 1FBIH 2Z93B 4FXGB 3QJHA 3MJ8A 5HGBB 1FZOB 2ESVD 1AQKL 1MOEA 1UZ8B 1NC4A 4NKQB 1FYTE 3HRZA 3L7FA 4Y1AB 5E4EC 4I3RH 3QDJE 5KVGL 4YEFA 1DQML 2VJXA 4HT1H 4L1HA 4LVHB 3VD9A 3FT2B 4ZYKA 2X4PB 1V5JA 4GQPH 2LFGA 1F58L 1JUFA 4UT6L 1N8ZA 4WUKL 4LASH 1MCPH 4OD1H 2VKWA 4IIQA 3CX2A 4Y4KB 4JB9L 4ZFOL 3GIVB 1MEXH 2DTSA 3FQNA 4JFDA 4O2FA 4U0RC 5DRZB 4FS0A 4ZNCD 3JVGC 1R3IL 2V2XB 3DURB 3LKSA 4JFDB 4PB9L 3STLA 3ARTA 3SE9L 2N7AA 1YDPA 4V1DE 2DQCL 4H88H 1NCWH 2X09A 3MRFB 4M00A 5K9QI 4NQED 4OLXL 3GSNL 4YX2H 1BJ1J 4K94H 1JK8A 4H1LA 3GMRA 1XR8A 5DZOA 3FRUB 2NY6C 3GJEA 3FZUC 5EUOF 1FIGH 1C8PA 1BBJB 2VQTA 1GGUA 5CEYB 5AD0A 4XH2B 3UJIL 4HIJB 1CLYL 4YDJB 1A5FH 1QO3A 4XI5C 3D0LB 1M7IB 4IDJL 2LU3A 1WFOA 4PREB 5E2WL 1Q9WB 4QRRA 4HV8A 5F7HA 4UBDD 2ITDB 1TNMA 4CU8A 1H8OA 1OTUC 3K7UA 4ERSH 5I74B 4UINH 2V2TB 2NY3B 3BVNB 3VXNB 3MCKA 5DK0B 1OPGH 5B3JE 4YDLB 4IOIB 4Z7WF 2FNBA 1IEAB 1PZ5B 5GIRA 1LP9B 15C8H 5L7XL 1MJJB 3GSXA 1GL4B 1F4YH 5CIPH 1OAQH 4LKXA 4EBQL 2HTKC 4LP5A 1C7TA 4KJQC 1XGRA 2VISA 1ORQA 2NY0D 3RHWK 3QEUB 4OD2B 5LWYH 1P4BL 3DETC 1AGDA 5EU3A 3T0AA 1JGEB 3QQ3B 1BBDH 1TNNA 3KHQA 3WXVL 2QQLL 1LO0L 1OARL 3O3EB 3A0OA 1UM4H 3K8KA 3EOYG 4PJCE 1KG0B 1YEKL 2J5LC 1HILA 4LLWA 3TWCL 2BRRH 1P9MA 4XMPH 4NNXB 5J3HD 3WYRA 3NA4A 1DBAL 1BIIB 3LD8C 3QXTA 1MFNA 4KK6D 1AXSA 4Z0XB 5GPRA 4IRSD 3QDGA 1I85C 2VXTH 2P5EB 3DHMA 1UJ3C 5F1KC 4XXDA 1DVFC 3H7LA 2C3GA 4QRTB 1FORL 1QP1A 1I7RB 3QNYB 2DN7A 3RWDB 2ZCHL 1OF2B 4QYOB 4ENED 4TRPH 2XZCH 1BAFL 2X4RA 3GZKA 5DMKA 4X9HA 1CL7L 2LU4A 2MPAL 1CXEA 1K8DB 5C71A 2J8UA 3RP1A 2ATPA 5FOBA 3KPQB 4XVTL 4NN6B 1LQSR 1NGPL 2NLJA 5FO9A 5SWZA 1M7XA 1R5VB 5HI4C 2AJVH 2P8PB 4P2YA 2Y07H 4Y4FB 5HXMA 5ADPH 4LCCC 3VI3E 5F72S 3P4NA 2NY1B 1SYVA 5DF0A 3PUCA 5GS0L 4Y16C 5DDHA 4ESKA 3IETA 1L0XA 1JZ4A 1GZPA 1IEBB 4M93B 1ETZB 5EULV 1T0MB 3BHBB 4L8SB 3PHOA 3V7AE 3GB7A 4YJZL 1T0MA 4I3SH 1N8ZB 3WD5H 4WUUB 2VE6B 1V8HA 4F3FA 4JQIL 1VKXA 5IQ9A 2OBGA 3C2AL 4FP8L 4QHNB 1ERNA 2QR0B 1QHOA 1Q0XH 4LCIH 4AEHH 1CBVH 4HULB 3EFDH 4JFFA 5ANME 4OM0L 3L3KB 3A6OA 3GBMH 4I9WD 5J06A 5C2BH 5CGYD 3ZZ1A 4I3RL 4PLJD 1E27A 5H2BA 3OPZH 1HZHH 3S34H 4XT1C 1NCBH 1B4RA 3VMOA 3EFFA 2P8LB 4ZSOA 3A67L 3IFNL 5C6WH 5HYJD 3GIZH 3IRZA 1X4ZA 4EIZC 4GRLC 3QO0A 4MMXC 4NQEE 1FH5H 4P3WA 4NC2B 5JDSB 3EFFB 1U2CA 1KPRB 3B2VL 1XGYL 1EAPA 3O4OB 3QDMD 4XPGL 1F11A 2I27N 2IPKB 3BEWB 1YEGH 2NY6B 4RFOH 3IKCB 5T5FL 2QTEA 4PJDB 1NDGA 2D31A 4UIMA 1Z5LB 4D0DB 4N1HB 3JUZA 1AR1C 2DQIH 4P4RB 2X05A 3LEVH 3UTQA 2CO6B 1U8QB 3D2UA 3DX8A 4UIMB 4OCWL 3Q6GL 4G6AD 4KJQD 4XMLH 4FQLL 3MLUL 4KRNA 1MELA 5J1AA 4LL9A 4F7EA 5F8RC 5D7IA 1W2KT 4BH8A 5J1AB 4LF3A 1YMME 4F7EB 1JE6A 4Y4FC 3VXMB 1PG7W 3MLVL 4XP1L 4JQXC 1OL0A 5IB5A 2DQDH 4LSVL 4NO5A 1EVUA 4A6YA 4J7RA 5FYKH 1MRDH 2WUCL 1B88A 2HT2C 3M1BB 3F7YA 5DQ9A 3RGVC 3VFSB 4NUGH 1J5OH 1CDIA 1TFHA 1MI5B 1WBZB 4QHLA 5FGCB 5FB8B 5EOCH 1IFHH 1MLCB 4MD4B 4LPXA 4RMUA 5C0DA 3B4NA 1MJ8H 5D1ZA 3VD3A 1AJ7L 3ZKXB 3FB5B 3EIFA 2D7MA 5BV7H 3H0TA 4YHMH 4GAGH 4U2YA 1A0QL 2NTSP 3IF1B 3H0TB 1H8SA 3UPAA 3D3VD 2NMSA 1IM9A 1L9MA 3ZKQD 5I0ZA 1MY7A 1A7PH 1W0WA 3OGCB 4LGPB 1ZHKB 1T83C 1E4XI 3U46B 4HX1B 2KDGA 2EDKA 4G8FB 4QRPE 2XY1A 4NN5C 2V9RA 5HHMB 3DYMA 5CJ5A 2XZQL 3WN5A 2AW2A 1DR9A 2XPGA 3LRHA 3WFBH 1ZWIB 1L0YA 3UPRA 2VXTL 5C0FA 3GHBH 3HI6H 2NY3D 4P5KB 1TJIL 5F7KC 1IL1B 1INEH 5I19H 3STZB 3FQTB 1HHJB 2BC4B 4MJIE 3BH8B 4JR9L 3RDTC 3PDDA 2J8HA 5HHPB 4ETQA 1ETZA 3I9GL 1IAIH 3LHPL 3KPOA 2EDEA 2SEBA 5D93B 3RU8H 2BRRL 2YKLH 3ZDXF 3RX5A 5E1AB 3LMJL 5GSVB 1U3HC 4PJGE 5HI3D 1LO0H 3V4PH 4H0HB 4JFQA 1WWCA 3WO3B 5IESL 3ZKSD 3BPNC 4PJEE 3LQZB 4APQD 4DKFL 3BKCL 3N9GH 4N5ED 5HDBE 3QCVH 2DM3A 1ACYL 2YSSA 2HG5B 5GGSB 3FMGH 5CUSL 3S35X 2YD5A 4KV5E 4KROD 3UC0H 3QNZA 1IKFL 4MAYB 1DANT 1B9ZA 1Z0MA 2VDNH 5ICXB 3QXDB 4MHHI 2V5MA 5GRXG 2P5EE 1HWHB 4PRHE 4K3DL 1FVCA 4WI5A 4URTB 3V4UH 1PEWA 4Q9QH 2AQ2A 1I8LA 2XIDA 1KPRA 1MRFL 1J1XH 4F80A 3I2CH 4OZHA 4ZS6C 4LAJH 2V17L 4P99A 4ZUWA 1UA6H 4MNGB 4GRMA 2PW2B 2M1KA 4IDJH 4U49A 2CK0H 4B41A 5T3XH 2QADC 3BN9C 3NZHH 4JGJA 5GS0D 1RZ8B 1GGTA 4ODUB 4OCXL 4Y4FD 2OR9H 2AK1H 1I4FB 4MXQD 4AEIL 2EH7L 2XNAB 4K9EL 1X44A 3MO1A 1G7PA 1ZAGA 3D39A 1S9YA 5EFIA 4JFED 3P11H 3MRMB 5FYKD 2BNRA 2UWEA 4PGCB 4ELME 3QI9A 2PO6A 4XPHL 1MVFA 1HEZB 1SVZA 3QZWG 1HNFA 3VFSA 5KSBE 2QQNH 3HC4L 3THML 3ULUE 4CUCA 4UNUA 5H94B 1NCNA 2A6KA 3MJ7A 3TJHC 3ZHKA 1WBYA 1INQB 2BVEA 3ALWA 5D7KE 3EDKA 1UXSA 4OI8A 1K6QH 5CSZB 3C60B 4M6ML 4JFHE 3QPQD 1ZTXH 5HHQB 2WUCH 1FNEA 4OLEA 4OD3H 4RA0C 1S5IL 5T5FH 5MHSE 2PXYD 2XFXA 3EYSL 4BH7B 3DMMC 1WT5C 1JNNH 2NXZC 4LCWE 2GTZB 5IBUG 1LD9A 5LCVL 3MZGB 4KKLC 5KVFL 5JORA 4HUWA 2GK2A 1UKSA 3MBXL 1MCBA 3FFCE 5B21A 3MLUH 3VFNB 4NYLA 1QTYT 4U6VL 3UPCA 4I18C 4OLYH 4ZXBD 2NTFB 4TRPL 4WHDA 4DUVA 5I1DA 1BOYA 2P8MA 4WHCA 4YHYB 1Q1JL 4D9LH 2HT3C 4R26H 1YZZA 4HDIB 2MHAA 3AM8C 1JHTB 5C0JA 2YK1H 1MVUA 1O7SA 3QRGH 2ZNXA 4R96A 1BD2B 4ODTH 5DMJB 3T65B 5C8JB 4PY8J 5J8OA 5DJDB 1HHIB 3HUJF 5ISZA 2DLFL 4IHOB 1E6OH 2D7TH 4XBGB 3HE6C 1DLHB 3D18B 4OFYA 4YHPA 4F8QA 1OQOA 1KEML 4F3FB 5KVFH 1OWWA 1Y6KR 2AQ3A 2UWEE 4P9ML 3SGJC 3O4LD 5T3ZL 4QHUB 3VXMD 4ZXBA 3RVWD 4HWEL 4Y19B 4M48L 1KF9B 3FQRA 4Y4KA 1JTOA 3ZL4H 1UH2A 1XF1A 1GJIA 1IGMH 2P24A 1NLBH 1KTKE 5FYLH 4KI5C 3Q5YA 1WF5A 4HWBH 4R26L 1CGXA 5TE7L 3IAQA 3HMWL 4GAYA 4PUBH 3SY0B 4N5EC 2A9NL 2O5XH 2RFXB 2X4SA 2EC8A 1CLOL 2IAMB 1QSED 5J0BA 3GMRB 4PY7B 4KXZH 4LMQI 5I1KL 2XRAL 4KZEH 2A38A 3V4VL 5DD6A 5IBLD 1JWUB 5D2LB 5AD0B 4LPUA 1AKJB 4P5MB 1T80A 4PD4J 4XB8A 3GO1L 4HGKC 3OG4B 5IHZA 3BZDA 4G9FE 4BKLB 4YPGA 3SO3B 1FFOB 1BFOB 2VZUA 2G60H 3WEXA 4ELKB 1N3NB 4D0CB 1KIUA 1NLDH 3V7AG 5EO0A 1CDHA 5HHMD 3REWB 3SKNA 4ZTPL 4K3JH 2VLRA 2HAZA 1OB1B 2KQMA 1BQSA 1RJZB 1E28A 3LH2L 3ZE1E 2XWJA 4DFIA 2R0ZH 3MUGB 2UZYB 3W2DL 5E8PA 3ZDYF 5JLZB 2XKSA 4HKBA 1MCNA 3CU1A 3DIFA 2XTJC 2EECA 2FYYB 1RSFA 4NSKB 3TT3H 2JJSA 3S37L 3BD5A 4DWHA 4YHKH 5ESVA 5C0AB 3VGEA 5GJTL 1J8HD 4J3OC 1G9EA 4P59H 5BO1H 5L2KE 4JLRA 2IALB 4PV8B 2CK2A 3B9KB 4IOFD 5L2KB 1I7UA 1JHLH 4XBEL 3WSQL 4YO0B 4JFXB 5TDNB 1IEHA 2MKLC 4MXWL 4ELMB 3AB0B 3QIWC 1YEJL 4APQB 3W0WD 5HHQA 3U0WH 5FUZH 5KVDH 3BYTA 3RWCA 5DD1H 1BGXL 1N0XH 4GMTL 1KT2A 1HKFA 2FHBA 1Q72H 4PV9A 3L3OB 4NQSB 5DFTA 4WNQA 3S36L 4C55A 1X5FA 3NCFB 2MWCA 5B3JF 1ZHKA 5HVGB 3O2DL 3F7RA 4XCYA 2WBJC 2YPLD 3CU7A 5JPMA 4GG6B 4HJ0D 1JN6A 3QULB 1LO3L 1EUTA 1LGVA 3ZDYE 4FXGA 5DUMH 1JNHA 1U8OA 3FHAA 4HH9B 4Z7NF 5DQJA 3ZE1F 7FABL 3T0BA 2BVPB 2QKIB 2NY1C 5JQ6H 3QB7C 5FYJE 2FL5A 4YNYB 3WL9A 1V05A 4OCMC 1GOFA 3KYMB 1B0GB 5DMIH 3QEGL 3WDIA 4TVPH 4HXAH 3DVNA 1IC4L 4JFEA 4KC3B 4MSWA 2CIKB 3MBXH 4IIQB 1XGQB 1DEDA 4JFEB 4DKEH 2KH2B 4I3GA 5EBLB 3QXAA 1RZFL 1FZKB 1P7KA 2APFA 3DRQA 3UP1A 1XGUA 5ANMB 3NIDF 5SWZD 3E8UH 3HUJB 4ONFH 3KPSE 3T8XB 2Y25A 1A21A 4J4PA 1ZHLA 4LU5L 3GSRA 4BZ1H 2X44D 5C07B 4GW5A 1FCGA 1NFDF 4YFDB 5T33L 2O5ZH 5DLML 1ZVYA 1K6QL 1OAUH 3VXSB 5I8EA 4LLVB 1SHMA 2Y36L 1EEUA 1NC2A 1LO2H 3T2OA 4WUKH 3T4AA 4JZJC 3I6GB 4JRXD 5FHAL 4KK5D 3VDBA 1W72H 3OKEA 4MQ7A 1E4WH 4HFUL 4YFEA 4PJHF 1H3UA 4PJCB 4ZUWB 3MXVH 1AR1D 4GG8B 4XCEA 4NZDA 2CUMA 4TTDC 3WS3B 2PKDA 3T1FB 4NCC2 1RURL 3PWVA 3T1FA 5LBSH 5MENE 3OAYH 3C5ZC 5FCUL 5MENB 3LPWA 1T04B 1DQLL 2VZTA 2DD8L 4YGAB 4GQ9L 2GJ6B 1XGPA 1GOHA 3HE6A 3O0RL 1N5YL 3DUHA 3NZHL 3R8QA 1W8NA 2A6DA 1NFKA 2W0LA 1DQDH 4NT6B 3LKOA 1YMHB 2FO1A 3EO0A 3N1GC 1HH6B 2D4FA 3HZKB 3AM8A 1QA9A 5T1DL 1YPZB 4MA8L 3V4VH 3O3EA 1X7QB 4U1SA 4MCYA 1TTGA 5FGCE 5F1NB 4L8DA 5GGTA 4Z5RA 4I18A 5EZIH 1M05A 2E6PA 5GRJH 1HILB 3ARBC 4O4YL 5C3TA 3UJJL 3FRUA 2XICA 1NCCL 4YO0A 4UU9A 5HPOA 5I30L 4C56E 1HI6A 5DLMH 4ODVH 4UU9B 4DGYH 4PRPB 4P2OC 5FV2A 1ACYH 4Z0XA 4LNVA 4JY6A 1QLRB 4XNQA 3LZFL 2BXZA 3WIIL 3ZSTA 5I8KH 2YC1A 3H8NA 5K9OA 3AS1A 3ZL4L 1H3GA 3AROA 2ZJSL 3ARDB 1XR9A 1ZVSA 3HFMH 2ESVE 3WHXA 1FGVH 1YQVH 4JKPH 2L4OA 2X4OA 4AENB 5DZNA 2AEQH 2LQRA 5F6IC 1CYGA 4NO2A 4CBPA 5KN5B 3CFKB 1QSVA 1V3KA 3HRPA 5I1AB 1DUYB 2E7LA 5LXGH 2ICEA 2Q76B 4FQ2L 4UV7L 3MREA 6CGTA 5KVDL 1J05B 1CFNB 2PCPB 3MLPA 4PJFE 3QUZA 3GRWL 4F7CA 4XMKH 4J1UB 1VGKA 4YUEL 5F7NC 3KJ6L 3SDYL 3T77B 4Y5XA 1WV7T 4KI5E 3HE7C 4MLIA 3QUKB 3KPOB 1F2QA 5I74C 4OIIH 5SWSD 1MCQA 1MCWW 5F9DC 4X7SL 4X7EC 3AY4C 5GSVA 1JF5A 2AXFB 2IPTH 3SGEI 5JA9A 4L8BB 3RWEB 3JTSA 4BK5A 1V7ML 1KPUB 3HA0A 1WIPA 1XCTA 2AQ1A 2NY5C 5CEXB 5IOPB 5GRVL 1KACB 2BSTB 5BV7B 3VW3H 2P5EA 1CK0L 3X12A 5GS2D 5BVPL 2EDWA 2A6IB 2XQYG 5J1SC 1II4E 1KN4H 2BVTA 4R4BA 1CGTA 4BUGA 2IQAA 5SWSA 3KPRE 3RNQA 3C08H 3QJHB 2OL3H 4M7LH 5BRZB 3N0PB 8CGTA 1S9XA 5ITBH 2YA1A 2C26A 2QBWA 4MAUH 4LRIA 4ZUSA 1AHWC 1BMGA 5IBTL 5B3NA 5EOQH 2KKQA 3RGHA 2WWMD 2I60L 2BNQD 2W59A 2MJWA 2XZAH 4XPFH 5I1GL 4F9LA 2FDBP 4JFFD 5DD5L 1CE1L 1U3HA 4M8VA 2R2EB 1EXUB 4HEME 2BNQE 3NVQA 1BOGB 5DTFA 1A1MB 1NBYA 1UQSA 4L4TE 3DETD 4YPJA 2R69L 1I1AA 2F53A 2RQ8A 3NOIA 5F9JA 3MXWL 3GBNH 3VXQA 5KS9E 2B2XH 3RVXC 5I18H 3BGMA 2WAHA 5KS9B 4OF3A 3QEQE 1F8TL 4KKAD 3WN5C 1A7QH 2XY2A 3B2VH 1RZ7H 1UXSB 1CFQB 3ULUL 3RWFB 3GK8H 4GXUM 4NCC1 5T3XE 1K4DA 4TUKL 1RUAL 4YC2C 4ETYA 3CLFL 4YX2L 4Z8FL 1MLBA 1T7XA 4KDWA 3WFHA 2XFXB 3GMNB 3GJFB 4RFNB 1ZSDB 3BXNA 2F15A 3MUJA 1X3DA 2HWZH 3TYFB 2HP4A 4L3EE 1NMBH 4N9GA 3G5XB 3KYKL 3PWNA 3MA9L 4WNQB 4KK9D 4XC3H 2FX8L 5SX5H 3U30C 1OF2A 4Q0XH 2DQHH 2NR6D 4JRXA 3A6CH 2F53E 4JRXB 1UC6A 3U6RB 1EVTC 5IFHH 1PX4A 3KPPB 3MX0A 3V5DB 1MUJB 5I16A 1AI1H 3LN5A 5I73C 2QKIA 1R3KB 3BP5B 3S5LA 5FK9B 2GKIA 2NZ9C 1KSRA 4GRLB 5IW6B 1YMMD 3LKNB 4JQXA 3QQ4A 3C09B 4DN4L 4X6CA 1E4XH 5ALBH 3SGKC 4U31A 2EYRB 2ITCA 2Y6SD 3T77A 4O58L 3U4AA 3L7EA 5E1AA 4QXUH 3TBVA 4QHNA 3GRWH 2GEEA 2VQ1B 4R90H 1HIMH 1CICC 4YHML 3K46A 5TF1H 3DMMB 5HI5D 1QLFB 2YD3A 3BPLB 2B5IC 4PLJC 4UV7H 1E4WL 3D87B 4HFUH 3QDGB 3MLZL 3WO4B 1T1WB 2Y7QB 4H26B 5FIEA 4UUJB 1I8KA 4EDWH 3IVKB 4HPOL 4NWUL 4MNQA 1Q94B 2Y1VA 2BHUA 1OGTA 1F3RB 2X4UA 4WWKD 1I1YA 4PLOB 1A6ZB 3OB0K 4YC2B 3CC5B 4J8RA 1VPOH 4TQEH 3UAJD 5E6IB 3T09A 3QG7H 3TVMC 4UV4H 4Y8AA 3GMLB 4IM8A 1G7JB 2AJUL 4HZLA 5DDHB 1E4JA 5I6XB 1W72L 2N1KA 1CGSL 4WEBL 2VXVL 4H0IA 4XPAH 2X4QB 4XXCC 3RUGB 5F89B 2VDMH 1OAYL 1VB9A 3TH4T 1MIMH 1YJDL 3AS0A 4PJBA 4ZAKB 4ZUVA 35C8H 1ZLUK 3VFGH 5BRZE 1JNLH 3MLSL 3OQ3B 5SWQB 1DBBH 3UBXG 1OAUL 4CU7A 2ATKA 2DIJA 4BA8A 1UADC 4LOUC 3EO0B 3ZKMD 2C1PB 3BWAA 3MROB 5AEAA 3FO2A 4UT9L 4MWFA 5I76B 5DMGD 1OTSC 1XIWA 3L95B 2YSSB 5GGSA 5JW4N 3H7BB 4JAMA 2CIIB 3V2AR 2ZUUA 3A6BH 4P2RA 4OLWL 2FECL 3CLEL 4HMEA 1Z6JT 2WM0A 4U7MA 1S3KH 3MR9A 4HS8L 5IBTH 5ICZB 1BJMA 2JELH 3RTQD 1D5IH 1DVFA 3TO4B 3QCVL 5DC9B 2YR3A 4NJ9L 5M94B 3G5XA 5JDJA 4FQHB 4OFVA 1I85A 4PJDA 1ITCA 1U8LA 3GNML 5BW7A 3MV7D 1YUHB 3HI5L 5I8CA 5IEHB 1K8DA 4GRMB 4DQOL 4NPYB 1N6UA 4LQ1A 2DI8A 2ID5A 1FNHA 3JV4B 3WUWA 2W0PA 4JO1L 1HHKA 1H3PH 3TESA 4NM8H 2JB5H 4GAGL 3R0MA 4I0CC 1MFCH 1YEHL 1IL1A 5FKPA 1KN2H 3Q5TA 3UMTA 3B5GA 2BNQB 3TT1L 3VFTA 4L9LC 1U92A 3NCCB 4R3SA 5DD1L 4F7MB 3HKFA 3WFBL 4NBXB 4RX4D 1QNZL 2DLTA 2VXQL 2P48B 3HZMA 3DYPA 3CDGB 1F45A 2A73B 3D39E 4QXGL 4G6JH 3TH2T 4DQOH 1M71A 1VACB 4R2GD 3NIFE 1FRGL 2YBRB 3U2SB 2EZ0D 3AMKA 3ULUD 4OZIA 3B5TA 2VLMD 5T1KA 4JDZB 4JPIA 5JXEA 5DVLA 1E27B 3NMEA 3VXRD 3K2MC 1L4IA 4DZ8A 2APWA 4YR6B 1RQ5A 4FQXA 3U48A 2O5YL 5IB2A 2KBGA 3KPTA 4PR5A 2IGFL 4WW2A 3RWHB 4K07A 4LHQB 1IAMA 3SPVA 2DI9A 2H26A 2IWGA 3K4DA 2ZSWB 3E0GA 4AK1A 4M7ZB 2VR5A 4YH6A 2OM5A 4DKDC 4NWTL 3GSNB 1JWUA 2ZJSH 2D9QB 4OQTA 2IBZY 3QA3A 1QSEE 5F3BB 3FRPG 3N1FC 5KG9A 3CH1A 1NLBL 3SEPA 2DLGA 4ZODA 4ZYKB 1JCKA 3GMLA 1MHCA 3QO1B 2WBWB 3LPGA 4XNZC 1EGJL 2EDJA 1NCAL 1NGYA 2EYSA 1O7VA 3EJYC 4WJ5A 4DUWA 4N5UA 3QO1A 4S1QL 3RDTD 1D7FA 3UTSA 3TF7C 2E9JA 4IIQC 3MRDA 4YIQA 1D5ZA 4WFHE 3OSKA 3T0XA 4X9IA 5CJQL 4PUBL 2BVQA 5FGRA 4UINL 4R4FH 3DXAE 4MB5A 3MC0A 4GRLD 1WZ1L 1CQKA 3RPIA 4XAKE 4I5BA 4EN3C 2CLRB 1G7LB 2NX5D 2VLJE 3RFZC 3DXAD 2F19H 3ZKMC 1G7LA 1NCDH 3BGFB 1NGZA 4ZTPH 5IJKC 3LEXA 4EVNB 5AUMB 4YHYC 2KZWA 4G6FB 1NBZA 2CDFB 2ZCKH 5HHNA 4ZUUB 1AO7D 2RFXA 4Z95L 5DD0H 4P2OD 2YPLA 3CMOH 3OR7A 1KCVH 1BLNB 2NY2D 5IJKA 2IQ9H 1R5IB 3O3DB 4U1KB 1C1EL 3S4SA 1BZ9B 3P9WB 4FHBD 3BVNA 3MLZH 2BMKB 1S5IH 1RULL 1NBVL 3UYRH 1EHNA 2X4NA 4MNGA 1ZTXL 1WWWX 2W9EL 1S8DB 1T21A 4H20H 1ED3A 4Z7QE 1MNUH 1FLRH 4QY8A 5D1QB 1P1ZA 2QSQA 5IB1A 4O58H 1Y18B 1J10A 4BH8B 3QPXH 5KJRL 5E6ID 3EOTL 4QOKE 3TH3T 1AC6A 4PRHB 5FYJU 1DSFL 1WCQA 3TLRA 1RK0B 4HUKB 4POZC 1A22B 4NZUH 2WIIB 4AQ1B 4I13B 2NY0C 3OKNA 4JHAH 5HVHC 3ZDZE 4PJ8B 3VFVA 1HE7A 3BUYB 5KVEH 4LRNL 5F44A 3EOBA 3ZE2F 1QR4A 2HFTA 4YHPB 3RZWA 3IDNA 1E6OL 3MOBH 3KDMA 2BXYA 4YK4B 4ZQKA 5MI0B 4OGAD 5IJVA 2XV6B 4F58H 5DO2D 5DMIL 2X41A 3VG0H 3QXAB 1BGXH 4XC3L 1EO8L 4S1SL 1ZVHA 4N8VB 4L8BA 1KC5L 1OD9A 4KKCC 4C4KT 4RGOH 4ZFGH 3REVB 3MV8D 2MKWA 1I8KB 3MNWA 4W4NA 1D3CA 1DVFD 4PRAB 4MYWB 5FOBB 1SEQH 3D9AH 3RL1A 3HG1B 4Z8FH 1BFSA 5JA8B 3MV8E 4PJEF 4XZUA 1AE6L 2F8OA 4ENEC 2OJZH 3MOAL 2P8PA 2WW8A 2HT4C 4EXKA 3B9EA 4G8EB 1FFPB 1NSNH 4KAQH 3TNMA 4LLUB 1JP5A 1VA9A 4FTVD 5HHOE 1ZLWK 1KCRH 3QJFB 3B9KC 5C86A 5C0IB 4PJDF 5LQBH 3ARZA 5LG1A 3B3IA 3TZVD 1AR2A 4HBCL 4LBEA 5FYLD 1UWXK 5EPMB 2GT9B 4K7PY 3EDFA 1I75A 2X4PA 1FYHB 2Y5TB 1WITA 1A9EA 2V6HA 4TUOA 5C7XH 1RUPH 1A2YA 2DYPD 5ACLA 4PJDE 2HN7A 3DVNB 4LRNH 3B43A 5GGTL 1F3JA 4XWGH 2HN7B 1W0VA 3QIBD 4FNLL 4MA7H 2I26N 3RVXD 4Y5VC 5EC1A 5BW7C 4Y2DA 3MNVB 4OSUL 5IM7A 3MNZB 2P24B 1M6OB 4LARL 5IG7A 2MCPL 3WHE1 4LCWA 4X0KB 1FG9C 4GSDL 4EI6A 1K8IB 3G6AB 4WV1C 4LKCB 4PV8A 2P8LA 4ZSOB 3VG0L 1I3VA 5C07A 1NGZB 4LLYA 2VQUA 3O41A 3D3VA 1HNGA 4X4ZA 1T5WA 4NJAL 5FGBA 3WNKA 5FYJL 5CJ8A 3C5SA 3GKWL 2NY4D 1LVEA 4DZBA 5EZOL 1DQMH 1HYRC 1NFIA 2WSKA 5DVOA 43CAA 3SDAD 4GW1A 4WVRA 3VU2A 1PSKH 3SOBH 4XRCA 1MCKA 3DX9A 2DWEB 3I85A 3NPSB 3V79C 3MCKB 2GSGB 4XBPA 1C7SA 1TZHB 2X9XA 3KLAB 4HIXH 4D0CA 2PO6D 5HY9A 4F37K 4GKNB 1TZHA 5TPWL 4G8IA 3GI9H 4KQ3L 2I5YH 4PJIA 1RZIB 5EU7C 4G6JL 4NO2B 3V0WH 5DQJB 3I3BA 3ARYA 4XXCA 2E7HA 1ZLWH 1F6AA 3Q6FB 2EXYC 5I9QC 1MJ7H 2BY3A 3UYRL 4POYA 5E6IC 4WU5B 3CDCA 1KJMA 2AEPH 2XTJD 3QWRA 4JG0L 1U93B 4XVJL 3QUML 4MMZC 3T4YB 3P30H 4YHLL 3BUYA 5D7JC 4O4YH 5BXFA 4OLWH 5I1HL 2NCMA 4PGZA 4KDTA 1Q9LB 2YS4A 1FGVL 1YQVL 4JKPL 1M71B 4DKAA 3X11B 3KPRA 3HPLB 4PGEA 5J57B 2BK8A 2H6PA 4CVZB 3RNKB 1WWBX 2W9DL 4V1DD 3TPUA 4G5ZH 4OFDA 1IILE 1NUFA 4E5XB 4KGLA 3PJSA 2UYLB 4FFVD 4I0PA 1DN0B 4ZFZB 3EYOA 4OAWA 3AC0A 4KXZI 4FXKB 5I75B 1YECH 2O61B 1KLGA 3FFCD 4P23A 4XPGH 1C5DA 1WZ1H 3FQWB 1A6TB 4G6FD 3U7YL 1ZGLB 4NO3A 4A2LA 3KXFE 4HUWB 4J6RL 4OBRA 3VXSA 4K8RD 1G7IB 1ORSA 1RIVH 4X8JB 4R4BB 1NUNB 5JHDB 3HN3A 1YEEH 1AQDA 5D2NC 2IGFH 4GH7B 3EDJA 1V7NH 3RHWF 4Z7WB 1VFOA 1P5VA 1RUML 5K93A 5E2UH 1NMCC 1OP3H 3RIAF 4OZFB 2AK4D 3QJFA 2Z35A 1QQDB 4KTYA 4QRPD 3KPMB 1WSST 5D7IF 5HYSA 2XPGB 1S9XB 2X89A 1ES0B 2PW1B 4ZDHA 3QBTB 3NABL 4AMKH 3STZA 1GGBL 5EOCL 3KG5A 4IJ3B 1YEIH 4Y5VB 3TZVC 4XHJD 1I3UA 4NGHH 4PJAE 5TDOA 4EDWL 4PJXF 4N0YH 4OFKA 2OMNA 2YEZA 1C08A 5HGAA 4R8WL 1IGCL 3F7QA 2A6JB 3JTSB 3DSFH 2C1PA 3BWAB 4OTXL 1KELL 4Q6IB 1P4IL 2BOBA 4KQ4L 1JMZA 4PBVC 1MPAL 4XVTH 3NCYS 4JFXA 1A1OA 1OAKH 2NY5H 3FQXA 1TTFA 2FHFA 3O3AB 3BP7B 4H5SA 1UVQB 5EU6B 3K3QA 3EKCA 2BDNH 5A2FA 5IWLA 4P5TB 3MUHL 5CZXD 4ODWB 1F4WH 3CFDB 5ICZA 2W0KA 2O5ZL 5BVJB 3DOSA 3F12A 2FB4L 2V2WB 4KJPD 1JPFA 1CXLA 4LDLB 2EKJA 4FZ8H 2EDXA 3QNXB 2R8SL 1MCHA 4GW4A 4WFHD 1MIEL 4LSSL 3EJJX 5JR1L 1DVFB 4ZS6D 4I48A 3VA6A 1RZ8A 4U1JA 5E2VH 4HKXB 4N1CA 5ENWB 1J8HA 4P46D 4X6FB 4XMPL 3V6ZB 1QOKA 3QFJA 4PP1C 4AT6A 4AH2A 1JNHB 5F6IB 4FTVB 1HHHA 4P4KB 1N5AB 4M62H 2FD6H 3V5DA 3VH8G 5E99L 4QTHA 1Y6MR 1BPVA 4P57B 5JO5B 3WE6B 2PYEE 5GGVL 3NFNA 4XNXH 2XWBB 5HHOA 1LEKA 2GSIA 1YJDC 1LDPH 1T89C 2VC2L 3LRSA 2JELL 1VGKB 4OSUH 1S7VB 3FB8B 4NCDA 4FFZL 1JF1A 1U92B 2V5SA 5IFAL 2APVA 2DYPB 2YD7A 4U6HB 2UVFA 2Z31B 3S36X 4LLDA 4MD0A 3MRQA 5IW1A 3STBA 1QUNA 2Q3AA 1HK6A 5D7JD 4WUUE 1P4IH 1XF3A 3BZ4A 2PR4H 5T1LA 4DN3H 3QPQC 2F54D 5CFHA 5LAXB 3MA9H 4JE4B 3I84A 1VPOL 3GHBL 2ARJA 3VMPA 3TCXA 3AXLB 3AY4A 5DVMA 3F7VA 2ARJB 3TN0B 3UTSD 4KQ3H 5I1GH 3BAEL 1MFEH 3ES6A 5CHNB 3EJZC 3W81A 2RCSH 4JO4L 4Y5XC 4K8RC 4NM4L 4N8PA 3CH1B 4LSVH 3MRGA 2WV3A 2IG2L 3WN5B 2OQJB 4IJ3C 3QUZC 3MREB 3O9WA 3MRCB 3IDXL 4QOKA 4KHTL 2RHEA 3W2DH 1FSKB 1GZPB 1IEBA 3C08L 2V7HB 2UY6A 3NFPA 2NXYD 5J11B 2VR9A 3QDJD 1QKZH 2PYEA 4PJIF 2XYCA 3IDYC 1A2YB 5ISZB 3G9AB 4XP4L 3HZVB 4XI5D 3WUWG 4D3CH 1YN7B 4M3JA 1VEOA 3HE6D 2WQ8A 2OL3A 3OJMB 2OMBA 3PWPA 3CVHB 4HT1L 3O3BB 3D25B 2OZ4A 1SEBB 2V5YA 3C6SA 4ODBD 5T1LD 5C07E 1BVZA 1YEGL 4NFCA 1YY9D 3C6SB 2WP3O 1MCLA 1DQJB 4KAQL 4X7SH 1S9VB 1X5YA 3G6JB 4ONHB 5E7FA 4FNLH 3NIGF 4JPVH 35C8L 4KZEL 4NBYB 3RVVD 3X13B 1A9BB 1YEFL 1S78D 2Y4SA 4S2SA 3MFGB 4V1DB 4YGVB 1A7RH 1OLLA 3IU3A 2GFBA 2AJUH 2W60B 3GMOA 4WFGD 4HS3B 3GSOA 5BVJA 2P7TA 2E9BA 1HSBB 4NUJA 4HMDA 2DWDB 3UYPA 4Z77A 3ALPA 1RZKC 1TPXC 4NUJB 5HGHB 3CLFH 2APBA 1RAMA 1ADQA 3IXTA 3CUPA 2WUBH 1KEMH 5JHDD 3EYFB 5MENA 1Y18A 1T4KA 4Y4HB 3LN4B 2D7TL 1XGRB 2VISB 4Q2ZB 2OTUB 4M43L 4QRPB 4GS7B 3PDGA 3H9HA 4K7FA 3ULSA 5C0CB 5JQHC 4PGBA 5I6XC 1FFQA 4PRBB 1E28B 4Q0XL 1S9WB 3OKNB 4NO0A 4WY7H 1S9YB 4O51B 5EFIB 4ODTL 4Q58C 2WLYA 1LEKB 5HHOB 1RUQH 1KC5H 3VXQB 3DIFB 4S1RH 2BNQA 1MEXL 4GOSA 1MCOL 3ZTNH 4P9HH 4GBXD 3DO3A 5ACZB 4HF5H 3IDMA 1EBPA 4XP6H 5T3ZD 2YUWA 1TDQA 1MCWM 1WBYB 1RJLA 4M02A 1IGYA 5TDPA 4PJ7A 1XF4A 4B5EA 2BSED 4OJFH 2ZOKB 4P23C 1HN1A 1U95A 1JFQH 3IFLH 3TYFA 5BZDA 4NRZA 4J4PC 2D3VA 1R24A 1WUNT 2AV1A 1JZ5A 3IF1A 1FYTB 1SM3H 5EU6D 4XZUB 4RWYL 5L0QC 2V5RA 5DK2A 3VXRE 1N59A 5IVOA 1OAXH 1UM5H 4DAGH 5GRJL 3ES6B 5CHNA 2QQLH 2VN7A 3GSNA 1RIUH 4GXVH 2FH6A 5E6IA 4LSPH 1FE8L 4P5KA 5AAWA 1K2DA 5IMOB 1CT8B 5C3LD 1F3DJ 2DMKA 1G1YA 5BQ7B 3ZO0A 4MSWB 5DJ8A 1EXUA 5GRYA 1KTLB 2XA8H 3B8YA 15C8L 1BF2A 3BPCA 4P4KD 5EO1B 1MFEL 1WVZA 1H8NA 3V52H 4R7DA 4JG1L 1I1AB 2F53B 3SDDB 4M1DH 3BP4B 1LNUA 3D39D 1KNOB 1NFDB 4LU5H 4BZ1L 4MVBC 1FV1A 2EC9T 4CKVX 1RURH 1CU4H 4X0KA 1FO0B 5IMKA 3TT1H 2VLME 3NAAH 1F6FB 5MEPB 1M6OA 2QLVB 3IS0X 4DN3L 5FGBC 1A6AA 3PQYD 2V5TA 3DUUA 4JDVA 2ICWI 5D7JB 4NM4H 1P4LB 1WAAF 1NL0L 4OGZA 3T4AB 2IANA 4S2SB 1WIUA 4IOSD 1RJYA 4WV1A 1LP9E 3RNQB 3GJFK 4JEGB 5DD6B 1R3HA 5EU5A 3UTSE 5CEZH 5JDSA 5ERWA 1L6ZA 3RI5F 2J2ZA 3VD7A 2QL1A 3S4SB 4Y2DC 4RNRA 3OMZA 1HSBA 4HAGA 4X9FA 4O2EA 1F42A 2YUXA 3MV11 3LKQA 4HUVA 3DUSB 2A1WH 2WK2A 3BKML 3QDGE 4HS8H 4XC1L 4Y7MA 3TN0D 1GZQB 2RB8A 3UJJH 3VG9B 1LO3H 3O9WD 1FHGA 1ED3B 4PJFF 4L4TA 2HVJA 1YC8A 1H3TA 2XN9D 3D2UB 3DX8B 3O2DH 4J12A 4XAWH 3MBEB 3CSPA 3KGRA 4LHUG 2X1WL 3IFPB 3D85B 3QEGH 3T3ME 2E7CA 2HJFB 2MQCA 2KUTA 3O8XB 4GBXC 1JGLL 2GTWB 1UKQA 4PTUA 4NN6C 4XPBH 3V0AC 1G7HA 1FN4B 4Z7QF 5ESVB 5C0AA 3O11A 3KWWB 1RZGB 2VDLH 3MFFA 1FVEA 3DVGB 4O02L 3KPRB 4BFEA 3O11B 2JJTA 1F4WL 1DBBL 3OXRA 2GCYA 4LLWB 1ZS8B 5C0DB 1CE6B 4Z5RB 2PUQT 1YPZE 1DBKH 1JI2A 2J4WH 3VFRA 3V8OA 4N0CC 4RGNB 4FFVC 4HUUB 4OTXH 2VXQH 3ARDC 1WISA 2HJKB 1MPAH 4M9OA 4JO2H 4NQEB 4M4RA 3U0TB 4N8VA 3SKMA 4PV9B 1WQVT 1XR9B 4JRYB 4NQEA 3VD5A 3RQ3A 4ZUTA 3R0NA 3ARRA 4PG9B 1CD0A 1KPVB 1D6EB 1I9JH 4ZXBC 5TE6L 4LHJB 5DMKB 1IFHL 1S7WA 3CFBA 2FJGB 4G43A 4NUGL 5HI3C 3GSUB 1I1FB 1DANU 5CCKL 1AGFB 3MRGB 3W5NA 5LBSL 4LDOB 4FABH 4G9FB 4R0LA 4HDIA 5GJTH 1D5MB 3T0EA 2C7UB 4M6OL 4K7PL 1JGUH 3F7PC 3U1SH 5E8OB 3BRFA 3D5OF 1B0GA 4X4MA 3INUL 3VE0A 3BH8A 3E1F1 2IPUG 1PG7L 4U1LB 2FBJL 1N26A 2O5XL 3LY6A 4DAGL 5J9PB 1J0JA 1LO2L 5C0CD 1OGAB 43C9B 4PTTB 4YXHL 4FN0A 5I66B 1KPUA 3TM6A 3FO2B 6FABL 1NFDA 5T3ZE 1QR1A 4EN3D 4GLRH 1HH9A 1VADB 1NJ9A 2DIAA 3D0VB 1DQDL 2YD2A 4OQ1A 3T8XA 1WT5A 4QHMA 1XIWB 3L95A 4ZG1A 2ZKHH 4RFOL 5HPMB 1CG9A 1JK8B 1TQCC 4GQ9H 1A4KB 3DROB 3TBSB 2P43B 4X80H 1NFDE 3F5WB 1JZ3A 5I8EB 4QCIB 1DBMH 1U8PA 3O3AA 4WGWB 1FL3A 2HFFB 1M7IA 1XEDA 3RGVB 1UENA 2J1KA 5AYUL 1BD2E 3S34L 4KY1H 2P5ED 4EN3A 4MS8C 4U0RB 1UB6B 2O5YH 5IVXF 5KSBB 3PP3H 1I7TA 2B7DT 3OB0H 4YPGB 1EEZA 2H2SC 4M5ZL 1RUQL 1ULVA 2FRGP 4HC1L 4NRYB 3QEHB 4KTDH 3BEVB 5SX4I 4P4RA 3DV6A 1RIHL 1EH9A 4LFHG 5MEOA 9CGTA 1FO0H 1U58A 4ZO6A 3F58L 1YC7A 3QI9D 2D0FA 3SDXB 4L3EB 1DUZB 4NKMB 5EBMA 5BMFL 4S0SD 2B0SL 5D2LF 3UTTB 3HLAA 1N5AA 3O2WL 1A1MA 5BJTA 5J6GA 2XOTA 2VWEE 1X5GA 3J7HA 2F54A 2PYFA 5IB5B 2XWBA 4JHZA 4PJ8C 2AP2A 3BSZH 1T0NA 1XGTB 5TF1L 3VDAA 1FN4A 3CMGA 5F97E 4WUUD 2BHZA 3L3JA 4JFYB 5E8DH 4E41E 1I8LC 2XQBL 4OGAC 2EDBA 4P49A 3LS4L 4WW2C 5F3HA 5DRNA 2XXCB 2X5PA 5C6PB 1FDLL 4AYFA 2OTPA 3E6HA 4K3EL 1A8JH 4CMMB 3GRWA 3MR9B 2M26A 2W65B 3PWNB 4CMMA 2VAAA 3RIAK 5JXEC 1IQWH 3OGOE 4XGZA 1BFTA 5IVXB 5KSBF 4NNPH 2VL5A 3FFDB 5K9OB 4NQVA 1RHHA 2AK1L 3JWDH 3L3GA 4MDIB 4ZTOH 4O9HH 4KK9C 4OZGA 3WV0A 1B2WH 5JXAL 5E5RB 3OXSA 4J3TA 1BHGA 1U91B 4EUPB 2OR7A 1CD8A 4HJGA 2Y72A 3QDMB 5C0EB 1HHKB 2VXSL 2R9HC 2NY3C 1U8OB 5M95B 4L9LA 1JHKL 1BF8A 2A1WL 1K2DB 4KI5D 4NOBA 5FDWB 4MX7A 3QQ9D 2WIMA 2P47B 4KRMB 3ULUC 4PJ5A 4WJ5B 3Q6FA 3EUUA 5DRXA 2XN9A 5JPNA 3VFVB 5C6TL 4TNVF 3UBXA 4J1UA 2J88H 3S8WA 2XN9B 3D2UD 3UEZA 4EQ3A 4JQVC 3GMQB 2FJHB 3MZTA 3T04D 4JPKL 4XPFL 1AE6H 2XKNB 2ESVB 3D85D 3FQUA 4PLNC 1DLHA 3D3VE 5EG6C 4CL7A 3KPSB 4KVNL 4OZIB 4JDZA 3PF2A 4EEEA 5LGHL 1PAMA 2DQGL 4C56A 4KROC 1WCBA 5HI4D 4K3EH 3KPRD 1YDPB 3JWOH 2P49B 5E2WH 4S0TD 3MGTB 4KJYA 1IM9D 1T20A 3ROOB 1MCPL 2FX9H 4XX1G 4Y4KD 3RZCA 4M1GL 1A6WH 2ZSVB 1QSFB 2HVKA 1KB5L 3TNNA 3SHSA 1MFBL 1XIWC 5C92A 1LE9A 3CFIC 2DM4A 3LIZH 4JR9H 1PFCA 4UQ3A 3QQNA 4O9HL 2H2SD 3S3PA 3RGVA 1TCMA 4CNIA 3GSNH 2Q87A 1IQDB 3QUMA 4J8RB 1C16A 1B6UA 4RFEA 3G6DL 1FVDB 1R3IH 1AXTH 4WO4B 3V5HB 2DDQL 4PJ9C 1VGEL 3MLWL 3SJVD 5SV3A 5DK0A 4X5XA 1LMKA 2NY5L 3EYFA 4EQ2A 5ESAA 4GKZB 4KQ4H 3PGFL 2ZNWA 3S9DB 5E2VL 1NKRA 3TVMA 1IT9L 4TNWF 4M5YL 2R2HA 5EBWB 1NBVH 3WHE0 5B39B 4N68A 1FG2A 5ALCH 5ACZA 5AYQA 3DGGA 2H3NB 1RK1A 1XGTA 2R4RL 4DVRH 5EBGA 3U7WH 2VUOA 4ZPVA 4NNXA 4PPTA 1ZV5A 5IJVB 3HC0A 4N0FB 3EGSB 3GJFH 5GS1B 1CGWA 2CK0L 2ADFL 5IV2A 1N7MH 3DPBA 5C08B 2A74B 3C5SB 2CKNA 4Z7VF 1DN0A 5IV2B 5FKAA 2EDYA 3ZYOA 1FC1A 2NNAB 4M5ZH 5DJYA 4MXVF 4J3WA 1CICA 1GOGA 1VCAA 4KROB 2OYPA 2WNGA 2JTDA 4QYOA 3MGOA 4V2BA 4JFEE 25C8H 3V4UL 1CTOA 4IMLB 4QRTA 4WU7A 1Q0YH 1JV5A 4EUPG 1IAOB 3SGKA 3UJTH 3LN9A 5KSVA 1VDGA 3VDCA 5GISH 1A7OH 4W6XB 4MNHB 4S1QH 1A4JB 1GAFL 3KPQA 3K4ZA 3OKKA 3FTGA 1PQZB 4L8CB 3JSSA 3KHOA 4PJAB 5IIEB 3FTGB 3S35L 2X6MA 1JRHI 3EO1A 4CVXA 2QSTA 5DA0B 4PJ5B 4JRWA 3FT2A 2DQJL 2YD1A 1RUMH 3QQ9C 4NWTH 5C09B 3PWLA 3RZCC 2VZSA 4U6HA 2H6PB 3OPZL 2V9QA 1U0QA 2YEZB 5EORH 1D5BB 2HJLB 1G9NH 4OCLC 5IG7B 4LFHD 3CH8A 2FZ3A 5CZVH 3RJQB 5KSAC 1UJ3A 1MFAH 2XXMB 5ITFB 1JIBA 5F9OH 4FRWA 4LSQH 4OT1H 1N7ML 3MMEA 1S7TB 3RVUC 4JFZL 5FHBL 1F02I 1RHFA 3N50A 4LP4A 4CDGC 4JQVA 3CIQA 3MCLH 2OP4H 3QG6A 4X8JA 1PY9A 4QT5B 3OJDA 1QO3B 5FYLE 3U9UA 2QHRL 3QDAA 5MERA 4GG8A 4XCEB 3KLHD 5KSBA 5JOPD 1UACL 2LABA 1RZFH 3PWJA 4TOYL 4NRYA 1RZJH 4WGVB 3WO4C 1H3PL 2AVGA 3P77A 2VDOH 1G7JA 4HZLB 3H2WA 3MUY1 3S96A 1MCIA 2ADJA 5IFJB 1GGCL 3IDIA 5D7SH 1D5ZB 4AT6B 5CGTA 4TVPL 3BAEH 1T3FA 3EJYD 3SDDC 3REWA 1IZKA 1KYOJ 1AHWA 5SWQA 4LRIC 2FHCA 3MRKB 5DI8A 1C12A 3PABB 3QZWB 3GM0A 5FM5O 5EBWA 4O5LH 4EUPH 4NJ9H 4OZIF 3RPIB 1FVEB 2EE9A 3LIZL 5A16B 3CLEH 1T2XA 2JCCE 4YXLH 4NM8L 1T7VA 1MLCA 1KB5H 3O4LB 2VR4A 4MCYB 4H5SB 4H1LB 1I7UB 1MI5A 4RISL 3KYOB 4LIQE 3HCVB 3X3GL 1MHHB 4U1KA 3GJFA 4V1DA 1OARH 4LSSH 5JR1H 4QXWA 4FZ8L 2HLAA 1MRDL 2V7NA 2G60L 2ZKHL 4JJ5B 5GRZA 2H1PH 3BPLC 1P4BH 2Q20A 3TC9A 4K7PX 4KUZH 4PJCF 1IM9B 5FO8A 4XP1H 2X4OB 4TNWK 1QSFD 4OUUA 2V2TA 2IAMD 1I1CA 3QWRD 1JNLL 1WTGT 5DEZA 3WLBB 3HE7A 3GHEH 4LAQH 1DBAH 1TVDA 4PBWD 2XWTB 1HSAB 3C9NA 3G9VA 3OG6B 5IGXH 3CFBB 4G43B 1ZA3B 2VLLB 1Q9KA 1R5VA 1X5JA 3C6LD 4XWOC 3L7FB 3S7GA 3BMWA 2IBBA 3CDFA 3QUZB 4TSCH 4MJ6B 1AJ7H 2Z8WC 5D1XD 5J12B 3D1MC 3EOBB 2R0WL 2DL9A 3EYQD 3GMMA 1MWAA 3CFJA 4MXWH 5DJAA 2MNUA 1NMAL 3Q2CA 5GZNC 3FCTA 5IK3B 1CICD 5JIPA 2R4RH 5HYFA 5H35A 1BEYH 3JWDL 4ZTOL 1DL7H 1TVBA 1HDMA 3WNNA 3DXAA 1NANH 1TVBB 5MI0C 3OAYK 4X7FC 1ZGLA 3F5WA 1PG7X 1ZKAA 1RIUL 4GXVL 3RVTC 3JXAA 3CD4A 3KS0H 5IKCA 3ARBA 5I1CH 1CL7H 2AKRA 2MPAH 4PY7A 4YZFE 2YMXH 4XH2A 4H20L 2A6IA 4HUXB 3EYVB 3NIDE 4A6YL 1JWSA 2R23A 2H45A 3GSOB 1QHPA 1WZKA 3L1OH 5T33H 2BSRA 2EO9A 4OGYL 4G8EA 4IRJB 3T0VA 2W0FA 5JOEA 7FABH 3ILQD 4MAYD 1FNLA 3HUJE 3WEXB 3VXME 2D2OA 5DQDL 1CFTB 2D31B 4RMVA 4ISVA 1IEAA 4X7TB 3C5ZB 1MJUL 3BE1L 1OSPH 1YMMA 2EE2A 1A3LH 3C5ZA 1XAUA 4WEMB 3KLSA 1BP3B 3VI3F 2RBLA 2F19L 4XC1H 4CVUA 1AC0A 2PYFB 4FA8A 5CZXC 1S7UB 3KAAA 3P73B 5DR5H 5FUZL 3S5LG 4KVCH 1OOAA 4AEFA 3K2UH 4YEEA 4PTUB 3MNZA 4OV5A 4I0PD 4JZJA 1Q8MA 4X6BB 5CZKA 3VXPA 3BISA 1X7QA 2IFFH 4G5ZL 4U1SB 2XA3A 4P3CH 1V3MA 1AIFA 1EJOL 4OV6F 2OR9L 1T2JA 1FL6A 5TDPB 2BOCA 2JLLA 3HCVA 2IANB 5GGSY 2VSCA 2EIEA 2FATH 4NQDE 2RAMA 4GBXA 2VITA 3RWJA 2Z4QB 2R69H 3KVQA 2BMKA 4A6YH 3DTXA 3F7VB 5LQBL 2YD8A 3VXOA 3LAFA 3T0ED 2R0KL 4ZUTB 3B9VA 1JYXA 3VXOB 4K55A 2R9HD 2XTLA 2PYED 1EK3A 3PL6B 1KCSH 5JORB 2HH0H 4PB0L 1BX2A 3UX9B 5HY9B 4HHAB 2RJMA 3C6LC 4XWOD 4YAQA 2GITB 3CFCH 1IMHC 4U6TA 2ORBL 1DBJH 1T6VN 3NFNB 1I3RA 4LARH 3OBAA 4MAUL 5LCVH 1F8TH 4MA7L 1HHIA 1QFOA 4WHYG 1JF1B 4IRZL 2QSVA 1EPFA 1KBGL 2PNDA 4F58L 4JCMA 3FB7A 3G5ZA 4IHOA 4RISH 2R0KH 5FUCE 3CVHA 4OLVH 5EBLA 2BHYA 4G42A 3RBSA 3I9GH 1SM3L 1C5CL 5FF6B 5LAXA 1OP5H 1C5DB 1MFCL 1YEHH 4JKLA 1S7TA 3QIWA 4RIRA 1DE4A 5ADOH 1CG9B 3MOAH 5EH1A 4NKOA 4KMTH 4ONGH 5J13B 2VDPL 1VFAB 4AIOA 1R3JA 1MWAL 5FYJD 3NCBB 4BZ2L 1QSFE 2VN4A 1Q9WA 4G8GA 2OJEA 1RZJC 2J3SA 5DK3A 3BDYL 5ERWB 3KPMA 1WK0A 3MV9E 4YUEH 1NKOA 2YXFA 4PJCA 3ZDXE 2R56H 4OZHB 3RA7H 1YNTB 5B4MD 1JF6A 1F90L 4IOIA 3X14B 5HDQL 5IHZB 5DD3H 5DJXA 2C3XA 2CH8A 4HWEH 5BQ7A 5E6YA 2ARJQ 3VGHA 1OSZB 5E7BA 3ILQC 3VRJA 1A9EB 2IH1B 5CSBA 3H9HB 3ULSB 2VXUL 4B7IA 1NCUA 4FQ1H 3WXWL 1OTTC 3BKMH 3C6LB 3L5JA 2AI0H 1KJ2A 4TULH 1X5LA 1S78C 4CJ1A 3MRJA 4D9QD 1FG2B 2P5WE 2XWJB 1S7UA 5JIIA 1YPZA 4ZFOB 4Q9CA<