3MLUH

Crystal structure of anti-hiv-1 v3 fab 2557 in complex with a zam18 v3 peptide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
220
Chain Sequence
b'EVQLVESGGEVKQPGQSLKISCKSSGYNFLDSWIGWVRQIPGKGLEWIGIIYPDDSDAHYSPSFEGQVTMSVDKSISTAYLQWTTLQASDTGKYFCTRLYLFEGAQSSNAFDLWGQGTMILVSSGTTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 220
sequence length 226
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mluH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mluH01
1N3NB 1KLUB 4G8GE 2C26A 5DVOA 3KPSA 1RUKL 5IJKA 5IW1B 5DJXA 1ZLUK 3BIKB 4Y2OA 4LF3B 5TE4L 1CD0A 2AJYL 4HIHB 3ISWA 4R97C 4PGJA 2FYYB 5C0DA 5CJXA 4JFEE 1FORH 4O2EA 3KPMA 1RUML 4MNQA 4UT9L 2GIYA 5HI5C 5C3LD 1SYSB 2H1PL 1AXIB 4KK5C 4OD3H 3CC5B 4NC1C 4AENB 1LE5B 2W65A 4R4BB 3WN5B 5IEHB 4LCIL 4GBXA 3DGCR 3MUGB 4HPOL 3UBXI 5E2VH 5IB3A 2CK0H 5DZNA 5HVHC 2GTWB 2H3NB 5FK9A 4JFFD 4OZGF 3QULB 4R4FH 1T04B 5IFJB 3T0ED 5DJ8B 3EDJA 2A6JA 4X6CE 5JIPA 2OQJB 3ARFB 4PJ8C 2G75A 2IQAB 4HFWB 1VFMA 3WYRA 4TOYL 3RWGB 3RY6C 4POZD 1J12A 3PDGA 4M6AA 1QBLL 1VEPA 4UDTB 5FGCB 5DT1H 4G42A 5DVLA 2K9UA 1L6ZA 4G6KL 1IILE 1JI1A 4GSDH 1U8QA 4JJHA 5BZDA 3TT3H 3TP4A 5DRZA 2P47B 1ITCA 3D0LA 4P2QA 3S36X 3TT1L 1SJHA 4BSJA 1V3KA 1RHHB 2BSRA 1FNSH 2EKSA 3GRWL 3PL6C 3HR6A 4HZLA 4PRAA 1KFAH 1W2KT 3LKQB 1MIEH 5BRZA 4YUEH 4LSUH 15C8H 3H9SE 4AQOA 1NBZB 3NIDF 2R0LH 4HQQH 4P5KB 3B5HA 1DFBL 4JRWA 3R06A 5B22A 1QYGH 3QUXC 4PTTA 2H32A 5HVWA 4GOSA 5MEPA 2NQCA 1U8OB 2A9MH 1MI5B 3WUWA 4GMSH 5JXED 3HMXL 3P9WB 3EOAB 3L6FA 1PX3A 2MQCA 5FHAL 3J7HA 2JELH 5L8JB 3QWOA 3SDCC 2FD6H 3O2VL 1MCPH 3HI5H 3GBMH 1TQCC 2ZG1A 4Z9KB 4WTWA 5HYJA 5E70A 4OGXH 3ARGB 4M3JA 5L88L 4YR6A 1ZHBA 5DSCA 3W39B 1RIVH 1WJ3A 3WIFB 5L7XH 2ATPA 1A1OA 2NXYC 2AXGA 3QDJE 3LSOA 4YZFF 1MWAA 2GK0B 1ZHKB 3ARDB 4XP1L 3GSXB 2X4TA 3VD7A 3ULUF 4QEGA 4H88H 5DI8B 3HMWL 4WW2F 3I2CL 3LV3B 5A3ID 1HCFX 4PJ7B 3RRQA 1QR1B 1N0XH 3P0VL 4PRPD 4Q6YA 2ICEA 3G5VA 4Y88A 3JV6B 3IFLH 5CD3B 2R56H 4OZFH 4XMPL 5T33L 4EVNA 1RIHL 2P5EE 5D5MB 1R24B 5D6CB 1CL7H 4ZNEE 1MHPH 3T4YB 5J9PA 4NCDA 4GUPB 3UTSB 3GM0A 1S9WB 3KYKL 1RU9H 3MXWH 5EOCL 2P8PB 3CVIL 5DLMH 1IC5L 2FLBT 4LLQB 4QT5A 4YHLL 5D1XD 3TM6A 3VFSB 2B1HL 3CD4A 3EYUL 1T21B 4ORGB 1B4RA 1MFAL 5HSFA 1YEEL 1RJLB 2HKHL 5LGHH 1JF1B 4WO4A 2IMMA 4RWYL 1CCZA 2F74B 1G9EA 1BZ7B 1GIGL 3VA2C 1OWWA 2OTUB 1WBZB 4HAGA 3AU1B 5JO5B 3ZE0E 1R3JB 3BEVA 3LHPH 3T2PA 2G60L 1R3LB 1MHCB 5BMFL 5IWLA 4LDOB 4J3OC 4IS6A 1RAMA 5L6YL 1E4KA 4WUUD 3IJHA 1A8JH 4HEPG 1PFCA 5DFVD 4POUB 3RIFF 1V3JA 4PIRF 4G6MH 5L2JB 5IESH 2IFGA 4QTHB 1FV1A 4GT7A 1GGBH 4G5ZH 3RI5K 2IQ9L 3PGDA 1A1NA 5EO1A 1MY5A 2JTDA 2CIKB 2J12B 1MJ7L 2EDYA 1OW0A 4NUJA 4Z7WB 1VPOH 5C7XL 2OTWA 1IMHC 5IFHL 3BKCL 3JWOH 2FX7H 1II4E 2D3VA 1WIUA 1LO4L 2O61B 3GI9H 5JPNA 4JFQA 3TNNA 2Z8VC 3INUH 2BHZA 3SDAC 2IG2L 5KBNC 4R0LC 5FA3B 3MLVH 2D7QA 3LS4L 4KHTH 1Z0NA 1A14H 4HKBA 5AZ2L 3VRJA 3MUJA 3MRPA 2EDKA 4PJIB 1P2CB 4F8QA 3CFEA 3QFJB 5SX4H 1CXEA 4LAQH 1I1CA 4XNQA 2NY5H 2QSQA 5CKAA 4N0CC 5DMGC 4NKIL 1L6XA 1MI5D 3NFNA 2YZ1A 4TSBH 1A1MA 3V4VH 1GGTA 3ULVE 2J2ZA 1CTNA 5J57B 5CEXA 2NYYD 4ZSOE 3D2UA 3K46A 2XXCB 1JHTA 1UFUA 1JHKL 1BGXL 2W0KA 5DD0H 5JOEA 2WBJB 2CRIA 2ZUQC 3LDBC 4M1DL 4NRZA 5GS0L 1CLYL 3ARGD 1CLCA 2FJGA 4M00A 4FQJH 4D0DA 3FFDB 5HHMB 1YMHB 5ICYB 1LO3L 1XIWD 4NO0B 4K3JH 1YN6B 4OM1H 3OXRA 4Z7QE 3TA3B 1PZ5B 4JKPL 5D1QB 2VXQH 3VMPA 3P9MA 4DUVA 2CK0L 2YMXL 3ARDD 4IHOB 4HWBL 3QUKB 4U6TA 3MJ9H 4KJYA 4U1MB 4XPAH 1KPUA 1G7MA 3IFOA 2A9NL 1T5XB 1UH2A 2F53D 3MLYL 1MNUL 1UJ3C 3O3EB 4YHKH 4KKCC 4Y4HA 1EHNA 5DT1L 5D2NE 3ULVC 4JO3L 1KULA 5DC9B 3VFOA 4WWKA 2ZUVA 3T8XB 4XNZC 5HTSA 5BQ7A 4AEFA 1V05A 4MSWB 3N1FC 4PP1C 4Y8DC 3VGAB 4U1HA 2YD2A 5MHSD 5IEKA 2QQNH 5E5RB 2HJLB 4O00A 1XAUA 3WNPA 3C8KA 4IOSD 1I1YB 4LSUL 15C8L 3UO1H 5EIIB 1DQMH 3CH1B 5KSBF 2CDGB 3HNTH 4P3DA 1BZQK 4W70A 4F7CA 1KENL 4WFEE 1WBYB 4N5ED 4I18B 4NQDB 1HYSC 4I3RH 4KAQH 4B0MM 1IC1A 3D3VE 3E8UL 2AV1A 5SWQA 1TETH 1KIPB 4W4NA 3FOMB 2NY2B 2A0LD 3MRBB 4PJEE 1RULL 2R2EA 4ERSL 4LCYA 1GGCH 3MV8B 1CT8B 4HUNB 3OKEB 3QXWA 3EYOB 5D2NC 5E9DE 1MCPL 3EDEA 2AI0L 4XP5L 3NCYS 2DQUH 4RMQA 3VXMD 3TBWA 3CK0H 3UP1A 3W81A 4F7MB 5I30H 2HMID 3VGHA 2YK1H 2DYPA 3L95A 4E41B 1AI1H 2PKDA 5DUML 1OARH 1I3GL 5C9KA 5K9JH 2Y1VA 1KCUL 3EDKA 4N8PA 3N0PB 4OB5L 4NNXA 5GGUB 3MNWA 1KCSL 3DHMA 4QXGH 5HHQA 3VE0A 1IE5A 1JWMA 1B2WL 2E3VA 1M05B 3QJHA 4GQ9L 4QYOB 4WI5A 5E8NB 2V7NA 1NGXA 1U92B 5EUOB 1N0XL 1T1WB 3VXQB 4NO3A 4QHUB 1V3MA 4X7TA 1H0DA 4HKJB 3KNBB 2V2TA 4CVUA 1WISA 5HHNA 3QFJD 4JREC 1FFPB 2A1WH 4OLZH 1ED3A 1WFTA 1I9IH 4MD0A 3LKNB 2OL3A 5FYKU 1U8JB 5KTEH 4M3KB 2AAVA 4M6OH 1RU9L 4KK6D 4Y16A 4YLQT 5D6DA 3IDXL 1W8OA 3RY5A 3MNZA 4IEFB 4OZHB 5FYJD 1LNUB 4LU5H 4RAUA 4D0BA 4UMGA 3S37H 3V6ZA 2ITDB 3KPRB 1NMCB 5F3HB 3S6CA 1DEEB 4ZDHB 3K8KA 3OKLB 1Z9OA 5EFIB 5LGHL 2KUTA 4LSDA 2EZ0D 4NUGH 4ZOAA 1RZKC 1H8NA 4BFBD 2BVUA 1BECA 2GTZB 2WBJD 1D5XA 5HPMA 1ITBB 3NBNA 1XGUB 1MRDH 1NFDB 2VH5H 1AQDA 5HHMD 1F8TL 4OZIB 4NO0D 4PR5B 2EC9U 1MAJA 3HE7A 1L9NA 5ACLA 3P4MB 1LEGA 2Q3ZA 3BFOA 3TA3D 2HRPL 5SV4A 3ZE2F 8FABB 3PHSA 1F58L 3OKOB 5D1QD 1WFNA 1EEZB 4UI2A 2CO7B 1KB5H 3HKFA 1NMAL 4MA8L 4ZUUB 3HPLB 3LN9A 4I8DA 4A6YL 4OI9A 4NN6B 3LMJH 3FO2A 3M07A 2X4UA 5DJ0B 5FCUL 3JWOL 2H9GA 2W9DL 1Z9LA 5FYJH 1TZHA 4ALAH 4NQEE 1JZ5A 4J3XA 4LQFL 3C09C 4R26L 5IMOB 3BYYA 2DQTH 1E0OB 3CVHH 3U7YL 3SE8L 1SVCP 2MCG1 1CR9H 1W72A 4HWNA 4UIMB 1QRNE 2JIXA 5T1KA 2DD8H 2KKQA 1JBJA 5FHBL 3VCLA 3QCVH 3BYTA 4J7RA 1EZVX 4Z5RB 3BPCB 3DVNB 4HS6B 3NIGE 4NNPL 2HLFC 1KNOB 3ZT5A 5LCVH 3TN0D 2MJWA 4IRJC 5ICXB 4GQPH 3IDNA 1WWAX 3TZVB 3EBAA 5EO9A 4Z7NF 2PYEB 3G6AB 1LP9A 4MJIE 2P1YA 4B53A 4DTGH 1FZKB 4W4OC 2OJEA 1F3JA 2NY2D 4X4MA 1KBGL 4O9HL 5GGVH 1C5CH 4UB0H 4P0DA 4R7DB 4HK0B 1P1ZA 1HWGB 2NXZC 4L8CB 5EZLA 5ALBH 3B9KD 2YBRB 2YD3A 5GRUL 2YD8A 3WJJC 3MV8D 3VA6A 3PWUB 3Q6GL 4OQ1A 4OZGE 4PS4H 1NBVH 2B8OT 4XPHL 2DQJL 1FN4B 5CZXC 4XP6L 4J3VA 5IOPB 5SWSE 4YXHH 1TJGL 3I3DA 5EUKB 4E41D 1DN0B 1BD2B 3EOYG 3REVB 2CKNA 1TCRA 4KJQC 3V5HB 3NPSC 4HK3N 3OWEA 3SHSA 4PTUA 2VXQL 3HUJE 2VKXA 3RKPA 3O4OC 4HXAL 3IJSB 2GAZB 3BEWA 1F6AB 3MJ9L 1MOEA 3F6LA 3V0WL 3HPJA 4HULB 4WHCA 1U3YA 1FZOA 3N85L 4QRQB 4EN3B 3NIFE 1KCRL 3P30L 4BELD 2E7HA 2P42B 3GSVA 2DB8A 1ZLSL 5DYOA 1CE6A 5AAWA 1CG9A 1S7SB 5HVGB 4GW1A 2NZIA 1N7ML 2DL2A 1J5OH 1GHFH 4OLYH 4ZXBA 1Z5LA 2YC1A 4LSSL 5EH1A 4MNGB 5EOQH 1G9ML 3BMWA 3ECBB 1OGAA 1QSVA 3MLRL 4XI5D 2B5IB 5FCSH 2XN9B 3KPRD 1NGQL 2ADFH 3GJFB 2HT3D 3D69B 2P5WE 3HZMB 3IETA 5F93C 5BVJA 3RU8H 5IW6A 2VAAB 2FO1A 1J05B 5DD5L 1DSFH 3RHWF 4S2SB 1TZIA 2PO6C 4UV7H 2EDTA 4YQXL 1U2CA 3GMPA 4XXCC 4U1GB 4XPFH 4KMLB 1KTLA 2PCPB 3S5LG 4YZFE 4M61A 5IBUB 2MFNA 4O58H 1AIFB 3WFEL 4QRPB 4IMKA 4XZUA 1KPRB 2VDKH 3VDBA 2FZ3A 4KMTH 1RY7B 4KFZC 4X7FC 1ONQB 3C08L 4QTIH 3BGMB 3LQMA 3FCTA 4LSRH 1Q9LA 2BNUA 2P4AB 1XF1A 3JBG7 5CEZE 1IC7L 2UWEE 4HS3B 2IANB 1G84A 1QLFA 3ETBF 4K94H 4RMSA 5CGYD 2LE9A 4IIQB 4XBEH 4DOHE 5GISH 2YEZB 4IRSA 3SKOA 1KGCD 5IG7B 3O3UN 5MERA 1FSKC 4XWOD 3O8XC 3QQ3B 5FGSA 2Q20A 3TCXA 2BFVH 2AEIT 3BPNB 4MWFB 2RGSA 3HFML 1NBQA 3H9HA 5DQ9B 5K9OA 4MQXC 4M9PA 3RZCC 5I1DB 4XBPB 4X6FA 2C4FU 2R2BB 3AREB 2QTEA 3GKWL 5I2IA 3BUYB 1RJCA 2FBJL 1JMXA 1NSNH 3AS1A 1EXUB 3RWCB 3TIDB 4EXKA 1QLEH 4ZFFB 5F6IC 1BX2A 1RUPH 3ULUC 3MREA 2ZSVB 2OI9B 1IL1B 1KG0A 3FL7A 4WW2C 5BS0D 5F7DA 3C6LC 4OCLC 5ID0B 4H20L 3RL1B 1GOFA 5HHVH 3TBVB 3K8MA 3U4BL 2VE6B 3BW9A 3JV0A 2ID5A 4LDEB 4MAUH 4U1SB 2BJML 4EBQH 5JOFA 1KJMA 3ZYOA 5EN2B 2VDRL 3I3EA 4WFHD 2X1XR 2E6JA 4EDXA 1CXHA 3SE3C 1PYWB 1MJ8H 1DP0A 4Q6IA 1CFNA 4JAMB 2F5AL 4YDVB 5CHNA 1BD2D 4PJAA 1MRCH 2O93L 4OIBA 3OKMA 5C86A 3CCHB 4M48L 1GAFL 1MCDA 1GPOH 3GRWA 2OYPA 2OS7A 5BO1H 4P4KC 4F33B 3UMTA 3WHE1 4NGHL 3VWKB 1KCVL 3AY4C 4Y4KA 4CADB 4DGVH 1GGIL 4XMLH 5D96B 5CILH 4XGZA 1UCTA 4FNLL 2CMRL 2M8XA 1XR8A 4JRYE 4EN3D 4HUWB 3HC3L 2VLKB 5LXGL 5EU6B 1TVBA 1VGKB 2CUMA 3MV7E 1RJYB 5DK0A 4QXUH 1IJ9A 3HMXA 5ELIA 2X9XA 2WNGA 4PJDF 5CINL 1JYNA 1FC1A 3IFPA 3RIAK 3GGWB 1D6VH 3TO4C 3EOBA 2GJ6A 2DLFH 3R0MA 4OIAA 4PJBB 3DO3A 1QSFA 5JNYB 3IAPA 4FG6C 4I13B 3G6JB 4DJMA 5J7CC 5HYFA 1A02N 2CXKA 2YD4A 3KYMB 4GRLC 3IRPX 4Z0XB 3KDMA 3TV3L 2J3SA 5KJRH 2Z31A 4OT1H 4N9OB 2RFXB 3WNMA 3DX9A 2VLRE 1BP3B 3G9VA 1MCIA 3DBXA 3WDHA 4QRPD 2X4PB 3O45A 2XTJE 5B3JF 3DTXB 5JHDD 1QLRA 2ZZUT 3LH2L 1MIML 3O4LA 4OKDA 3NCYP 5EPMA 2VDMH 1J11A 3VFTA 2PTUA 4GW4B 4AH2A 1RZGB 4YPGA 4KRNA 4TVPD 3P4OB 5I75C 3DWTA 4OI8A 3C5ZD 2IAND 1AJ7L 4LLUA 1YDPB 1RZJH 4ZAKB 4UU9B 1CXFA 3BZDA 2R1XA 3SE4C 4XAKE 3GJFH 2R0ZH 5CLWA 3IJYB 4KY1L 3ROLA 1FL5A 1T3FA 4RX4A 4LLWB 4ELKA 1PKOA 1PW3A 3P0YH 2DQGH 5J06A 5FUCE 1MVFA 3HA0A 4OLVH 3MROA 3KVQA 2UUDH 4LPTA 4MAYB 4MX7B 4EIZC 2HJKA 5IB4B 1CF8L 4GAFB 2QQLL 5EDXA 2VXUH 3CSBA 3VFNA 1VGEH 3GSNB 5FDWA 3NFSH 4HH9A 4JO2L 3ARED 4AEEA 4MDJB 1YC8A 1VFAB 2EE9A 5L2KB 3BRDA 2C3GA 1CE1H 3T09A 3D85A 1KB9K 1U8KB 4U2ZA 5EBGA 2XTJC 1T7XA 3OX8A 3HAEB 5HGDB 4JFOB 4I3SL 2G2RA 3MLTB 4P2CG 1HINH 5C0GB 5LGKA 3A6BH 4YNYB 3SCMB 3MOAH 3RNKA 3QO1A 4O02H 4RMRA 1XF5B 5GGQH 3QEGH 5BV7L 4I2XE 1TZGH 1A2YB 2HLAA 1JPFB 3EHBC 5GGRB 4Q0XL 3FQTA 3IXAB 3NCBB 3QUYC 4QF1B 3IDGB 4N0YH 3OKNA 2VLJA 2Y06L 5DHVB 4Q9QL 5ACZA 5I8EB 1IGIH 5I1GH 4KTDL 4XPGH 5FUCC 4JZJB 5ISZB 4X6DA 4OGZA 1RURL 1OB1A 1L7TL 4LCUB 3BPOB 4HC1L 5EB9A 4K8RH 1CGSL 3OR6A 4R97B 5DJYA 5M7QA 5I76B 4KMTL 1QA9A 3CDYA 2HT2C 4FMFA 4MA3B 4OIIL 3V7AG 5DD6B 1ZLUH 1D9KC 5AD0B 4LKCA 1SJEA 2VISB 5IM7B 5DMYA 3GMRA 3QDMB 2CJUH 2VLKD 4IDJL 1QVOA 4WHDA 1CDIA 2AJZA 5HVHB 4NRXB 2RHEA 4OF5A 3RKDD 2UVEA 4JEGB 4G6JH 4XCYB 1XGQB 4NZUL 3VFPB 5DEFA 1INDL 1I75A 4WV1A 5I8OH 1NANH 2XKNA 5D2LF 4RGOH 3ARZA 3WKMH 5IB5A 1V5JA 4GRMB 3NABH 5AWNL 1I4FA 3QPXL 3ESUF 3IS1X 3OR7B 3RWIA 3V5DB 5T3ZD 5D71H 3MNVB 1MAML 4N1CA 4JKKA 4XCNA 4KJWC 4TRPL 3BP5B 2CKBH 4JFEB 4JANB 3TYGH 5GIRA 1XF4B 4EI5A 3W9DA 2ZOLB 1FC2D 1YEIH 1FVDB 5HHXH 3G9AB 3EFDH 4BFEA 1P4BH 2NY6D 5KVFL 3UTZB 4HWBA 4FTVA 4EBQL 1XGRA 1J1XH 4AT6B 4PRBA 3T2QA 2DQFB 5DUPH 3H0TB 4U1NA 1I7RB 4F7PA 2CRYA 3PIQA 4Y19D 4BA8A 3RDTB 4XAWH 3MXVH 3QUXB 3RNQB 1DBBL 4F7TA 4X6CB 1A6AB 6FABH 1DVFD 1NCDL 2J6EH 4ZAKD 1FAIH 1FPTH 4TUOB 5FUZH 4E42A 1YNKL 2ARJA 5ADPH 1RUQH 3S5LA 5I17A 3V2AR 4L29B 3K1DA 1GPOL 1N59A 3SDCB 4YJZL 2DRUA 2GSIB 5CWSA 1WLHA 2XPGB 5T3ZH 3T1FB 1XGYH 4P9ML 2XKSA 5D9SB 2DM7A 2DOCA 3MLSL 5EZJA 4OJFL 1MCBA 2VSCA 3QIBA 1GC1C 2NLJB 2AK4D 4JHWH 1YJDL 1JTOA 1SJXA 5IV2A 2MCPL 2NXYB 4BH7B 1T83C 1OAUH 4RQQB 4JFFA 3H9SB 2E6QA 5J12C 2P45B 3VG0L 3T0EA 3JV4A 1ZKAA 4F2MB 5J13C 2BMKB 3S37X 5LQBH 1XGPA 2ESVE 4PJCF 3SCMD 3IDYC 2AXHA 4OCWH 4FFVC 1X5IA 4TUJB 3LRSA 5I0DA 1YUHA 2VLLA 3SKNB 3BQUC 3RWHB 3WFHA 2A2QT 5I0ZA 3HZKA 4H1LB 5CJQH 4OLEA 4LLMB 1QBML 1D6VL 3QNYA 4PG2C 3W0WD 3QG7L 1FE8H 4EUPA 4NYLB 3FTGA 1CU4H 4L3AA 2SEBB 2EDQA 3X17A 3TH3T 3NPZB 1ZHLB 3ZL4L 5EZIL 3OF6A 5GRZA 2ILLA 4JZNA 3JTSB 4JQVA 2VZUA 2CGRH 4RAVB 1HKLL 5KJRL 3GSNH 4OF3A 4HJ0C 2PW1A 4U7KA 4M5ZL 1V7NL 3QDJB 4KVNH 3KPOB 1BVKA 4PY8I 5I1KL 4L4VE 5HI5D 5CCKH 5I9QB 4KK5D 3S4SG 3VFWA 3KLSA 1JRHI 3HAEH 1JN6B 2DMBA 4GXUM 1EFXB 3ARXA 1KTKE 1KC5L 4XXDA 3SGJC 3C8DA 5KSUB 1FZJA 3EFFA 2E7CA 3QDMD 4ZUTA 3MGTB 1YA5A 2AJVL 3DVGA 2R0ZL 1DZBA 4QRSB 4ZO7A 2R0WL 2VDNL 1P9MA 1MCSA 4XNXL 2P5EB 5D7IE 3PDOA 3DX6B 4P23B 3HZVA 4PJ8D 3RX8A 5DHVH 3W11C 3QUMB 5EBMB 1DJSA 1EO7A 4F9LA 4PGCB 4JGUA 1J8HA 1I8LA 1MF2L 1KIQA 3DMMB 2EDBA 5CD5C 4WU7B 2C3HA 5ITFB 3KR3L 2B1AL 5GS2D 5FV2A 5F7KC 4U6HB 1L9MA 5C09E 3QDGA 4X5XA 5D8JL 3SDDC 1OM3L 3QEQB 1UEYA 3MACH 5EU3A 1UT9A 3PV6A 3QUZA 3SDAB 3MGOA 1J0IA 2VL5B 4NIKB 1OLZA 4R0LB 1KLFA 3A6BL 1ZXQA 3PL6D 5F9DC 3T77A 5BCAA 3VFRB 2VTFA 4O02L 1BFVL 1BJ1J 1NFIB 4TULH 5GGQL 4NQTA 1UWEH 4TVPL 1DQQA 5DEGB 1NC4A 1HHHA 4X0KB 1KN2L 2VXVH 4JO1H 1X3DA 2H2SC 2E8YA 4G7YL 2D7MA 4NO2B 1QHOA 1ACZA 4A6YA 2CPCA 1IGJB 1ND0B 1A7BA 1PGRB 4FQQA 5KS9B 2IBZX 4PRHE 4YK4B 2YXMA 3GIVB 3ULSB 3AUVA 3QUXD 1N3NA 1KLUA 4N8VB 2UY6A 5DUBA 5F9WC 3WS6A 5IW1A 3BIKA 3DHJA 4LF3A 3W82A 5E08H 1DANT 4HIHA 1KN4H 2FYYA 4NKDB 4L3EB 1K4CB 5LG1A 4WDIA 5E7BA 1PLGL 4KI1A 3SDCD 3N1MC 5GS2H 4IRZL 1ZSDA 1SYSA 4XCCL 1F3DH 3CC5A 3DX7B 2X4QA 4AENA 5FGRA 3LDBB 1JNNH 2BNRE 2IH1B 4R4BA 3NAAH 1GOGA 5DQDL 1FGNH 5HHOD 3MUGA 1CGUA 1U3ZA 2NXYD 4Q97A 2CJUL 4L4TE 2H3NA 1T04A 5IFJA 5DJ8A 1G9NL 4PJFF 1RZIB 3ZZ1A 3TC9A 3QXVA 2OQJA 3ARFA 3BOVA 3O9WC 2H6PB 4HDIB 3RWGA 3MLUL 1MCEA 2WUCH 4P2OA 4OSUL 4UUJB 4YE4H 3S3PA 3GMLA 2NY3B 3BH8A 4FABH 3MV9A 3LCYA 2EE3A 3O6MH 2AJUL 4EQ2A 1TNNA 4Z8FH 3SKMA 3NFPA 5E8PA 3U1SL 2VLME 4UNVA 1T1ZB 4ZSOB 1RHHA 4XNZB 2IAMC 2A77L 3WO4C 4NFDA 4XNUH 4NKOB 4U6VL 3TYGL 4PJ5E 1EHLH 3CIQA 4CJ0A 3Q5OA 4WVRA 2MPAL 1NBZA 1P4BL 1CI5A 5H35A 3UPRA 1NUDA 5FYLE 2BNQE 3MJ9A 5IMKB 4P5KA 4AY0A 4OZ4A 4KUZH 3LRHA 3QDJD 1N4XH 3QH3B 5DUPL 1HZHL 1U3JA 1S8DB 2LFGA 1UB6A 1JPGB 4DWHA 1YEFL 3DRTB 1U8OA 4BZYA 3KGRA 1EFXD 4XHQA 4KTYA 4B7LA 1RK0A 1SMOA 1HH9A 3CXHK 3EOAA 3Q5YA 1FAIL 4AIXA 4M1CC 1OAQL 3V4PL 4H1LH 1IGTB 2GI7A 4U33A 4KRPC 5D2NB 3HB3C 2P5ED 3ARGA 3KS0H 1NCAL 3QNZB 3UPAA 4PJDE 1WCQA 3PP3H 2B0SH 2ADIA 3C9NB 4ODUB 1VKXA 3GHEL 1C8PA 3OTTA 1EHAA 1PJ9A 1ZHKA 1BM3L 1FLRH 1PQZB 3WXVL 4PYGA 3DV4B 3QEQD 5DI8A 1IAOB 3VXOA 3LV3A 2ZPKH 4PJ7A 1OTTC 3SDAD 1H5BB 2A83B 3D3VB 5DHYB 5E56A 4DKEH 3T4AB 3BGAA 3FQRA 4JJ5B 1T2XA 3S3SA 5L9DL 5ID1A 3K4AA 5CEYA 1JMZA 2XY1A 5HGGS 4PJEB 2DQDH 1S9YB 5B3JE 5D5MA 1R24A 5D6CA 1FE8L 5F6HI 2JB6B 3PWPA 5IHLB 3T4YA 3IAGC 1CU4L 4GUPA 3UTSA 4BQCA 4XPTH 4DGYL 5F3BB 3RWJB 3GMNA 4M4RA 3I02B 5E9DB 4NWUL 3IU4L 2P8PA 2X89A 2BOBB 2PXYC 2CGRL 4N0CD 5DMGD 1YMMA 3SQOH 4DUWA 1JE6A 3QUMH 1E4JA 4PJXB 1IM3B 3QQ4B 1YEDA 3B2UC 1VCAA 4L3ED 3KYOB 1JF1A 2Q7YB 4NZTH 3ZDYF 2B4CC 4GKZA 1FFNB 2OTUA 1U58B 1WBZA 3AU1A 2CRZA 2W92A 1R3LA 3WIIL 4H25B 1MHCA 5ETUA 3MRMB 5F1IB 4XCFH 3U9PL 4LVNB 4XP4L 1IAIH 4O2FA 2HWZL 4OGYH 1ES0B 4FFZL 2F5BL 5L2JA 5FO9B 4W81A 3RA7H 3O41B 1F90L 2CIKA 3NVQA 4MZ2A 1IGFH 2PR4L 3TBSB 4BJLA 4IBLT 4TUKL 4A2MA 4Z7WA 1ZTXH 2R2CA 1RZ8B 2AABH 2Q1EA 1G7QB 3T08A 3KYNA 3C2AL 5HYSB 3X12B 3K4ZA 3LOWA 3VXRB 4JY4A 2I26N 5A16B 1HDMA 1FYTE 3P4LA 4KKCD 4NSKB 4PJGA 4HKZB 2O61A 3ULVD 3GIZH 1G7IB 3C09B 2BXZA 4UIKL 2DIAA 2C3XA 3N1GC 1NC2A 5FA3A 2I60H 4QXTB 4KDTA 2APWA 1FDLH 4PP1D 4HPYL 2FO4B 4JQXC 3F8UB 2BVOB 1MCQA 3ARVA 1WFOA 4JPKH 1UWEL 5IJVB 4PY8J 1P2CA 4HUXB 5A2FA 3BP6A 2YHGA 3DSFH 2H2PC 2BP3A 4TSCH 2FJHA 4YAQB 1G7HB 1HYSD 2IFFH 4YHPB 4PP2B 5I19L 2FL5A 5HYQB 4MMXC 4M6ML 3MBEC 1LK2B 5IBUG 1MJUH 2MWCA 1FNGA 3ZTNH 2V2WB 3TPUB 2GSGB 5DXWA 1RI8A 3M8OL 1ZA3B 3MODL 5DVMA 1FLTX 2R23B 3RTQC 3T2NL 1U41A 5JA9A 4AMKL 3VWJC 3VXUE 5E8OA 2R15A 2AQ3A 3NACL 2X42A 1YMHA 5ICYA 5D2LE 3CU1A 4FP8L 2Z35B 3DPBA 1YN6A 1DE4A 2C5DC 4KGJA 1ORSB 3S4SA 4JFXB 1QRNB 2Y5EA 3CFIC 4U4BA 5KOVC 5IIEA 1U8IB 5SWZE 5E8EA 1DL7H 1PZ5A 5D1QA 5I8CB 4ZOEA 2QSCL 5IQ7L 5E5MB 2CUIA 2Y7QB 3NPSB 2DL9A 3C5SB 1CLOH 2DKMA 5DMIL 3QUKA 1UZ6E 5JQHC 4U1MA 3L5IA 3O4OB 3CDCA 5KZCB 5EC2B 1PG7H 5AYUL 1T5XA 3DXAD 3D3VD 4MJIB 4BQBA 1EPFA 4XVSL 5DRXB 3O3EA 4OLXL 4XC1H 3QP3A 2FIKB 2H26A 3EO9H 4OV5B 1DQTA 3T8XA 1G0YR 2XXMB 3SGDH 2DBJA 1AC6A 1F4WH 2D7TH 2J1KA 4GS7C 2IALB 4MSWA 2IGFL 4L3CA 3UBXA 3MLWH 1BOGB 4OZGB 1KV3A 3BD4A 5E9DD 5C6TH 2Q8BL 1WIPA 3OXSB 3PXJA 4CMMB 2ZCKH 2HJLA 3IS0X 4ONGH 4X7SL 4ODWB 4QHMA 2VAJA 4BKLA 3WL9B 1LP9F 1I1YA 4LPWA 1IGMH 5EIIA 2XG4A 3CH1A 5SWSB 2H8PA 3RPIB 3QIWB 2CDGA 1MRFH 1H3GA 4H5SA 2OLDA 3CSGA 4I18A 4NQDA 4NBXB 2YD9A 5A2IH 4XVTL 4KUZL 1N4XL 2GCYA 5EZOH 2ITCB 3DSNA 3GI8H 3HUJB 3IAQA 1KIPA 4PGZA 3MRBA 4FQ1H 5A2JH 2PO6B 3L5HA 4HLZH 3HC4L 4ODHH 4JFDB 4HCRH 4EI6B 1WITA 4B7IA 3FO0H 5F8RC 1JHLL 4DCQB 1CT8A 3OKEA 1MCKA 5CFHA 1UH4A 5ENWB 3CLEH 1FL3B 1X5JA 4TSAL 1RPQA 1A5FH 1EEQA 1NGZB 4PJCE 4UQ2A 5FGBA 4F7MA 1AGEB 1S9VA 4WI2A 5FYKH 4HIEB 2DDQH 1MHHB 5IW3A 3SKJH 3VXRD 1IEHA 1AY1H 5FEBA 5IHZA 2QJDA 5GGUA 3VMOA 3BRGC 1I85A 3FQWB 2DLEA 5BJTB 1UWGL 1KELH 3VG9C 3VW3L 1M05A 3F62A 2P5WB 4GBXC 4QYOA 4KKBC 5E8NA 5IMMA 4ODXB 4HT1H 2ZPKL 1U92A 1FSKB 2I5YH 4G7VL 4PRNB 3O8XB 3ARRA 4LSTL 5EUOA 1P6AB 1RZKH 1T1WA 1ZV5A 5ANMB 3VXQA 1WFUA 1XR9B 1ZS8B 3ZKNC 4HC1A 4QXWA 4JPIB 4MZ3A 4YDJA 3V4UH 5FV1L 1JNLL 4HKJA 3KNBA 1UCBH 4YHMH 2P46B 4E5XB 2HLFD 1KB9J 3SDXE 3MSPA 1FFPA 4IRJD 4YPJA 3L1OH 2NZ9C 3LKNA 5F6IB 5T1LB 3KXFA 4LL9A 3CX5K 1AGCA 2ZUXA 1EUTA 4WW2B 1IQDB 3C6LB 1U42A 4Y5VC 3T3PF 1LNUA 2B2XH 3QZWB 1WCBB 2EDNA 4M8QA 5IR1B 2ITDA 3SQOL 3KPRA 3S35L 4G43B 4KI5F 3QRFM 5F3HA 1DEEA 2NXZD 4ZDHA 3HNSL 1K3ZA 4CU8A 4ZPTB 4NZTL 2HJFB 1MVUB 3BHBA 4PJHA 4DOHB 3UYRH 2AKRB 5HHPB 3MRGB 1XGUA 5CZXD 4LNVA 1NFDA 3L3OB 4J6RL 3N9GH 5E1AB 4FFWC 4OZIA 4BZ2H 5F9JA 3PQYA 2UZIH 5D70H 4Q2ZA 1A0QH 3P4MA 4OGYL 5CP3A 3OKOA 1EEZA 2X5PA 2HFGH 3D39E 4KJQD 3BISA 1UXWB 1JTPA 4G3YL 5CZVL 3F7YA 1MJJA 4ZUUA 3L3HA 3HPLA 2VR5A 3V6OA 5KZCD 4P4KB 5C0JA 2IWGA 3ZSSA 2F58H 5DJ0A 5KVDL 1OD7A 5F6HJ 5HY9B 2OZ4L 5K9QI 4LGPB 1VDGA 2XA3A 4RCAA 2AJSL 1NAMH 4XBGB 2G5RA 5IMOA 4F80A 5I1HL 4WUUE 4Z95L 2R4SL 3HAEG 3EO0A 3VXPB 2G9HB 1YEHH 4MCZB 4UIMA 2JJWA 4LRNH 1VADB 3SGEH 2UZXB 4NJAL 5DFTA 4D8PB 4Z5RA 3BPCA 3DVNA 4GAGL 4HS6A 1NBYB 2YXFA 5SWSD 4R7NA 4HMDA 5IGXH 1P5VA 3HRZA 3TO4B 4G8FB 2P8LB 2C1PB 1MPAH 5DC0A 5FM5O 2HKFH 3TZVA 1CFVL 4XNYL 2PYEA 2YOCA 3G6AA 3K1KC 2FR4B 4M93C 2ZCLH 2X4SB 3WXWH 1FZKA 2NX5B 4XP9H 4OFYD 2IFFL 5HGBB 4MLSA 4KQ4L 2PO6D 4HK0A 4JFDD 3U0WL 3NN8B 2A73A 4L8CA 2V9TA 4HZAA 3PWUA 2ZUYA 4JRYB 1OF2B 3F7QA 2KH2B 2ARJQ 4PJFE 4E9LA 4APQC 3MA9H 3SN6N 4YHZL 3ULVL 5J1TC 3QYCA 3CX2A 5B38B 4ZUSB 1U6AL 5IOPA 3DIFA 4FOMA 5H94B 2RJMA 1EJOL 4WO4C 2QBWA 3H3BC 5EUKA 1DN0A 3REVA 4YC2C 2WWKT 5GXBB 5I75B 1B88A 4C4KT 1RIUL 1TVHB 3V5HA 1DL7L 1MI5E 2VYRE 4OCRH 1DLHB 1JZ4A 5IWLC 3WIHL 2P7TB 3GHBH 2ED7A 1F2XK 3IJSA 2GAZA 3C5JB 1F6AA 1MSPA 1Q0YH 2P5WD 4GKSB 2IBGA 1GZPB 1G0DA 4U3HA 4CMHC 4PRDA 3O8XD 1PG7L 1H3PL 4QRQA 1U3HA 2D4FA 1BVLB 2LQRA 1XMWA 4MQXD 1OT2A 2NTFB 4M1GL 3RZCD 2NY7L 1FVEA 4K2UL 3D87B 4PLKC 4KTEH 1WC7B 2K7QA 3BT2H 3IDJB 4MXVF 2I9TB 4JLRB 4M62L 1PY9A 1S7SA 3P3YA 7FABH 3B3IB 2VNCA 3ULUD 2XTJB 1G1YA 1KXTB 4TTDC 3L5WA 5DHXB 4MNGA 3C6LD 3ECBA 5D93C 4JB9H 1KCLA 2XN9A 3B8SA 3WSQH 3GJFA 4AG4L 4K71C 3MRDB 5C3TA 2BDNL 2ADJA 2F53E 4ZODA 5IHUH 5CEZD 3H3PH 4OFKA 3HZMA 3RVTC 4Y2DC 2VAAA 2VXSL 1X7QB 3ME0A 4V1DA 1N6VA 3U83A 1J05A 3VU2A 1EH9A 3QJFB 4S2SA 3DROA 1P4IH 4MJ5A 1A64A 5ESAB 3MRJA 4MDIB 1SBSH 5E8DH 3X3GH 4XCEB 1OAXL 3OJVC 1A3LL 5TE6H 4RGMC 4Q9RH 1AIFA 2C3WA 3PHOB 4QRPA 3CU7A 1LDPL 4HF5L 2HT4C 1C7SA 3CLEL 4HIJA 1ONQA 4P4KD 2O5XH 1TDQA 3BGMA 3UTOA 2QSVA 3ULUH 4MLIA 4EIGB 4FQPA 4JFHD 1NL0L 1D9KB 43C9B 4YXLL 2IANA 4WENB 1S7RB 3RGHA 2Y07L 5E2UH 4IIQA 2F19H 2NR6C 2G5BB 2YEZA 4I2XB 4UT7L 1EVUA 3DJ9A 3O6FB 5CEZH 1OPGH 3A67H 5MENB 3OKDB 1UM4H 4P57A 1KELL 3QQ3A 1CVRA 1PAMA 1RZ7H 1DBAH 2YKLL 4MWFA 4HT1L 4AIOA 5I1AA 2I5YL 1C5DB 4RFNC 3CGTA 2W9LA 5I1DA 4XBPA 3KWWB 3O3AB 1HILA 3VXME 4OUUA 3BUYA 1KT2B 2BERA 4P3CH 4RZCB 3VFMB 1R3IL 3PG2A 3TO4D 1EXUA 3RWCA 3TIDA 5DJ2B 4Y1AE 2ZSVA 4G9DB 3LN4B 1IL1A 1T7VA 2R0KL 3OQ3B 4S11A 3S88L 5ID0A 5LWYH 2NX5D 2GFBB 3RL1A 1FNAA 3TWCH 4FG6D 2VE6A 2D03H 4EXPX 2R69L 2P24B 4WTXA 1MUJB 1JL8A 4H26B 1LGVA 4U1SA 5ESQB 1UVQA 4YGAB 4P59H 4GRLD 2ZNWA 1ZHNB 4GMTH 3RJDA 1P4LA 3RWEB 4YDIH 3T1WA 5CUSL 4JRYD 3JTTA 3EW3B 5HI4C 3KPQA 1VACB 1KJ2B 1JRHL 3E2HC 4X6DF 1H3WM 4KZEH 4ZTOL 1A21A 1PYWA 1SM3L 5TDNA 1IARB 3WJLA 3IFNL 3QFJE 4JAMA 1P7QB 2DQIL 4YDVA 1A7OH 4DUXA 2C1OB 4DN4L 3UJJL 2Q86A 5KVEL 4HJGB 3U7WH 1BREA 2WIIB 2E5EA 2ERJC 4FXGB 3U0PB 3MC0A 3MMEB 5DWUH 3TCLB 1YZZA 2FIRT 3LS5L 1IKFL 3ZHLA 4GH7B 3VWKA 5H2BB 2BVPA 1CQKA 5C0AA 4CADA 2EC8A 3RX7A 4ZFOB 1B3JA 2F58L 4JR9L 3KPNA 2X41A 4HUWA 4LPUA 1MY7A 2VLKA 5EU6A 1VGKA 1FGVH 3BP4B 4Y5YC 4LDLB 5D7SL 4K23H 1RJYA 1Q9OB 1YNLL 3CFDA 5C08D 4ZFZB 1IGYB 3BH9B 2BY1A 2XTJD 2ZJSH 4IM8A 1A9EA 4M5YH 4QNPE 1NKOA 4FQ2L 1A6VH 4H8WH 3NZHL 3OJMB 4UINH 3OPZH 3IDYB 1Y0LB 2FECI 1R3KB 5FM8A 3GGWA 1QNZL 3BQUB 4RISH 1RMFL 4RA3A 5MEOB 3EHBD 2AVGA 1T0MA 4GG6A 3QUYD 1BQHG 4ZD3H 4ZS6C 3G6JA 4N8VG 5T3XH 4CNIB 4X4YA 1WV7T 1KPVB 1FBIH 2DQHH 3NA9H 3QXDB 2Q6WB 4LCCC 1HXYB 4GAYB 4KZDL 3MYJA 4QHKI 3ARPA 1NCCL 4ORZC 1VERA 3O2WH 1SEQH 4I0PB 4Y16C 5D6DC 2XIDA 3DTXA 3CXDH 3ALPA 4X9HA 1N2RB 1WAAA 2DMCA 4O2CB 4GW4A 1RZGA 3GMOB 3LQZA 4Q7DA 2HT2D 1I9RL 3AC0A 3CXHJ 4G6AC 2XQBH 1D9KD 1S7TB 1EMTH 4ZAKA 1KXQE 1OQOA 1YDPA 2ESVB 5BW7C 1MLCB 5TQ2H 1M4KA 4QRRD 4X7EC 1J0HA 2QHRL 2QQKL 3PP4H 4N9GB 2WANA 5MEND 3WFBH 4LLWA 2VDQH 3B6SB 3HS0B 3MV8E 3HE7C 1XGTB 4UDUB 4M4PA 4MAYA 4MX7A 1CXIA 3NCJL 5IB4A 4K3DH 2FB4L 4JCMA 1CFBA 2ORBL 5C0RH 2AJXH 5M95B 4MDJA 3Q3GB 1VFAA 4V2CB 5DA4A 5L2KA 1CTOA 1V7ML 2YPKB 3OZ9H 4E41E 3RVWC 4XPBL 1U8NA 5T1MB 4U49A 3SDDB 3L3KB 3UJTL 3HAEA 3HHRB 5HGDA 4JFOA 5C0GA 3MLTA 4YNYA 4KJWD 4N8CH 2A74A 2VOTA 4JHZA 3O0RL 1RJZB 4ETQB 3BVNB 1XF5A 4L4VB 2YPVH 1A2YA 1M6OB 1QEWB 5EO0A 5JMOC 5GGRA 4OCYL 3IXAA 2RCSH 1C12B 3M1BB 2DI7A 1YN7A 1HHJB 3MYZA 4JDTH 5KG9B 4JFZL 3DURB 4KWUA 5DHVA 4LHJB 4LBEB 3STZB 1P7QD 3B9VA 5I8EA 2BSTB 4JKWA 1UACL 2W38A 4MXWL 5JTWA 5D7IB 4JZJA 5F9WB 5ISZA 5SX5H 4JN1H 3THMH 4LCUA 1A6TB 1YQ2A 2XT1B 1PG7X 2RR3A 3ZT7A 4OF7A 5I76A 3EGSB 4R90L 4DVRL 5MI0C 5C09B 3GEWB 3GBNH 1DBJH 2X4OB 5BVPH 3MA7B 2K7PA 2VISA 4FQHA 1IC4H 1D5IL 2NW2B 2Y36L 4M43H 1UYWL 5D7LB 4AL8H 1B4JL 5CZKA 2XWBA 5JXAH 1XFPA 2XZAH 12E8L 2O5ZL 4NRXA 4X4XB 1TITA 5DTFA 3MLZL 1K2DB 3L7FB 1KJ2H 1BAFL 1XEDA 1ROWA 3T3PE 3VFPA 3O9WB 4NP4L 4JPWL 4KRMB 4QRTA 1OP9A 1DUYB 4PRHB 4FFVD 4NQXB 4PB0L 1XF2A 1A6ZA 4ENEC 1QO3B 3QI9B 4G8GA 3BQUD 3VGFA 4PGEB 1HSAB 3OR7A 4PBXA 4WHYH 3V5DA 2BZDA 3N1QC 4GG8A 3MNVA 1J8KA 2D2OA 3BP5A 4JFEA 4RSVA 2F54A 4JANA 4P46B 3U7AA 1CICB 2PETA 2IAMB 1XF4A 1X5ZA 4IJ3C 5CJ5A 1KGCE 3WO4B 2ZOLA 1UGNA 3BPLC 1N64L 3K2UH 3UDWA 4ISVB 3SBWC 4HX1B 3A6CL 2BNRB 3UTZA 5CGTA 4WCYL 3KJ6L 4Z76B 1OAKL 4ZXBC 2R29H 4BSVA 4AT6A 1GC1H 1HEZB 4HJ0D 5FUOH 3H0TA 1U8HA 3V9FA 3V6BR 1XCQB 3BD3A 3BZEB 2EDFA 4L4TB 3RDTA 4D9RD 5GJTL 3Q5TA 1CK0L 4MB3A 2N7BA 3RAJL 3DO7A 3DYPA 5JORB 5HPOA 1A6AA 4AIZB 3BO8B 5TE7H 5BS0E 2ESVD 1IAKB 3FAWA 1H3UA 5E4EC 2CDFB 4KI5C 1S5IH 2E8ZA 1YY9C 1BQUA 3IDIB 4L29A 4M7KL 2XPGA 2XTLA 1J1OH 1J1PL 4LSVH 3T1FA 4KRPB 4MJ4A 5D9SA 2FX8L 1T1YB 4P9HH 3SY0B 5IBTH 3B9EA 1JYWA 5HYSG 3ET9F 3I75B 5KSAC 3W11D 1ZGLM 2FRGP 3MFGB 3O6LH 1AXTH 2EDJA 4PJ5B 4DW2H 2NY4C 1C5BH 4BH7A 5CD5D 1JGEB 1N5AB 1LMKA 4RQQA 5F7MC 3H9SA 4K23L 4F2MA 3SDDD 3Q1SL 2BMKA 2BNQB 3QPQC 5L0QC 4FFYL 3V7MA 4TUJA 1INEH 4IRSC 3SKNA 4ZPVB 5ACMA 1QSEB 1DQDL 4MQSB 4NWTH 4JM2F 5GS1A 2PYFB 4PLJC 1HNGA 4K7PH 4HBCL 1JFQL 3T0WA 2FHBA 4NYLA 2XZCH 5TDPA 2H2SD 3WFDL 4M7ZB 2JCCF 1CL7I 1ZHLA 4R96B 1FO0B 4YBQC 3GB7B 3UTTD 4Q9CA 3RWDB 4UILL 3VXTB 3ZYZA 4RRPG 3JTSA 3SJVA 5D4QA 5I1IH 1WBXB 1BBDH 4KGLA 4PJDB 5GRJH 4NQCB 5EORH 1LD9B 1F4XL 1QFWH 4MJ6B 3QDJA 2FDBP 3KPOA 3GJEB 1J0JA 3IGAB 5JW4N 5C09D 1JN6A 4LSPH 1EFXA 1LK3L 5JDSB 3BAEH 4HV8A 3PNWA 1NCBL 1FG2B 3LN5A 4CVZA 3OAUH 3GNML 2DIJA 5KSUA 2VDLH 1ZT1B 3BKJH 3P9LB 5D7LD 2R39A 1I8MA 4KC3B 1A7PH 1I3RA 4Q6IC 5I1CH 5F7YC 1RSFA 5IQ9B 4PLOB 1RV6X 2D7OA 5I15H 3VXSD 1H3XA 4ZNEA 2DBLH 4P23A 5JHDE 1CFQA 4HIXL 4ZTPL 5IT2L 2M1KA 5EBMA 3O9WD 4LP4A 4PGCA 1ZWIB 3E3QC 3WEXB 3U82B 3DMMA 2ZNXA 5E2TL 4EOWL 1JZ2A 4PJ7F 4WU7A 2ZCHH 4R8WH 1E4WL 4Y4KC 4U6HA 3AMLA 3PF2A 1GOHA 3OZ9L 1RZJC 5JMRA 2I9LB 5FKAB 3TJEH 1FH5H 3U79A 3FO9A 4FXKB 2F8VA 1C16B 1NMBL 2P8MB 4J3SA 1F3RB 4FRWA 2IAMD 2VL5A 3P77A 4QHKJ 5D5MF 4R0LA 3TIEB 1PSKL 3O4LE 1QKZH 2K1MA 1IM9B 1NFIA 5ICZA 3X13B 5DEGA 2CLZB 4PYHA 2BNRD 3C60A 4X0KA 1J7VR 4ONFH 3SO5A 1A6WH 4NO2A 4L5FL 5KAQF 2YWYA 4R2GC 1IGJA 1ND0A 5SX4I 3D0VB 4D0CB 5A2KH 3CX5J 2VZ3A 1BQHA 4JM4L 1MFCH 5C07E 4N8VA 2OZ4A 1NGPL 2EH7L 5ADOH 1OHQA 3TVMA 1KTDB 4GKNB 1QPPA 3VGEA 1A4JB 1U95B 3D9AH 1ZMYA 3MBEB 1I9JH 4YXKH 4NKDA 2A6KB 5SV3A 4M1CD 4M6NH 4HG4K 4ZOBA 2AEPH 1OAZL 3V79C 1NDMB 2E27L 3O2DH 4X80H 1FYTB 3DX7A 4KRPD 3RTQB 3VWJB 3E6HB 3HB3D 3BDYL 5LVEA 3ZHDA 2VLMD 1B0WA 2IH1A 4Y5XC 2V2XA 32C2B 3WHXA 3CLFH 5EU7C 2NW3B 1AP2A 5BVPL 2FEDC 3LQAH 4PB9H 4UOW1 1LO2L 4PJ5D 1DDHB 4DFIA 2HTLC 5AYQA 3RWFB 4NHCL 4OTXH 2XZAL 3GK8L 1RZIA 4YFLI 1D6EA 1Z3GH 4NCC1 5C0IB 1DEDA 1W0WB 5I1LB 4K8RC 2IPTL 4KV5F 2JJVA 4N0UE 5ILTL 4F9PA 2H6PA 4PJGF 5C6PB 5TJWK 1OTTD 4HDIA 4QHNA 4MA7H 1NCWH 3Q0HA 4XNMA 1MCNA 2VLJE 5INDB 1QSED 2FX9H 2LU4A 2DS4A 5EWIL 4JY5H 1VFBB 1PEZA 5J8OA 4WEUD 1QACA 3EYQC 1DBKL 2QHLA 2FGZA 3MOBL 3V5KB 2AK1H 4ODTH 4ZSOA 2VDPH 5JQ6L 4WFGE 4NKOA 4QO1A 4UOW0 3QZWG 4ZO6A 4PBVC 4LLVB 3VXUB 1ADQL 1GZQA 3QRGH 5C70A 4NM4H 1F00I 3WIHA 2PXYD 4JHAH 4ZFOL 4CVWA 3ZDZE 4J12A 2OK0L 5D2LB 2QADC 1G6RL 4NQCD 1AKJA 5IMKA 1OGTA 3B2UD 2IJ0C 3EYSL 4NQSB 1GC1L 3QH3A 4NJ9H 4BZ1H 5DD3H 1JWSB 1S8DA 2AGJH 1OWRM 1C1EH 4PJBE 4PGBB 3MJ6A 1YECL 3MRKA 3KLHC 4OLWH 2KZ1B 1RD6A 2XZQL 5TE7L 1BZ9B 1LO0L 2CLVB 1AHWC 5IB2B 5TDOB 1IGTA 4TQEH 4LEOA 1MH5B 2VXTH 5D2NA 1Q1JL 3UTPE 1Y6NR 3I9GL 5LKNA 3J8F7 3KPSB 3MLXH 5FKPA 5LBSL 3LVEA 3R1GH 1KLGB 2W0PA 3G6DH 5IBTL 1FO0H 1IFHL 2AV7A 4Y19E 4Y0GA 4PJ9C 2LAGB 3KPMB 1MCFA 2E9WA 2XI9A 3BZ4B 4MNQB 1IT9L 3O6LL 4NNYB 4LEXL 3WS3B 2AW2A 1U8MB 3G5ZB 1IAOA 1MFBH 5I16B 1UWXH 4ODVH 2Q76B 1MFDH 4FTVE 4JPVH 3VG9B 4X8XA 4ZS7H 5J11B 1FCGA 3I50L 5GGSB 1I8IA 1H5BA 4TN9A 2A83A 3D3VA 5DHYA 4JRXD 3DECA 3T4AA 5IB3B 1JPTH 4JJ5A 1IM9D 1KEGL 3AROA 4NZRH 3CDGB 4PJEA 4YFDB 4WGWB 1S9YA 3S98A 2HFFA 2VWEE 5GSVB 2AK4E 2H2PD 5EBWA 5F3BA 3RWJA 4RMTA 3I02A 4YX2H 4G42B 4N0FB 5DA0B 2BOBA 5GS0C 4Y5VB 4PJCB 4UTBH 5BZDB 4ELME 1KOAA 3D0LB 3MBED 2D7PA 1IAIM 2OJZL 3QQ4A 3O6KH 5E2WH 1CD1B 2BSRB 1CDYA 3V52L 1FFRA 1RVFH 1FFNA 4HZLB 3STLB 1UM5L 4XVJH 3SOBH 5B38G 3ARSA 3DUSA 3DETC 3W0WE 2UUDK 4H25A 4OQTL 4OZFB 3RTQD 3VWJD 4C58B 1MEXL 4ZFGL 2R4RH 3MRMA 5F1IA 2APXA 4FHBD 4UNUA 4Z7UE 4BFGA 3D5OF 1T20A 1ES0A 5FO9A 3SDYL 1IGCL 1WZLA 3O41A 2H32B 5TPWL 4YHYB 3TNMA 1PKQA 4OGAC 4S1QL 2VWEC 3TBSA 3SDXB 3LZFH 5FO8B 1J0YA 5FAAA 1RZ8A 3EJJX 1NQBA 1G7QA 5I8KL 2GUOA 1SQ2N 3BI9X 4K9EC 5HYSA 3X12A 4M7LH 3QHZH 3WDJA 4D3CH 5A16A 4GLRI 2JB5L 2RB8A 5HYJB 1G7IA 1BFOA 1G6VK 1ZHBB 3QIBC 4QXTA 1U91A 2ATPB 1P53A 2J4WL 1A1OB 1HI6A 1I3UA 2BHYA 4YWGL 3VXUD 3G04A 3GSUB 3EAKA 3LPWA 2XA8H 2ED8A 4CDHA 5IJVA 4HUXA 4MD5B 2LV4A 2VDOL 2DLIA 4BYHA 4YDLB 4YAQA 1G7HA 3D39B 3QNXB 4YHPA 4M93B 4PP2A 3ARTA 5D1XB 4DGIH 1CZ8H 2VMFA 5H37G 5I6XB 1T80A 1T4KB 5JW3L 5E6IA 1CGVA 3JVGC 1LK2A 4PJHF 2DI8A 4HFUL 4P5MB 3IKCA 5J9PB 2EYRB 3D9AL 3BSZL 1AE6L 3WJJA 2V2WA 3TPUA 1TJHH 5AZEH 4ODSH 1BF8A 4JQVC 1ZA3A 4NQEA 2R23A 4Z0BL 1MCLA 5F96H 4A2LA 3HI6L 3KPSD 4WUUB 2LTQC 5GHWH 4QWWC 4APQB 3VFGL 3NTCL 4XWGL 2Z35A 4JFXA 1QRNA 3X3FH 4WO4B 1U8IA 3SGKA 1JNHA 4MNQD 1WZMA 3VH8B 2DM4A 5E5MA 4OLUH 4G9FE 4S1SH 2JF1A 3V0VB 1AD9A 1I8KB 3N1PC 4HKXA 2CSPA 1WWBX 1UA6H 5EC2A 4GBXD 3ZE1F 4AZ8A 3RUGE 4KKBD 1X5FA 4MJIA 35C8L 5HVFB 1CIDA 3ZKND 5E24E 4S10A 3IYLW 4PG9B 2FIKA 1P6FA 4OV5A 3PGDB 1A1NB 1JK8A 5KN5B 2EDOA 3SE9L 5EO1B 1FRGH 5DD1H 3L3DA 2GY5A 4XMKL 1DN2A 4FQCL 1DANU 5HHOE 2IALA 4F9LC 4HS8H 3UJIH 2W59A 1I8LC 3QCUL 4JN2B 4KVCH 4OZGA 3MJ7B 2NZ9D 1G7PB 4PJFB 1MQKL 4CMMA 1NAKH 1E4XH 4FS0A 4ODWA 5DR5L 3WL9A 4K7FB 5D93B 1CLZL 1A3RL 4JE4B 5IVXF 5SWSA 3RPIA 3QIWA 2I27N 3QUZC 2BVQB 5F7EL 4K71B 4NZDA 1LEIA 1L7IH 1Q0XL 3LEYH 5EBLA 4Y2DB 2BSSB 2VIRB 2W1NA 3CFBB 5BRZD 5F9AC 1M1SA 3HUJA 3LD8B 3H7BB 4CBPA 5GQBA 1L0YA 3MRHB 4N1EA 2PO6A 5FYLL 1L0QA 1X5HA 3ZTJH 4FFWD 5JW4R 3BMVA 4XXCA 1DQLL 1LE9B 4FZEL 4DZBA 1HSBA 3HR5B 4LIQH 4RGMB 4X83A 5ENWA 1FL3A 3VRLF 2W60A 3WS6C 1EK3A 4TQEL 3LEVH 2ZOKB 5F1OB 1XIWB 3NFNB 1A1MB 1NGZA 3MV9E 3PWLB 4MQ7B 4LARH 1NJ9B 1AGEA 1TCMA 1I7UB 4S1RL 3G6DL 4HIEA 1HWHB 1MHHA 5GJSL 5CAYB 1GVIA 1NLDL 1KEMH 5HYJD 5BJTA 2HH0H 2JCCE 2QKIB 1S7QB 3CMGA 2F53B 3H7LA 2P5WA 1MFBL 4ODXA 5EC1B 4PRNA 4OD1L 2FECL 3O8XA 2Z4QB 2B4CL 5INCB 1XR9A 3BKML 4JPIA 4RFNB 2NY1C 3G08A 2AJ3B 2AQ1A 1FZMB 3V6FB 4OCXL 2IPKA 4U6XA 3ARFC 3ALXA 1W0YT 2RIKA 1KPUB 1EVTC 3MCKA 4NDMA 1QFUL 3FT3B 5K9QG 3O81A 1IBGH 4P2OC 5T1LA 2H32H 3D39D 1I1AA 2FEEI 5HI3C 5ITBH 4WW2A 1IQDA 3QEQE 3FHAA 5JOPE 1VESA 3F7VB 5CBAA 3VFOB 4LCWE 5IR1A 3LIZH 4O5LH 4G43A 1S3KL 3WFCH 3DX8B 4JM2C 3ZDXE 4L1DA 1CD9B 2UWEA 4QRUB 1N6QH 3B5GA 4ZPTA 2HJFA 1MVUA 5EA0H 4UOJA 1ZANH 4JZOB 4N1HB 4KJPC 4XVJL 4YEFA 1UXSB 3MRGA 3SE3A 2C3VB 3C8KB 1S5HB 5AUMA 4APQD 3L3OA 1FVCA 1PY4A 3JWDL 1MCOL 1LVEA 5KS9E 4WO4D 4F7CB 3L5XH 3MRCA 1MWAH 5TF1H 3B9DA 4TNWK 5GGTL 4DVBB 5F7NC 2AV1B 2ERJB 5ESVA 3VXMB 2YD6A 3WD5H 3KLDA 4FZ8H 4L3EE 4P4KA 2FLRT 4G8IB 1I1FB 4U1LB 2R2EB 4Y1AB 3BIBX 4K7PX 4AEIH 5LGJB 2VQUA 4LCYB 1G7JB 4GAJH 3GO1H 3G5YB 4WEBL 4I48B 2WLYA 4YEEA 1G9MC 2DWDB 4LPVA 2DQEL 3QHZL 3C6SA 5HY9A 2FH8A 5C0CE 4ZYKA 4JKLA 4PLKD 3HG1E 4JG0H 5T5FL 4Y5YB 4G6FB 4NO5B 1RHFA 1JWUA 2G9HA 4DN3L 2WK2A 3L95B 5F21B 1VADA 3D25A 1D5BB 4TTDD 4F58H 1KB5B 1TJIL 4D8PA 5I18H 4NNXB 4TYUA 2YUVA 1NBYA 3MNWB 3ARQA 5JLZA 3HNVL 2OX5A 3VE0B 2YRLA 4K55A 4G8FA 1Q72L 2C1PA 2P8LA 3OMZA 4M7JH 2V7NB 4UT6L 2FR4A 3RVTD 4LNRB 4Y2DD 2X40A 4MVBC 3NH7L 2X4SA 1R3HA 4X7TB 5HGBA 4NPYA 4Z7OF 3CVHB 5HHNB 3NN8A 3RQ3A 2J88H 4LCCB 1FORL 1OT1A 4X6EB 3SO3B 4C4KO 2JJSA 4JRYA 5ERWA 4OD3L 1FIGH 1VB9A 1EEYA 5DC4B 3S34H 2HT4D 3MV7A 4PJGE 3T3MF 5B38A 4ZUSA 2BX5A 3V6ZB 1KJ3H 5JR1H 3OB0H 1E6JH 1K4DB 5HDQH 5E2VL 5KOMC 2MQ0A 3R8QA 1TVHA 3WMSA 4R4FL 3KAAA 2PNDA 1D5XB 1DLHA 2NR6D 1S7XA 1SYVB 3TGXA 1MCCA 3C5JA 1AQKH 2ENSA 3PGCA 4GKSA 1DBMH 3FMGH 2WM0A 1UA6L 5T1DH 4PY7B 2H41A 2BRRH 1LEGB 2AXJA 1H8SA 4GSDL 1BVLA 1JF5A 1Z2KA 2NTFA 5LAXB 2LAAA 3TT3L 4YGVB 3GM8A 2UY7A 2NTSP 3IDJA 2I9TA 4JLRA 2FGWH 4QCIA 1FNSL 3ARYA 2HVJB 2VLRA 1KFAL 1MIEL 5TF0A 4DQOH 4YUEL 4ZUVB 3K7UA 2WP3T 1TZHB 1GJIA 1CBVH 3TN0B 4GG6F 5C2BH 4RMUA 1G1CA 2R0LL 4HQQL 3G6JF 3DXAE 4CU7A 4KDTC 1YEKH 1QYGL 2JK5B 1W72B 1XH3B 1X7QA 3H9YA 2D31B 4WUKH 4U0RC 5HI4D 1D5ZB 1YYLH 2A9ML 2PW2B 5F88B 3QJFA 3PP3K 4GMSL 3B9KB 1HIMH 3GFUA 2RBLA 4MDIA 4U1KA 2JELL 1WAAF 4XCEA 4EZMA 5E99H 2FD6L 3IDNB 3HI5L 5FYKE 3GBML 1QOKA 2V5RA 3FOLA 4DAGH 4R6UA 3FFCE 3PHOA 4RBPH 4LSQH 4NRYB 1WEJH 4OGXL 4TPRH 1F3JB 5FYJU 4PJXE 4UAOC 1R0AH 1T2QH 1RIVL 3OAYH 1YEJH 2J8UF 5MI0B 4CN6A 5L7XL 1TQBB 1H3TA 4Y1AD 5BZWB 3GMMA 5F97E 3P4NB 1S7RA 4J1UB 4I5BB 1AXSA 1N8ZA 2EDHA 2G5BA 4H88L 3QG6A 2R1WB 4I2XA 3S9DB 3KLAA 3O6FA 4RWHA 5KW9H 3Q48A 3OKDA 4G6FD 5ALCH 4Z7VF 3L3GB 4W6WB 1HCVA 2KPNA 1TCRB 2R8SH 3IFLL 1E6OH 3KWWA 2R56L 1WVZA 4YDKH 1NANI 3QT2A 2W91A 3U30C 1CL7L 1JGLH 4RZCA 2VERN 1MHPL 3VFMA 4KHXH 1K5NB 3LY6A 5GSRB 4FQIH 2CO6B 2JJTA 4NKMB 5F9OH 1OSPH 4G9DA 3MXWL 3VXRE 2OP4H 4ODBD 4PBWD 4C59B 3JSSA 5DLML 1IBGL 3AS0A 2GFBA 4ZQKA 1UQSB 2C7UB 4ZS6D 4URTB 3U4EB 4LGSB 3CFJB 2O5YH 1DLFH 1WTLA 2P24A 1MUJA 3GSVB 4H26A 3DGGB 1RZFH 4NHUB 4U1IB 3QWRA 2V17H 5HGAB 1CE6B 1ZHNA 5C0FB 2UYLA 1CG9B 4GW1B 3WFCL 4F37K 1H15B 3LHPL 4Y16D 4YIQB 1K8IB 4DFHA 4WY7H 5I71C 3KPTA 2AQ2A 1P7QA 3OKKB 3QIUA 3CDFA 4G6ML 1E27B 4I18C 3HRPA 4Z6AT 5IESL 4G6AD 1CN4A 5IW6B 1GGBL 4G5ZL 2WIIA 5DRNA 3R4DA 4FXGA 5DEZA 5E4EB 4HG4J 3U0PA 3MMEA 3TCLA 4HHAB 4UTAH 1EO8H 1MFEH 3S36H 1YNTB 1VPOL 1TNMA 5H2BA 1JGVH 1ADQA 2UVFA 2D7NA 3OJDB 3HE7D 2FX7L 1KTLB 4ZFOA 4GLRH 5B8CB 3B9AA 1G6RA 1GL4B 1N0LA 5KSAB 5DJCB 2EYTA 4YO0B 3KXFE 3GI9L 1ZLVK 2VR9A 5C0BE 3INUL 4POYA 4JFYB 5BV7C 3BP4A 5FGBC 1A47A 1C08B 1NLBH 2Y25A 2W0FA 3QQNA 1Q9OA 3MLVL 2L0DA 3RVWD 4ZFZA 1IGYA 2OL3H 3BH9A 5JIKA 4KHTL 1A14L 1I85C 4F58L 1Y0LA 5L0QB 1J0ZA 4LLDB 2P49B 1AGDB 1EDQA 1OCWH 2BSED 1R3KA 4WJ5B 1LEKB 5FA4B 2YPLE 3BQUA 4MJ2A 3VJ6B 4O4YH 1YPZF 5MERB 4LAQL 5MEOA 3RVXC 5BS0B 3QXAB 4PG2A 4P99A 2NY5L 1VFOA 2JIXD 5T1KD 2HVKB 4M7JL 4XRCA 3LKSB 1BEYH 4YHNB 2GT9B 4TSBL 4CNIA 1VA9A 3V4VL 2IMNA 4CVXA 2DQCH 5K93A 3EOTH 3QXDA 4K07A 1XT5A 4GAYA 2VJXA 5FO7B 3I6LD 3F12B 3WLBB 4C83B 5DD0L 5CMAB 3IDMB 2VZ1A 4I0PA 4U31A 1KG0B 5F7DB 1N2RA 2OSLB 4O2CA 4FQJL 2DN7A 3BW9B 2X70B 4JCLA 3ZE1E 4K3JL 4OM1L 5DZOA 5FM4A 4JQIH 1K6QH 4WI3A 1KJMB 2ESVA 2VB5A 4EDXB 3VMNA 1UG9A 4HEME 3E6FB 4JFDE 4N9GA 3MBXH 4XPAL 1CFNB 2N4IA 1T03H 5CHNB 2MMXA 3B6SA 1W72H 2ARWA 3I6KB 1DUZB 1SVZA 3MRLA 3OKYA 4OFDA 5F8QC 2V5TA 3G5XB 3NIDE 4YHKL 5T1DL 3OKMB 4KU1A 5TQ0H 1NGYA 5IVXE 3Q3GA 4HJJH 3U36B 3V6OC 2YPKA 2A6IA 4ENED 1HQ4B 4M9OA 5F7UA 5CP7A 3QHFH 5EU5B 4Y4KB 4OQTA 4GRWF 3SDDA 3L3KA 2QQNL 4I77H 1XR8B 4U05A 3D18B 4X7DC 3UO1L 4ETQA 1DQML 4L4VA 1CDGA 1TVBB 2Y4SA 1M6OA 1QEWA 2EO1A 3HNTL 3PGFH 5DZLA 2OBGA 5ANME 1C12A 3M1BA 4I3RL 4KAQL 4BQ8A 1HHJA 5KANI 4G8EB 3WLWC 4ZXBD 3RVUC 5KG9A 1TETL 4R2GB 3DURA 3FT4B 2GQHA 1OGAD 4LBEA 2V6HA 2BSTA 4GJTB 1ZEAH 4D9LH 3WCYA 4HK3J 1H8OA 3QISA 5D7IA 1WWWX 1GGCL 3TZVC 3ULUE 5JHDB 1A7QH 3K2MC 1QSFB 4Y4FA 1A6TA 1P84J 2W9EH 5J6HA 4KI5D 5DGRA 1YY9D 2DQUL 1YJDC 2NPLX 3EGSA 5KSVB 1A6UH 1S78C 3CK0L 5I30L 1A3QA 3CFCH 4XHJC 5C09A 5I1EH 2YK1L 3C5ZB 3KDMB 5KVGH 1YEJL 1AI1L 3MA7A 1OARL 3DX9B 4RGNE 5K9JL 4Y5XB 4XC3H 5KSAD 2NW2A 1TTGA 3OJ2C 2FH6A 4QXGL 3O4LB 2AEQH 2NY4D 4GKOA 4RIRB 3VD5A 4YPGB 2OR9H 1K2DA 3ZTJG 5ALCL 3MUHL 3UAJC 4L8BB 3O9WA 3AFLA 3QPQD 4V1DE 2OCFD 2BC4B 4PRHA 2GJZB 2V5SA 3BZFB 4IRSD 1QO3A 3QI9A 5C07B 2A1WL 1T3FB 4PGEA 1HSAA 4JFHE 4OLZL 4PLJD 2J8HA 4ELKB 1I9IL 1NEZB 1W8NA 5DQJA 5KTEL 4M6OL 4X6BB 1U3HC 4BQ9A 1RK1B 4FQXA 4P46A 4JO4H 1FNEA 3P73B 1CICA 4I1NB 4LU5L 5FDWB 2WLZA 3E0GA 3S37L 1BQSA 2X4NB 4YBQD 4FMKA 4KKLC 1K8DA 2ZKHH 5E4IA 4ISVA 3D85B 4OKVB 4X98A 1RZFL 1YQVH 3P0GB 4RGNC 4X8JB 2BNRA 3F58H 3TBTA 5I1JH 3X14B 3SPVB 4NUGL 3BP7A 1HEZA 2QADB 4ESKA 3QO0A 1XCQA 4OZFG 3RNKB 2YA2A 1MRDL 5DF0A 3BZEA 4L4TA 4OBRA 2VH5L 3GSOB 4C55A 2V9RA 1SMAA 3DUUB 1A7NH 3IXTB 5JORA 3T0AA 3ZSTA 4DZ8A 4AIZA 4N0UB 2NX5E 2Z8SA 4Z77B 2DWEA 5F7WC 2CKBB 1ACYH 1KB5L 1WT5C 2CDFA 2KBGA 1PBYA 2VLJB 1T6VN 3IDIA 1EZVY 1AHWB 3UZVB 1Q9KB 5ACZB 2FSEA 4UTAL 1RUKH 3LMJL 2YSSB 3EUUA 2V5YA 1T1YA 5TE4H 2AJYH 4HWUA 4X6DB 1T22B 5FYJL 3I75A 5J6GB 4QOKE 4ALAL 2R2HB 1AH1A 1RUMH 4UT9H 3STBA 4X9BA 3B4NA 4PJ9B 4PJ5A 5DJYB 4MGXA 2DQTL 3CVHL 1JGEA 3LEXB 1CD8A 1N5AA 4Y4KD 1CR9L 5HJ3A 2CH8A 3FZUC 2DD8L 2BNQA 4LCIH 3QCVL 1QPXA 4HPOH 3TO2A 4IIQC 3EDFA 3GMRB 5T3XE 1RUAH 4ZPVA 1CGYA 5LCVL 3WHE0 5DMJB 2PYFA 2ZP0T 5D7KE 1I1RA 4O4YL 5TGBA 4PREA 4DTGL 4TOYH 4UQ3B 4R2GD 1BJ8A 4DEPC 1QFWM 2BCKA 3T3ME 2WUBH 1QBLH 2WINB 4KUCF 5GGVL 1C5CL 4UB0L 2X2YA 3GB7A 3VXTA 4G6KH 1J0KA 2NY6B 4Z7QF 5ALBL 5C08E 4D94A 1WBXA 4Y89A 3PUCA 2EEBA 1HK6A 1FJ1B 3TT1H 1QSFD 1NBVL 2A6DA 3JXAA 4PS4L 4H8WC 4Y19B 3GRWH 1ZGLB 4XCNB 4MJ6A 1M7XA 3BESR 1RQ5A 5GIRB 1PEWA 3IGAA 4DK3A 1T2JA 4YXHL 5B4MC 2Y6SC 1DVFB 4J23A 3LKOB 4OFPA 1G9NC 2NNAB 1FIEA 2Z92A 2P48B 1O7SA 4ZO8A 2WQRA 4FTVB 1DFBH 1IAII 2VITB 3VH8G 1T89A 3P9LA 1ZT1A 2FEDD 3O4LD 2HTLD 4WRLA 3CNKA 3DUHA 3RZWA 1F42A 4WW1B 1X6NA 3HMXH 2PF6A 1QD0A 5E2JA 1B0RB 3ARBA 4K8RD 2AK4B 5KSBE 1ZWIA 3O2VH 4JDVB 3WEXA 1RFDH 1N59B 5C07D 2FJFB 2X1QA 3FB7B 3VWKC 4M8VA 4RX4D 5TH2B 5L88H 1EHXA 1J5OL 4ELMB 5FKAA 1GHFL 4OLYL 4FXKA 3BE1H 3EYQD 4QRRE 1AO7A 5EZJB 5EOQL 4PJEF 5DJAB 3PHQB 5MEQB 4OF8A 2V5MA 3FJTA 5MENE 2Z93A 2ADFL 3B43A 4XP1H 3W0WB 1IM9A 1HHKB 1T7WA 4JQXA 5GGTA 1HN1A 2X6MA 3D85D 2CLZA 1T1XB 4JGJA 1I3VA 3HMWH 3RU8L 3I2CH 3JV4B 3MJ8B 5DURB 4Z7UB 4LVHC 1DSFL 3P0VH 1INQB 2QADD 3QEUA 3V8OA 3D0VA 4UV7L 4D0CA 2Z0BA 2J8UE 1T0NB 2VLLB 4XPFL 3HZKB 4XMPH 1EBPA 5T33H 1ZEAL 5J89A 3PDDA 1RIHH 1KTDA 4GKNA 3ZMRA 5IFAH 3QNYB 3NCMA 1B9ZA 2E7LC 4O58L 4EUPB 3KLHD 3FTGB 3MBEA 2VDKL 3KYKH 2A6KA 2Z8RA 2Y72A 2CIIA 3QAZC 2VLJD 3S8WA 5EOCH 2HP4A 3DVFA 2ENYA 1NDMA 3CVIH 4Z7VE 4QTIL 1FYTA 1IC5H 4LSRL 4YHLH 2B1HH 3CFCL 3EYUH 3VWJA 3E6HA 1J86A 1MFAH 25C8H 32C2A 4K94L 2HKHH 2XRAH 2NW3A 2EIZB 2ICCA 4WFGD 5AEAA 4XBEL 3LPGA 1GIGH 4XC3L 4P2RE 5GISL 4PJ9D 1DDHA 1T5WB 2OXGA 5D1ZA 2G60H 5GGSY 4PJ8B 2BFVL 5A40E 4CU6A 5L6YH 1W0WA 3D48R 1FNHA 1EGJH 3I6GB 1JTTA 2B39A 3MRQB 2BRQA 3KHQA 5INDA 1JI2A 4F15C 1Z0MA 2IQ9H 1NSNL 2D4DA 4M7LT 1QLEL 2DMKA 1IVLA 1VFBA 1RUPL 1MJ7H 2V7HB 3ZKMC 5DJ6A 4BK4A 4MAYC 5C7XH 1XZ0A 2EIBA 2FEEL 3DV6A 3ESVF 4GO6B 3RIFK 3BKCH 3SQBA 3V5KA 3L9RB 3SGDI 5IFHH 3PL6B 5HHVL 2DI9A 3AAZB 1FFOB 3ZE2E 4MAUL 3UTPD 4LLVA 3VXUA 1LO4H 5GS0D 5D2LA 2IG2H 4X9GA 5EU3B 4NBYB 4RMWA 2Y9RT 5DS8A 2WAHA 1F3DJ 5J4MA 5SWZA 2Q3AA 4NQSA 1MJ8L 3KJ4C 1JWSA 3T77B 4P5TC 2LU3A 4G9FB 5TFSH 5AZ2H 5C8JB 4PGBA 3DETD 2ATKB 1MRCL 1NC4B 4JY6B 4PV9A 4FTVD 2QL1A 3RUGB 1BZ9A 1C7TA 1TQCB 5BO1L 5IB2A 4NT6B 5K9KB 5TDOA 1MH5A 4DGVL 4JZJC 4MYWB 4XMLL 5DUBB 5CILL 4OGAD 1D3CA 5HYIA 1KLGA 3RL2A 3BPOC 5HHOB 3OV6A 2DLHA 3GSQB 3JZ7A 3NIGF 4ZNCD 4D9RE 3EJYC 1JHKH 1BGXH 2F54E 4WDIB 4Z7NE 3BZ4A 3RIAF 2QR0B 3L3JB 4M1DH 1YPZE 1ZSDB 4NNYA 1CLYH 1Q38A 4QXUL 5GS0H 4P4RA 2VABB 5J1SC 3WS3A 2X4QB 1U8MA 3G5ZA 1LO3H 5I16A 1UM6H 4R3SB 2Q76A 5F70A 3AB0C 5GGSA 3QIBD 4HD9A 1ZE3C 2CQVA 4RDQG 4JKPH 1ZVSA 2YMXH 1RUAL 3OHXA 3PWVA 2DLFL 5IVZA 4P9HC 3PXHA 4HWBH 2NY1B 2HFEA 3CDGA 3CUPB 5DURD 2A9NH 1OAYH 2XOTA 3NZ8B 1HXMA 5GSVA 2KZWA 3MLYH 1MNUH 3LKPB 2CR6A 1OL0A 2OMNA 5JW4M 3BIAX 1FP5A 2WUBL 1JPSH 4P2OB 1I7ZB 4N0FA 4JO3H 4OT1L 3GMLB 4NQUA 3REWB 3BH8B 4Y5VA 5IMLA 3MV9B 4PJCA 1E28B 4N5UA 3HUJF 3SKMB 4L8DA 3V95A 3NFPB 4O51B 5E8PB 1N5YH 2YA1A 1CD1A 4K9EH 4JM2B 2VDML 3PWJB 3KS0J 3STLA 5C6WH 3OF6D 2EDWA 3UDWC 3ARUA 1JZ6A 1BLNB 4OZFA 4XB8A 5JXEA 2JCCB 1RZJL 3NIFF 4QWWD 3LAFA 5H35B 4PUBH 3UPRB 1KENH 3HI1B 5IB1B 3SKUD 3UTTE 4OZ4B 3EJZC 2X4RB 1TPXC 3E8UH 3RDTC 4DKDC 3MRNA 5CSZB 1UB6B 4GRWE 1OTSC 2E7BA 3P0YL 2DQGL 4OLVL 1QUNA 4ONOA 2YR3A 3TH2T 3SDXA 1RK0B 1RULH 2VXUL 5FO8A 1VGEL 4ERSH 1HH9B 3NFSL 2Q7NA 3MRFB 3FQUA 5IROC 1F45A 2QLVB 4IMLA 1CE1L 1NFKA 1QTYT 2XFXB 1RFDL 2AI0H 4XP5H 4EUPH 3SJVE 3V0AC 4CW1A 4LCWB 4HWZB 4CN4A 1HINL 4PRPA 3BE1L 2EKJA 3MOAL 5D7LE 2ADIB 1J10A 4MHHG 1G7LA 3A0OA 3RGVC 1IAMA 5DUMH 1VKXB 1J8HD 1I3GH 3QEGL 1KCUH 2MHAB 1TZGL 3SGEI 4OB5H 1DQJB 3VXSE 5SX5K 1KCSH 3GSUA 3PWNB 3QDGD 1B2WH 3HE6C 4GQ9H 2ZSWA 4MD5A 4N0YL 3VXOB 1T7ZA 1SY6H 3QUZD 3BXNB 3FB6B 1D5MA 2OR7A 4XH2B 1IGIL 3D39A 3QNXA 5I1GL 2NMSA 4XPGL 4G9FD 5D1XA 4ZUWB 5GS1C 2UWEF 3FQRB 5ID1B 2FATH 1CYGA 2D0GA 4HMEA 5CEYB 1T4KA 1NC4D 5IFAL 4I9WD 4P5MA 4K8RL 3V8CA 2EDRA 3PWPB 3R8BB 2EYRA 5CSGA 4GW5B 3VI3F 3BN9C 3IDXH 3GMNB 4LHQB 5BOPA 1LE5A 2R9HC 2ZUQB 4YH6A 5C0CB 3WN5A 5IEHA 4WUUA 5BXFB 3HG1B 5C92A 1YMMB 4APQA 5J3HC 1YEDB 25C8L 2XRAL 1N26A 2GTWA 3QULA 4GKZB 5A1AA 3CSYB 3VH8A 5I9QC 5I73C 3ILQC 2IQAA 4HFWA 5ETUB 3S7GA 3V0VA 4G6JL 4B50A 1F8TH 1I8KA 1ZK9A 1JUFB 5FF6B 1QP1A 5I8OL 4O2FB 1EGJL 4UDTA 4RGOL 3WKML 2HRPH 1UJ3B 4NOBA 3W5NA 1F58H 2LVEA 4Y8AA 3NABL 4X5LA 4J4PC 4PG9A 1NMAH 5FOBB 4MA8H 2NY1D 5KN5A 5D71L 3BWUC 2EEAA 4P23C 3Q6FB 4A6YH 3ARFD 3F7RA 3LQAC 2CKBL 3LKQA 3QDAA 1CGXA 5FCUH 4JN2A 3DMMC 3KYNB 3MJ7A 2W9DH 1G7PA 1JGDB 4P2OD 1YEIL 4PJFA 5HHXL 2VRAA 1S7WB 3EFDL 5HI3D 4JY4B 4LQFH 4R26H 1HDMB 3MV9D 4PJGB 1AC0A 4K7FA 5HD8C 1J1XL 3U7YH 2X10A 1QZ1A 2BVQA 3SE8H 4F7EB 1NC2B 4JM2D 1NUFA 2DLGA 2EDEA 1QSEE 3DVIA 4XAWL 1Y18B 5FHBH 4Y2DA 2BSSA 2KDGA 2VIRA 1MI5A 3CFBA 1MHEB 3MXVL 4U0RB 3H7BA 4KJPD 2JJUA 3C60C 5TFSL 6FABL 3MRHA 4NNPH 2J6EL 1EAJA 4MMZC 4FQLH 1BMGA 1FPTL 2M26A 5FUZL 1WZKA 2IPUK 3BP6B 5ADPL 4F3FB 1RUQL 4QKXB 4L8SC 1LE9A 3D6GA 3HR5A 2FJHB 4YK4C 5T3ZL 1JJUA 3WKNA 1NGWB 1XGYL 2F15A 1KBGH 2FL5B 3W39A 4O9HH 3TVMC 2ZOKA 1XIWA 3UCRA 1JGUH 3WIFA 5DK2B 3H9ZA 4NQCE 3PWLA 3BJLA 4UAOB 3U46B 2EDLA 4MQ7A 3NCFB 1NJ9A 3BWAB 3FRPG 1H9VA 5GRUH 1I7UA 4BFIB 3Q6GH 4JHWL 1FNGB 2GK0A 3ARDA 3GSXA 4XPHH 1OAUL 2DQJH 5JOPD 4XP6H 4LCWD 1R5WB 1ETZB 5LQBL 1QR1A 2QKIA 1S7QA 3DXAB 3BD5A 5E8OB 2F53A 1TJGH 3WNLA 3MR9B 1UM6L 1DE4B 4OCWL 5EC1A 3S4SB 5IIEB 4E0RB 3JV6A 2Z4QA 5INCA 5CD3A 5E8EB 2VZOA 5CJQL 5AG8A 2AJ3A 1PG7W 4HXAH 1FZMA 4JREB 3V6FA 3U30B 1NUGA 2ZUWA 1S9WA 3V0WH 1IKNA 5DFWH 4F9PC 1AD0B 1S9XB 2PUQT 1OAYL 2UV3A 3FT3A 4LRIA 3WFZA 3N85H 2DTMH 4PRIE 3FFCB 4LLQA 4HWEH 4MVBD 3VFSA 1KCRH 2ICES 3P30H 1T21A 3W9EB 2NY3C 4NN7C 2D9CA 1JPSL 1OP5H 4ORGA 2H26B 4J8RB 3F7VA 1ZLSH 1RJLA 3GSNL 2F74A 5GRXG 1BZ7A 1ULVA 3PWPD 1N7MH 3DX8A 5JO5A 3KG5A 4JRXE 4KVNL 4QRUA 4W6YB 3UBXB 1R3JA 4L3CB 3UTSD 1N5YL 2YA0A 4LSSH 3RJQB 4K9EL 5CCKL 1QBBA 4JZOA 5C0CD 1G9MH 2DJSA 3MLRH 4MS8C 1BQLH 1UXSA 2X89D 5F1KC 4QHMB 2C3VA 3HG1D 4BKLB 1S5HA 1YMMD 1NGQH 2YUZA 4TTGA 5I71B 5HGHB 3BKYH 5JIHA 2H8PB 5GGVY 4QTHA 4H5SB 4PUBL 4FXLA 5DD5H 2WV3A 5C0NC 3DARA 4DVBA 2GCYB 4AM0B 3MLPA 3VXMA 3ZKSD 4YQXH 1CGTA 1UJTA 5DO2C 5EIQA 3S3JA 5DJDB 5F89B 1HYRC 4G8IA 1I1FA 3H8NA 4U1LA 4Y1AA 4WFFE 4ONHB 5LGJA 1G7JA 3WFEH 4UNTA 4CDGC 3RHWK 3G5YA 3VFUB 4I48A 4I3GA 2IBZY 2DWDA 3UPCA 5FOJA 4OUOA 4V2BA 3MACL 1AGFB 2X1OA 3C08H 2GYSA 5BV7B 4UQ2B 4Y5YA 5E94B 4NO5A 1S9VB 2DICA 4NC2B 1IC7H 3MZTA 2CD0A 5E6YA 1D5BA 4TULL 1KB5A 3HC0B 4PJIA 2FWOB 3QFJA 1ZLVH 5IHZB 2VXVL 1HOCB 4JO1L 3SEPA 4IRJB 3U2SB 1X5YA 4LFHD 2EEDA 5DJZB 1FL6B 1NC2D 1H5BC 1SY6L 5IMMB 5HDBF 3QXUA 4LNRA 3HFMH 2IADB 1Q9WB 4KXZI 4YHIB 3GKWH 4YDJB 1NAMB 2FBJH 2FATL 5E08L 1PKQE 2NXZB 2UZYB 3CVHA 1KN4L 3OAZH 4LCCA 4X6EA 3C87A 4NCC2 2IH3B 2WBJA 2C4XA 4IOFC 1UZ8B 3CZJA 4H20H 3K4DA 4X7CC 3KXFB 3U4BH 1AGCB 2K3TA 3FFDA 5GRWA 1JNNL