3MLUH

Crystal structure of anti-hiv-1 v3 fab 2557 in complex with a zam18 v3 peptide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
220
Chain Sequence
EVQLVESGGEVKQPGQSLKISCKSSGYNFLDSWIGWVRQIPGKGLEWIGIIYPDDSDAHYSPSFEGQVTMSVDKSISTAYLQWTTLQASDTGKYFCTRLYLFEGAQSSNAFDLWGQGTMILVSSGTTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 220
sequence length 226
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mluH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mluH01
1PGRB 1OSPH 1KBGL 3C8DA 4F7PA 1FFNA 1NEZA 3QIUD 4PJAB 2DQGL 1MCJA 2YXFA 1CBVH 4TSCL 1HQRA 3T2NL 3NCFB 3REVB 5IVOA 1RIVH 4OF6A 4O2EA 4F7EB 5D1QA 3F58L 1TVDA 5T1KA 3IDJB 4NYLA 2NW2A 5DD0H 4NN5B 5K59F 2OJEB 2NYYC 4NQXB 4BELD 1RUAL 4JFXA 5C07A 1EHLH 5C0RH 5J4MA 2G5BB 1MCLA 4KAQL 1KTLA 2VKXA 3RWJA 1JN6A 4FHBD 5E24E 4X5LA 4JQXA 2WV3A 5EOCH 4S1DD 5IB2B 2ICWB 5HDBE 3OG6B 1DQMH 1PSKL 4NKDB 2WWMC 1WFTA 5CMAA 4OIBA 1WF5A 3KPMB 2PO6D 1LP9A 4HUMB 4QOKB 4O58H 5BMFL 1DQDH 4YX2H 2FBJL 2EIZA 4XC3H 4LCWB 3WE6A 4FMFA 4PJBA 4JFFA 4GMSH 4WI6A 2I27N 5HYSA 4F3FA 3BQUD 3UJJL 3IAPA 4EXKA 5GPRA 3CK0H 1G1YA 1H3VA 4GH7B 3SGDI 3M07A 2A6JA 5JUEL 5H37H 1QBLH 2XXMB 5IIEB 3MV7E 4MA8L 1C12A 2F8VA 4GQ9L 5D5MB 3IJSB 2KBGA 4OFYA 4F8TA 3TO4C 2JCCE 2LFGA 3HZKA 1I1AD 3FT4A 3MLRH 2R1YA 4BQCA 1KBGH 1YJDH 3ZYOA 2DQGH 2Y1VA 2VLLB 1JGEB 4KPHL 4TSCH 2LTQB 1KIRB 3EYQC 1T5XA 4GRMB 2C3VA 1D6VH 4HKZA 3F58H 1IAII 2B2XL 2R29H 3IDYB 4N0YL 4KK9D 2YBRA 2EXYD 3RP1A 1RUAH 3ZHDA 2G9HA 2XN9A 3OJVC 4XPAL 5HDLA 1RUMH 4ZYKB 3BKJL 2WQ8A 3L5IA 3PGCA 3FB6B 3WHXA 2LU7A 1NFKA 2VQTA 5HVGB 5I17A 1PSKH 4L3CA 4E41D 4OCLC 3R06A 2JIXA 4TSAH 1G0YR 4NZTL 2JELH 3BP5B 3JV0A 5BMFH 4Z7UB 2HLAB 4P5TA 5GGVH 5J8OA 1KTKE 3AB0C 2Z4QA 3D18B 3D5OF 5HYQA 3O3AB 3T65B 2F54D 3BRGC 3SKMA 3Q5YA 1UB6A 3DX6A 4NC1E 3UJJH 3L5WB 4ZSOA 1TZGL 3RPIA 2CR6A 5JUEH 4LFHG 3MJ8B 4MA8H 4U1JA 4K94L 2C26A 1R3KB 1KTDB 4RAHA 1OW0A 1QO3B 5IVXE 1Q1JL 2UWEF 3F7YA 4MA3A 1KOAA 5DRXB 5I73C 5JDSB 1QFOA 4HHAA 5JXAL 3NN8A 4IRSD 4WNQB 2EDNA 3ZE2F 1TETL 4N8CH 3SDDD 5D7JD 3VRIA 4QXGL 2EC9T 2IEPA 3GFUA 4KPHH 2OJZL 2NNAA 3WUWA 4FQ1L 4RQQB 1A9BA 2QEJA 5IFAL 2IALA 1RK0B 1UJTA 3MJ9A 4XBGA 2B2XH 3LEXB 4QHMB 4ONFL 1WBZB 4N0YH 3V5HB 1I7ZA 1P4BH 3QWOB 4QT5B 1WWWX 1LILA 1MAJA 4TQEH 1NGQL 1A1NB 4MNQB 2EDOA 5HI4D 4I3RH 1TCMA 2WWKT 5I1AB 4BH7A 2X1XR 5C0JA 1ND0B 1KXVC 4YFDB 5CGYC 3CFIC 3UXFA 4KY1L 3SE3C 1S3KL 2O5YL 5HHNB 1KCSH 3LOWA 3NIFF 5IMMB 4QRRD 1A22B 5DTFA 5J12B 4X4XB 1BJMA 5IWLA 5IKCA 5AZ2L 3HI1B 1CXFA 4F33B 1TZGH 3QQ4A 1IT9L 4PJCF 2UZXB 4K94H 4ODTL 4Z0XB 5J6GB 3FAXA 3KPQA 5D6DC 4ZS6D 4X4YB 3EHBC 1GL4B 4YWGH 1D5MB 3D0LA 2BZDA 5B39G 2H6PB 5DQJA 3IDIA 4PJ5E 3FB8A 3I3DA 5JXAH 1TETH 2DLEA 1LO4L 4IEFB 4QXGH 3C8KB 2FX7L 5A2JH 1T4KB 5DMGD 3SJVB 3KJ4B 1WAAE 1HHKA 3QIWA 4FZEL 1GVIA 3VXMD 1S8DB 3VRJA 5IFAH 3IFPA 3TLRA 3EJJX 4ONFH 1CDCA 5IB1B 4GMTL 4R6UA 3RTQA 1FFPB 2VDNL 4NT6B 1PZ5B 4MD4A 1DANT 2AJUL 3AREC 4YDJA 4OZIA 5AYUL 2I9TA 1NGQH 2HJFA 4EZMA 3LQAH 2OTUB 1QP1A 1Z9MA 2VLRB 1UJ3C 4KHTL 5DFWH 4I9WD 4JB9L 3ZT7A 4LRIC 1EK3A 4DCQA 4BH8B 3UPCA 4KY1H 3L3JA 4UT7L 1S3KH 2E3VA 3RIFF 2O5YH 3I6KB 4E9LA 5EZJB 1Q9LA 2YD2A 5JNYB 3AS3A 4XNMB 3C60C 2GJ6A 2I60L 3W2DL 3DX8A 4PJGE 5IBUG 4Y4FA 5I75C 4GG6A 5AZ2H 3ULVD 3DSFH 2Z9TA 2JJTA 3DUUA 1K2DB 1IT9H 3RDTD 2BDNL 1FZOB 2BC4A 2E7CA 5GZOD 4ODTH 2M26A 1IM9D 5FO8A 2WBJD 1BVZA 3WDJA 3RA7L 3MMEB 3RU8L 1ORSA 4WWKD 3VMOA 5MI0B 1J05A 2A6DA 2J2ZA 5AWNL 2DMBA 4XPFL 4ZFZA 1AHWB 1U8JA 5JHDB 3PWJA 5CSGA 3BHBA 1DE4B 1D5ZA 1C8PA 1IFHL 3DVGA 5FGCB 4P2RA 2YD1A 3HAEA 3MV11 2FX7H 4NZJA 1NMBL 3TA3D 2ZG3A 1LNUA 5K9QG 3VFGL 1YMHB 4FZEH 4M1DL 5IVZA 1Z9SA 2AAVA 4RFEB 4CMMB 1BBJA 4M6MH 4O2CB 4GMTH 5GGRB 2VDNH 3QI9D 4XNZC 1QLFB 4NQEB 2AJUH 3V6OC 4XCFL 5C0ND 2A6IB 3GMOB 4LASL 4JY4B 4KHTH 3EO9L 3BT2L 4JB9H 4NN7C 1LEGB 1BP3B 1QPXA 5D93C 4IS6A 3GB7B 1A1OB 1NC4D 1I3RB 3TPUA 4KGJA 4MS8D 4HK3J 2I60H 1FVCA 3FAWA 4U1MA 2M2DA 3ZMRA 1F6LL 3GMPB 3MRDB 2FATL 4U1HA 5AYQA 1NC2D 2BDNH 3RA7H 3O6KL 3RU8H 1JUFA 5L0QC 3PHQA 5DJDA 5BW7A 2R9HD 5AWNH 5E1AA 4XPFH 1JGDB 4UILH 5EG6C 3RWGB 3TEUA 1NGZA 2CO7B 2UVEA 1IFHH 3O6FB 5F97E 3RHWK 1IGTA 1NMBH 5I8KL 5CILL 5D7IE 2VL4A 3MRPA 3GUTA 5GGQL 2D7PA 3VFGH 2BX5A 4M1DH 5AD0A 2DQCH 1QVOA 4H1LH 4DKFL 3O2WH 4YR6A 2XKSA 4ETQA 1YN7A 4CN1A 3SO5A 2DS4A 1ZT1A 3QEHA 3O4LA 1J0ZA 5EU6A 4D9QD 3FHQA 4LDOB 5J6HB 2DQIL 4HX1B 4XCFH 1X4YA 4WHDA 3U0PA 2X10A 4QRPE 2DD8L 4ZO7A 3BPOB 5MEOB 4LASH 4KMTL 3ZDZE 5FO7B 5B39B 1EEYB 3MGAA 3W0WA 3OJ2C 1ZLUK 1AGBA 3OGCA 1CWVA 1SBSH 4X99B 5FKPA 4Q2ZB 3RGVC 4LIQL 1QQDB 4HG4K 1KLUA 1RJLA 1D9KB 3LRSB 4G6KL 3V6FA 1M7DB 4OZFA 1Q38A 2R56L 2QQKL 4PB9L 3WN5C 3LKRA 1KLGB 4CL7A 5IEHA 4D0BA 2FATH 3VMNA 4X9HA 1CDIA 3MCKB 5IB5A 2PF6A 3MODL 1I8MB 3NCJH 4QRSA 4L4VA 3TIEB 4OGYH 2V5RA 4K3JL 3VGAB 2VQUA 1T21B 4P5KA 2EH8L 5D2LE 1RJZB 3FO2B 3ROOB 4DUXA 5FDYA 4UBDC 3GSQA 3O9WA 1A21A 4FQIL 4JZNA 3HPLB 3KPPB 3PV7A 1N5YL 3HR5B 1J1PL 4DGVH 3DURA 1FLRL 5I8KH 4YAQB 5CILH 4JDTL 4HCRL 3NZ8A 5GGQH 5LJYH 2ZOKB 3U6RB 1WZMA 5IBUB 4DKFH 4X8JA 4NZUH 1JVKA 1IAKA 5IG7B 4CVWA 4Z77A 3OB8A 4QOKD 2OTPA 4APQB 2VMFA 4O51B 3VXQA 2Q87A 2DQIH 4RMQA 2DLGA 3UZVB 5D7LE 3RX5A 4OB5L 1Q72H 3MBEB 3OKKB 5TDPB 2DD8H 1BVKB 2V17L 4HK0B 3MTRA 1UH4A 5EFIA 4XNQA 1BFOA 1I8LC 2AJ3A 5I6XC 4MNGB 1LDSA 5C86A 5CEZE 1XF2A 4LIQH 1W72A 1P6FA 4I3SL 1QLEL 4G6KH 4G8FA 4UT6L 1MVFA 1CGTA 2BP3A 2HT2D 2PTUA 4KI5D 1A4JB 2Q8BL 2QQKH 3I6LE 4PB9H 4CAGA 4M8VA 1SQ2N 4P0DA 4AEFA 1F8TH 5TDOB 4IIQB 2CIIA 3SO3B 1KNOB 3BZEA 1HYSD 3JVGC 1VACB 4MYWB 3MODH 4GO6B 1GC1L 1UKTA 1GGTA 2BVEA 3S9DB 4PTUA 4QO1A 3PNWB 4K3JH 2WP3O 3OX8A 5IW1A 5EO1B 4K3HA 5DK2A 1VFUA 2EH8H 4U33A 3U2SA 4U6VH 5C09E 4ZFOB 3QB7C 4OF5A 3QUZC 3DI3B 1RZJL 2I5YL 4Q58C 4FQIH 4NNPL 1F5WA 3ROLA 1J1PH 3SKUD 3CJJA 3HZMB 1CFNB 4HCRH 2FO4A 3AY4A 1FAIH 4N9GB 2P8LB 2VDQL 4NCC1 4LSVL 1AIFA 4BSVA 3EOAB 1KB5L 1CD1A 4MXVE 2DJ4A 3X13A 3DTXB 3H9HA 1HSBB 1ZVYA 5GS3A 1FNGB 1VCAA 3ARUA 3D25B 3CVHA 4H26B 3VFUA 4XWGH 3QNZB 1AGFA 4OB5H 4BYHA 3ZE0E 3BRDA 1GZQB 2V17H 4QRQA 2GYSA 4NGHL 2PYEE 4OKDA 2I26N 2PYEA 1ZHNB 3B9KA 1JK8A 3B9EA 5CJ8A 4LLYA 1MCDA 1IVLA 4I0KA 4ZTPL 3I9GL 3KLDA 4XP4H 4OFVA 3BEVA 3MA9L 5BQ7A 3TH4T 4I3SH 3FRUB 3HE6C 4UT6H 4GS7B 3KYOB 1I9EA 2BJML 4UI2A 3HB3D 1W2KT 4MDJB 3O6ML 2J6EA 1MHCB 3K8KA 1KB5B 4BFIA 4NHCH 3BIBX 3MNZB 4GSDL 2HJLB 2BVOB 2XY2A 4DW2L 3DPBA 4YIQB 1MFEL 3MYJA 5F7DA 4MWFA 1DN2A 4PJ8B 5CSZB 1EAPB 4KROB 2D0GA 4WI8A 5E6YA 1P4IL 4P46C 3WFHA 5E08L 3TO2A 4XI5C 2I5YH 2VAAB 1LE9A 4GW5B 2CQVA 4NNPH 1KACB 5KOMC 4MNQD 5JTWA 2DQFB 5D9SB 4WUUE 3EDJA 3MJGX 2EDWA 5FXCH 4NQTA 2VLJD 2VOTA 4NHUB 2VDQH 3CD4A 4LSVH 4XGZB 5IHLB 1O5DT 1T0MA 3KXFA 1KB5H 1ACZA 1C16B 5I71C 5I2IB 3B6SB 3D85D 3OJDB 2OTWB 4EDWL 1A6WL 2P5EA 4P57A 3U1SH 4G9FA 4GXUN 4NGHH 2OL3A 2ZNXA 2YD6A 4JKLA 4HUUB 3L1OL 2HP4A 2V2WA 2EDKA 3BPCB 4AY0A 5JQ6L 1RFDL 1MF2L 5F89B 4ZTPH 3I9GH 5DURB 5EBMB 2J8UA 5L8LB 3C09C 3T4YB 1KSRA 2HLFC 1U8PA 2AEIT 2BJMH 5C0EB 5DK0A 1AXIB 5T3ZE 4MMZC 3SPVA 5ENWA 4IRJC 3T0WA 3O6MH 1S7QA 5DJXA 3MRKB 1I1FA 4BM7A 2AW2A 1J87A 1O0VA 4GKZA 4UQ2A 4DW2H 4HS3A 1MFEH 2PCPA 5FK9A 1G6VK 4HUNB 1OAKL 4Y2DB 4Y4KB 5IHBA 3TBWB 5LG1A 5E08H 2A77H 3VH8A 4DUWA 5J56B 4HUWB 4HUVA 1CXIA 4AIZA 1H3TA 5KSAA 2MHAB 4FQXB 1LD9A 4U1LB 1RZ7H 1X6LA 5IMKB 4FXKB 4PR5B 2VLRD 5IBTL 3HE7B 2W0FB 5IK3B 3LAFA 2FBOJ 3FQUA 3MLWL 4XPHH 3MUY1 4UDTB 1XGYL 1KB9J 2N1KA 3S36X 2BNRB 1TQCB 1AI1L 3WIHL 2P5WA 2VYRE 1R3IL 3KGRA 4Q6YA 3O3EA 4EDWH 1KJ2B 1A6WH 1EO7A 5E2VL 1OTUC 4AK1A 2R0LL 2CKNA 3HKFA 3LRGA 1WFUA 1X5HA 3G5YB 1NCBH 5KSVA 2UWEA 3SE4C 2CLZB 3LEYL 1NCWH 2F74B 3L1OH 2LTQC 1RFDH 3BAEL 3PWPB 1MF2H 4K7PY 4IMLA 4OAWA 3FB5A 3CUPA 5DVLA 3DUHA 3GSXA 4AIXA 1M4KA 4JCMA 1DVFA 3VXOB 3MRFB 2E7MA 3MRJA 1N7ML 2W91A 5FGSA 1XR8A 2EZ0D 3CLFL 5JHDD 3QDGE 2AQ2A 3W82A 1CI5A 4BQ8A 1WVZA 1T2XA 2FLBT 1KJ2H 2BMKB 4FQHA 1NUDA 5DRNB 1RZGA 5ACLA 1OAKH 2PTVA 1G7HA 1XGQA 1NANI 3TT1L 4U1GB 5EPMA 2UY7A 4J4PD 1ZAGA 4Q6IA 4LPVA 3VFNA 3MV7B 2YPLE 1WTLA 3L95A 2YPLA 5IBTH 3L5XL 1XT5A 2JB6A 5HHPA 1EFXD 1IGYA 2R1XA 3BP7B 1XGYH 1CL7L 3LY6A 3HMWL 3WIHH 4HIEA 1R3IH 2WMPA 4NUGL 2O93L 1QFPA 4WHCA 5HVFB 3G6JF 4WO4D 5E2VH 4X6EA 1MFBL 4HWZA 1AC6A 1H15A 1HWGB 1PVHA 3AU1B 1PEZA 4NQCA 3RNQA 3SDAB 3WHE0 1FL6B 2H2SD 5EU5B 1F58L 1OGTB 2X4UB 4BZYA 3JXAA 2PXYD 3GGWB 3G9VA 4TRPL 4X7CC 1NEUA 3BVNB 3F6LA 1FIEA 2HVJB 4LLMA 1BVLA 4WHTB 3EFDL 1N7MH 5GRXG 1P84K 2BOCB 2V2TB 3CLFH 3FRPG 3HRPA 3DXAA 5TH2A 4POYA 1PLGH 1UKQA 2YKLH 1DCLA 1JTOA 4GAYB 4LLQB 2GT9A 4LCYA 4C55A 2LAAA 2AP2A 2PW2B 1BIIA 2GCYB 4ZXBB 5JPMA 1S9YA 4PJXF 5HJ3A 3TT1H 2HTKC 3QH3B 4Z7WE 2F15A 3G08A 4Z7WA 3PP4L 4U6YA 1UACL 1SHMA 5F7MC 4HWEH 1UXSB 4YXHL 1JV5B 2R4RL 2FRGP 1KIPB 5J12C 5DQDL 5IB3A 3DYMA 1N2RB 1H3PL 4C56B 4CU7A 1NMCC 3CAFA 2RAMA 1PQZB 2IH1A 3CIQA 5MEPB 3L5XH 3UTQB 3GBML 3TESA 1CL7H 1KPUB 5EB9A 1JRHH 3HMWH 1FJ1A 3VD4A 1QA9B 7CGTA 3UBXI 1N6VA 2EYRA 1FGVL 4F80A 3A67L 5B22A 1D9KD 1M05A 4HMCA 1MFBH 1ADQL 4NKMA 5TE4L 4Y5XA 1MH5A 4M8QA 4AG4L 5DO2D 5ID0A 1KCRL 4NPYB 2PYFA 4RCAA 5I76B 5BZWA 1F58H 3K81A 5DMJB 5GRWA 3W9EB 2QHRL 4G9DA 4W4OC 5CBEA 2NY1C 2AXFA 1LHZA 3IS0X 5FYLE 1KCVL 5EUOF 5EWIL 4NKQB 4I5BB 2Y7QB 3O3UN 2C4XA 3EFDH 1N6UA 3OKDB 4HH9A 4OV6F 4Q9QH 1T5WB 4FQPA 3SGJC 4LMQE 1H5BA 5GSRB 4F7CB 1TZHB 2OCFD 4OD2B 1VADB 3P0YL 3ALPA 4WFHD 1G0XA 1OAQH 3RI5F 4Y4HC 5BOPA 4NQDA 4NM4H 3TNMB 3P77A 1BD2E 4G8EA 4LKXB 1X5LA 4FG6D 3WFCH 2N56A 4MJ4A 3VXRB 1QR1A 4XVTL 4APQD 4R4FL 3U79A 2E7BA 2F5AL 4YXHH 2R4RH 4D0DB 1NAML 5DQDH 3MBED 1H3PH 3SCMD 2IG2L 1QKZL 5GSVA 4LOUC 5AG9A 3TZVB 2XTJC 3V79C 3GBMH 5EIIA 3B5GA 3VCLA 3MBXH 5F7UA 2FWOB 4PLNC 5ALBL 4PJ5B 5J11B 3CFJB 1FGVH 1JTPA 1U3HC 3A67H 2AJVL 3GSWB 4G6MH 3T77B 1EEZB 1WTGT 1UH2A 1FYHB 4OCYL 1ADQH 4JRYE 4LVHB 5TE4H 4QXUL 5EZLB 4F9PA 1UWXH 5J9PB 1KCRH 1U8HB 2MKLC 2WIMA 3LQZB 3NIDF 2ICCA 2A83A 5D7KE 1QSEE 3IF1A 5F96L 1BLNA 1G9MH 5CIPB 1YN6A 3ARDC 3SKNA 2QHRH 4LKCB 7FABL 3ARTA 4P2QE 5HGGS 1NAMB 1TTUA 1SJVA 1KCVH 2DQUL 5EWIH 2VSDA 3QDMB 3STLA 4MCYA 5ITFB 4YHKH 4BSWB 1NDMB 5ESVA 5E9DD 1IL1A 5CEXB 3F62A 3KYAA 3MRQA 3BH9A 4CN6A 2DAVA 3GJFK 2QR0B 3NCMA 3P0YH 4WJ5B 2GW5A 4Z78B 5F1KC 1NJ9B 4PRNA 1XGRA 3K74B 1I7TB 1S78C 3K0WA 3QXDA 4UNTA 4X6DF 5T1DH 3BH8A 4FXGA 2R2HA 1T66D 4FFVD 5DUPL 4K07A 4PJGB 3ULUH 4XVTH 2DI7A 5CIPH 1H3UA 3VD7A 2F5AH 3OXSB 4LHUA 4DN3L 1NAMH 1OT1A 1U58A 4H5SA 4NZDA 1IAOA 3WDIA 2IG2H 3GSOB 4PTTA 3PWLB 5ID1B 1C1EL 3VFOB 1U8KA 4KTDL 2WQRA 1WWCA 3LN4A 1BMGA 4XAWL 5ALBH 3RUGB 3DUSB 4JE4B 5DD3L 5SWZA 1WITA 2AJVH 1VFBA 1MCOL 1B4RA 3SDCC 4IDLA 4PJIB 1HZHL 1I85A 4KHXL 3SOBL 1R24A 4Y5VA 2E7LC 5HHMD 4YEFA 3PIQA 1ZVSA 2ZCKH 5HPMB 3QXAA 1JWMA 2IH3B 3P4OA 3U4EB 1IC4L 1JPGB 3O6FC 5F96H 4EN3C 4S0TD 5T1MA 3Q6FB 3TBSB 3OF6D 4KVNH 4UOW0 4R4BA 3IETB 1FL3B 5EOTB 2DQUH 4PJ8D 4XWOC 3SGDH 3GK8L 1A9EB 1NFDE 1A6VL 3PQYA 5DJ6A 4I77L 1NFDA 4HS8L 4M48H 4ZAKB 4U3HA 3D39E 3BPLC 3LCYA 5BS0D 4NNYA 3RZCC 1HINH 5GXBB 5A40E 1D3CA 3I6GA 4NO2B 3QP3A 5DUBA 3EOTL 5F1NB 1CLYL 5HGBB 2VZ1A 5DUPH 5IQ7L 3P0GB 5JDJA 2GUOA 4OF7A 3ULVF 4R4ND 4DN3H 5CEYB 1J0JA 5HDOA 2XA3A 1L7IL 5ILTL 1JPTL 1IAIH 1NGXA 3SBWC 4DFHA 3MOBL 3MV8E 4UINL 3PG2A 5HVWA 5EO9A 3CU1A 2H1PL 1C1EH 3BN9C 3BISA 3SY0B 4KTDH 5FHBL 1ZOXA 1GOHA 1VERA 4JM2A 1INDL 4XAWH 2ERJC 4L8BB 1CR9L 1G7LB 3QEQD 3ZYIA 4MX7A 5DD3H 4Z76A 1M7IA 1U8NA 1FZMB 4PJFF 1MCOH 3K80A 2YK1L 3LVEA 5F1IB 2OBGA 3B2VH 4X83A 4KHXH 3SOBH 5D7IB 5I8CB 1MEXL 4J1UB 3G5VB 4G5ZL 1IC4H 5C8JA 3UAJD 3IVKA 1BQUA 1XAUA 1IKNC 1ZLSL 4LL9A 1B0WA 3MV9E 4JHWL 5KG9A 5IJKC 1WJ3A 1YEGL 1RI8A 4Y2DD 4P3DB 1G7QA 3GK8H 4NIKB 3S4SA 3M17B 1A6VH 4I77H 1U8LB 1WFOA 2WK2A 2CUHA 2NY6D 4JZJB 4QF1A 1XCQA 3V5KB 1I9RL 4RISH 4EKXA 4KFZC 1DBBL 4FQXD 5CJQH 1XIWC 4O4YL 5IMLA 1AGEB 1E4XI 3C5ZA 2V7NB 3HE7D 1W0VA 2R1WA 5JR1L 3HUJA 2CXGA 4O00A 2BNRD 4EVNB 3RY6C 3WS6C 5IQ7H 3ARBA 2HN7A 1TCRB 4DEPC 3FO1B 1EO8H 1ZT4B 4YDVB 3FL7A 5J89A 1L7IH 5J13B 5ILTH 1JPTH 1FN4B 3ARFB 4NSKA 3TN0B 3IDGB 4LSDA 3MGOB 4Y88A 2LVEA 5D1QD 2H1PH 3W11C 3MO1A 4XP1L 5FHBH 2ZUQC 1YMME 4LK4A 5D1XA 5JLZA 1INDH 1E4WL 2CXKA 5D2LB 1KCKA 4MCZB 3UYOD 5CEZL 4M3KB 1OAYL 3F12A 1U2CA 2YK1H 5EC2B 2DN7A 1EEQA 1MEXH 3HI5L 2EE3A 4N0FA 3DX7A 3PABB 3FQWB 4G5ZH 1AO7B 1N0XL 4WU5A 3V7AG 1JNHB 5I66A 2YD5A 4MXQC 2W9LA 3ILQD 1ZLSH 2AEWA 5T1LB 3GMQA 1EVTC 1JMXA 4NOFA 4AQOA 1KJMB 3STZA 2UV3A 3ZKMD 3O2DA 4MQXC 5DHYB 5D7LB 5A2FA 3QIUC 3ISWA 3QAZB 1JPSH 4HFUL 3P2TA 4J12A 4Y16B 2EE6A 3RWIA 3QG7L 5I1LA 1YEIH 4Z7VE 2VLKA 1YUHA 4PRIE 4K7PL 4XXDB 1KV3A 5DJAA 4PBVC 5FB8B 4L9LB 3RWFB 1DBBH 5E8NA 4J6RL 4KRNA 2O61A 4YDIL 2EDDA 3MV7D 3IAQA 4NKOA 3UTPE 2OQJA 4OFYD 3FKUS 3KDMB 1CFBA 3KPOA 5DJ0B 5EO0B 3QIBA 5JORB 5JR1H 4FQJH 5DD5L 1NLDL 5JMRA 4NBXB 3NTCH 1TJIL 3DROA 4RAUA 4I0CC 4UNVA 5BJTA 3RAJH 3T2PA 4QXTB 3MNVB 2YA1A 1H3GA 5C3LD 3ARVA 3W5MA 4PRPB 2JJUA 3SDAD 2WAHA 1D7FA 3O8XC 3BIAX 4ZPVA 4P23B 1V7NL 5DHXB 1XFPA 2H26B 3GNML 3JWOL 4K3GA 1JBJA 2VDOL 1GGCL 4NC2B 1XZ0B 3VFMA 5CEZH 1OAYH 1T22B 4KROC 4WW2A 2CGRH 1KJVB 2A38A 4NNXA 3T0EB 1FFOB 3HI5H 3RQ3A 1N0XH 2J6EL 3IJYA 1FZJA 3BDXA 3CXDL 4NDMB 1YEDA 2GSIB 1P7QA 5ESAB 1YNTA 3X11B 1VESA 2Y72A 1AXTL 1HHGA 1S9WA 3HMXL 4PJ7F 2J1KA 4NRXA 4HFUH 4ODXA 2YPKB 3GIVA 2A0LC 3QG7H 4M9OA 4TNVF 2BSTB 3AROA 4IJ3B 1J0YA 3LN9A 2C1OB 4K7PH 4GKOA 5F3BB 4KUCD 4RMTA 4KQ3H 5DD6A 2XKNB 4LPYA 4UAOB 2E8ZA 4J6RH 4X0KA 4YDIH 5FYJE 5CD3B 1JHTB 5IP4A 4BKLA 2E27L 3HC0B 5D5MF 3RVXD 3RKDD 3VW3H 5CP7A 5C0BE 4NCDA 5DD5H 1ZHKA 1T04A 4W70A 5DS8A 4OGXL 1TJIH 3I2CL 5E8EA 3QG6B 4LGPB 4DZ8B 3VXSA 2J7LA 3VWKA 4GKSB 4TULL 5GZND 1QNZL 4HFWA 4PY7B 5SWSE 2MQ3A 2V2XA 4KV5E 1J8HE 2CK0H 5I8EA 5IMOA 5C08E 3DV6B 4N1HB 1QBBA 1DBML 3HC3L 4FFYH 4TUOB 1OF2A 4CN4A 1K4DB 1WZ1L 2VH5L 2X9XA 3V0AC 2IANA 2YD8A 2OXHA 2IPTL 3UYPA 1LK2A 3GNMH 3JWOH 4R9HA 2A6KB 3CFKA 2YSSA 1GGCH 1JWUB 4HH8A 5FA4A 1ZGLP 2EIEA 4HIHA 1QLRA 4C54A 3GJFB 4WUUB 2IPUG 4FTVA 3QISA 2AV1A 1WBXA 3UDWC 4PJEE 3UEZA 5T3ZL 4LP5A 4P2OA 3U0TA 4OZGF 1FNAA 1S7WB 1MFDL 2Y25A 3TNNB 4JFEE 1IARB 3DBXA 5FOJA 3BJLA 3REWA 3RIAF 1AXTH 3HMXH 1N3NA 2SEBA 1AXSB 3KWWA 1TQCC 2IFFL 4W6WB 1OWWA 3QJFA 3WBDA 3ZT6A 4ODHL 4Z7OF 5JQHC 3ARGA 1Y6KR 2Y6SC 1IAIM 5JIHA 4YZFE 5C9JA 4X6CF 1VFAB 1Z0NA 1C7TA 1CXHA 2IMMA 2E27H 5ICXB 3KPSB 2DQDH 4MDIA 1DEEA 4R7DB 3QUMB 1IEAB 3GJFH 2FH6A 2R39A 1II4E 2ZOLB 4D9LH 3Q3GA 1X5JA 4JLRB 1B0RA 1MWAA 2ARWA 4MB3A 4JREB 1NGPL 1CICC 4G6AD 4PJ5D 1KELL 4P3WA 3I2CH 3RL2B 1H3WM 2UYLB 1UH3A 5CZXC 4PJHF 5EOQL 4KKBC 1FYTB 2Z31C 1QNZH 4I4WA 4ZUWB 4PLOB 1CTOA 5ACZB 5A3ID 1CG9A 3PF2A 2IAMB 1DBMH 5SWQB 1V3LA 1CE6B 1WZ1H 2VH5H 3W39A 2P8PA 4EI5B 5L8KB 2IPTH 1BQHG 3RTQD 3VJ6B 5D6CA 2EDBA 2NZ9D 1MIMH 2PO6A 5HPOA 3TYGL 1FO0L 3QUMH 2E9WA 4NFBA 3UO1L 3WXVH 5DSCB 4YBHA 4I0PB 4PJ9B 4U1GC 5IV2B 5T3ZH 3BQUA 1UXWB 1MFDH 2HH0H 4F58L 3AXLA 2F8OA 2JTDA 4PGBA 3S3JA 3V0VA 3QQ9C 4JRWA 5KAQG 1ES0B 1K8IB 5D8JL 4BZ1L 1JHLH 1MAKA 4LRIA 3EYOA 2IFFH 3B4NA 4Y4FD 4M6AA 1F6FB 4TN9A 5B8CA 5DMGC 4ODHH 4ETYA 5F7FA 2GI7A 4Y5YA 1I1AA 4OLWH 1EGJL 1U8OA 1EBAA 5JW4R 1T1WA 1V05A 1J88A 1DQJB 2EE9A 1PDKA 4ODWB 2HMID 1FO0B 1NGYB 1OSZB 3V5DA 2AI0L 3S96A 1NGPH 3QUKB 1KELH 2HT4D 4KXZH 3SGKA 3ZSSA 3QDGB 4LEXL 4NRYB 4LCCA 4NJ9L 2ATPA 1A6AA 1FG2A 5EOQH 5IW6B 1ZWIA 2OI9B 3VFTB 1T83C 2ZSVB 4I18B 1G7PA 5C0GA 3GDBA 3QZWG 1T1ZA 4G8IA 4K9EL 1HEZB 2RFXA 4QRTA 4MZ3A 2EYSA 5F70A 1ACYL 2P24B 3RVUC 4E41A 3L7FA 1PZUB 3S6CA 1G9NH 1S9XA 4ZXBC 3TYGH 3RY5A 5I74C 1FO0H 5C7XH 4L3AA 3UO1H 1BEYL 3LKSA 2DQHL 3V6OE 3QEGL 4TSBL 1DN0B 1H0DA 5GIRA 1B9ZA 3P9LA 2Q7YA 3VFPB 4P99A 4MD5A 1T7WA 2I25N 3T8XB 4C83A 2GJZB 4QHUA 4UV7H 1HNFA 3TWCL 3K4ZA 4JVPA 4X6BA 5D8JH 3QYCA 4BZ1H 1A6ZB 3EO0B 4CBPA 3E0GA 2Q6WA 1PG7W 4DVBA 2FYYA 5CS7A 4DGYL 4S1QL 2I07A 5D7SL 3MNWA 2HT3D 2NY4B 1EGJH 5DC4B 1J0IA 3KNBA 3O4OC 1GOFA 3W9DA 3PHOA 1BF8A 2Y9RT 3FZUC 5D7JA 2FB4L 3L3OA 3IAGC 3OMZA 3L3HA 5B38A 2YN3A 3UTZA 3WLWC 2AI0H 3BYYA 4JRXE 4JRXA 3UZQA 2EEAA 4PIRF 3MRHB 2UUDK 1IGML 1QHPA 1XEDA 4LEXH 4NJ9H 3VFSA 5HD8C 4RIRB 2HG5A 2W92A 3WIIH 1RIHL 2XA8L 4JO1L 3IFNL 1MQ8A 2R4SL 5D2NE 5IJVB 4YHPA 5D2NA 4W68A 4CVZB 4K9EH 5B4MC 4CRPA 2X9YA 3FHAA 4F7MB 3V7MA 1A2YB 4OD3L 1JCKA 2X7LB 1ACYH 4C4KT 1BWMA 3MLTA 3WIFB 4LHQB 5HYSG 2FZ3A 2ZUWA 4YPGA 5FYLL 3OV6A 4QRPD 3FMGL 1BEYH 3CU7A 1V3KA 1WT5A 4QRRA 2MPAL 3X12B 3I84A 3I3BA 4G80B 4X6DA 2B39A 3OR7B 1IGJA 1J18A 2I9LA 3O41A 3TJHD 3EFFA 3QNXA 3STBA 4PG2A 1CXEA 8FABB 5J1AB 4KK5D 1S7UB 2BNUB 4QTHA 3TZVC 3TWCH 2OXGA 3LKPA 4Y1AB 5DFTA 1BZQK 4TOYL 2P42B 3HLAB 2G75B 4MQ7A 5AUMA 5J11C 4DGYH 2FR4A 4S1QH 4XCYB 3MFFA 2ARJA 3UTTE 1MUJB 3M45A 1BQHB 5FIEA 5LGJB 2JK5B 1AY1L 1L9NA 1MHEA 3MRNB 2WINB 3Q5OA 3AFLA 3QDAA 1WIUA 2FB4H 4Y89A 5I15L 3ULUC 1UB5A 5L2JA 3WNPA 2DJUA 3VXMA 1K6QL 1IGMH 3O9WD 4J2XA 1JPFB 4R90L 1NCNA 5MP6H 1AFVL 4JO1H 3CH1B 3IFNH 4WY7L 1X5AA 2R4SH 2ZCHL 5MENB 3QPQD 2KDGA 3L3IA 4DKAA 5DMYA 1BD2B 1PBYA 1URLA 1F02I 4XPBH 1PYWB 3PXHA 2CDFA 3UBXG 3K7UA 1G84A 2YUZA 3BKML 3EOYG 1RZFL 1FDLL 1GSMA 4ERSH 5T1LD 1DUYA 3ALXA 4AIOA 1T1YA 3FQNA 4K23L 5FM4A 4P4KC 5FYLH 5D7LD 2HVKB 2IQAB 1WC7A 3HCVA 3OR6B 4Y16D 3LDBB 3FMGH 3BSZL 2PTTA 1A7BA 3BPNB 3E1F1 1I8IA 1UCTA 5E8OB 2X4NB 4UUJA 1ZA3A 5DWUL 4P2YA 2BOBA 3TBVB 1CS6A 5CEZD 4F2MB 2AEQL 1FV1A 4J3OC 1OWRM 4KRPD 1OB1A 3RDTA 3LKOA 3TVMB 1T7XA 4K7FB 4JRYB 2D31B 4DQOH 4TOYH 4MSWA 2N7BA 2Y07L 2VISA 1IM9A 3QZWB 1D5BB 2B5IB 2WBJA 5H94B 2Q76A 3I6LD 4GRLC 5CD5D 3ZKXB 1NBZB 4WWKA 4JY5L 2VXSL 5GGUB 2NY0D 1MLCB 3WUWG 2DWDA 1AY1H 5EBGA 3KPRB 4P2QB 3DIFB 1R5IA 4F9LC 4M61B 5CZVL 5I15H 4Z5RB 1HOCA 4HC1H 3TA3A 3D0VB 3N9GH 4P23D 1S9VA 5C09D 3B9VA 1K6QH 1Z0MA 3HG1E 4OZHE 5TDNB 4HJGB 3HNTH 2VITB 4OZHA 2DM4A 4R90H 4EJ1C 2BERA 3CSYA 1AFVH 1AP2B 1KIQA 1W0YT 1HH6B 2ZCHH 3JV6B 4D8PA 3QI9A 4ZUVA 4CVXA 3CC5A 4LDLB 5FECB 5EORL 4JHAH 2OX5A 3BKMH 2EDHA 4KKAD 5C0CE 5DK3A 4HKBA 4LARL 1S7VB 1FDLH 5C0CA 2HFFA 2NXZB 5IOPB 4DUVA 3GHBL 3X14B 1HWHB 5DI8A 3GSUA 3H9SB 3RWDA 5IEKB 1YECL 4K23H 2WWKO 1KN4L 2XFXA 1KEGL 3E3QC 1TFHA 3D3VB 1NC4A 2G60L 3BSZH 2GQHA 1QEWA 1FNEB 2DQTL 4JPIA 1AD0B 3KPTA 2PYED 5C0FA 3GMLA 5HXMA 2X70B 2VWEC 1X5KA 1ZK9A 5DWUH 3L3GB 4JZOA 1R3HA 3LSOB 4PP2A 1HI6B 2CLRB 4OV5A 2AEQH 4N8VA 2EDJA 2QADC 4L4TE 1RUQL 4S2SA 1NFIA 4L4TA 1P1ZA 1J0KA 2P8MB 2Y07H 2DM7A 3HE6A 2D7NA 4HS6B 2RIKA 4GBXD 4JFDE 1U9KA 1K4CB 2X40A 4FNLL 4M02A 4X4MA 1WWBX 4KU1A 4R7NB 4BFGA 3QCTL 1EJOL 5CP3A 5CZVH 3MRCA 4P9ML 5E1HB 4OM1L 1I7RA 1HHJB 4LF3B 1OQXA 3NIFE 4WTXA 4JR9H 1CQKA 3L7EA 3O3BB 3OKLA 4JPVL 2WNGA 1U42A 1IGIL 2B0SH 1HXMA 3MLXL 4BK5A 3D39B 4M6OL 2FDBP 1T20A 4WUUD 4OLYL 4M6NL 3U30B 5EORH 4GKNB 3VWJB 3U7WL 5FA3B 1CE1L 2X4OA 1JNLL 4LARH 2XYCA 1I7UA 3GHBH 5DJ8A 1XF5B 1N0LA 1S7TA 2HFGL 4ZOCA 2DF3A 1YECH 5F7NC 1KN4H 1X5XA 4XVJL 2VL5A 1KEGH 2AK1L 3GMMB 5DMKA 1FNSH 2G60H 2R2EA 4PRDB 4HJJL 4WV1A 2DQTH 3MV8B 4YQXL 3GSRA 4R2GB 5INCB 1T1XA 4YDLB 1Z5LA 1CD9B 5MEQB 3F7QA 1FC1A 1I3UA 5J13C 3F6IA 3TN0C 4JDVB 5LBSH 3WHXB 3CX2A 2ENYA 3B2UD 2GJJA 4PJAA 4H25A 1RUQH 3RFZC 4RRPG 1WV7T 5BV7L 3GM8A 5BRZE 3KLHD 4TUJB 1JP5A 3K8LA 3CGTA 1CVRA 5T3ZD 3REVA 3UBXB 4F7EA 3IDJA 3LHPL 2OJEA 4NQXA 1LEIA 4FNLH 4PREB 3GMNB 2IQ9L 1EJOH 1IQDB 3DX6B 1CLOH 3MOAL 3MV9B 2IAMD 2G5BA 2YD4A 4P9MH 4X80L 4EQ2A 4OM1H 1RV6X 3IS1X 5IB2A 5CKGA 4WI9A 4NKDA 5GGTL 4KK8D 2VB5A 1AH1A 1IGIH 1RVFL 5E94B 3UROR 3MLXH 4J3UA 4YC2C 4QOKA 5F3HB 4LCWE 4OLYH 4M6NH 4I0PD 4LCWA 5BV7B 4HHAB 3NN8B 4L9LC 1FZKB 3WFEL 3U7WH 3QO0B 1AD9B 1CE1H 1JNLH 3VRIB 4Q97A 2A9MH 4WI5A 5IROC 4I1NB 1IILE 2NY5C 2XKUA 2AK4B 2AK1H 1RMFL 5D5MA 2DKMA 4HJJH 1EMTL 4YQXH 4QY8A 3OGOE 2VC2L 1YMMB 3VI3E 2J5LC 4KJQD 1W0WA 2JKXA 2R2CA 2YZ8A 1YPZF 4UQ3B 1DVFD 1JI2A 1WQVT 3G6AB 1JGEA 2DJSA 5BV7H 1KIRA 1N64H 4OLUL 5J3HD 3BP4B 4GRMA 4BH7B 1NDGB 3L3DB 3QDGD 3LHPH 2CMRH 3PV6B 2L4OA 4U1NB 3T0EC 1S5HB 1VSCA 2IQ9H 4TTDD 3DO7B 4GAFB 4ZYKA 4HGMA 2X2YA 3EDDA 4NO5B 5E5UB 1T3FB 3MOAH 5BVPL 5L7XL 3FB6A 4R8WL 4U0RC 1MCKA 4G6FB 4Z7VB 4RMWA 3MJ6A 4KJYB 1BJ8A 2G2RA 2ED9A 4HXBL 3WEXA 4PRIB 4XHQA 5GGTH 3NFNB 5GQBA 4LGSB 4XXCA 3BP5A 4Z7UE 2UUDH 2HLAA 1CQYA 3ZTJH 2YPLD 4M62L 3FB8B 3D18A 3O3AA 3T65A 3H42L 4UAOC 5CWSA 3WFEH 2FX9L 1KENH 3RWEB 4MVBC 3L5WA 3JWNC 4K3DL 1YEJH 4HULB 3R1GL 4G7VH 2VQ1B 4DZBB 4YHZL 5EA0L 3MJ8A 1RMFH 4PUBL 1R3KA 1KTDA 1QO3A 4MHHI 2FEDC 5C6TH 5DRXA 2NY4D 1OT2A 1E6JL 2ID5A 4JKWA 1XCTB 2BNQE 5JDSA 3VXTB 2L7JA 4WNQA 1IMHC 4L1HA 3VFWB 4X9BA 1H9VA 5FYJL 5KANI 2QBWA 4F7TA 4ZUSB 5CJXA 3S34H 1G6RL 3MRGB 1NBVL 3M8OH 4RQQA 4K3EL 3MLSH 1KYOJ 5HDBF 1RK0A 4Z6AT 3E6HB 3LEXA 5DVMA 1WBZA 1RY7B 1L6XA 3V5HA 2YS4A 2VO5A 2GEEA 3QWOA 4LPWA 5KS9B 1IGFL 2BVPB 2PW1B 4QT5A 1MCHA 4FFWC 1Q9OB 4PJBF 5BVPH 4GG6B 4EOWL 1JE6A 5L7XH 1A1NA 2DLHA 4MNQA 4M5ZH 4QNPE 3TJEH 3DUUB 1DDHA 2BC4B 3AB0B 4HXBH 5I1AA 1NQBA 3EJZC 4MMXC 4KTYA 4P9HC 1JNJA 2DIBA 4KUZL 2X4SB 1J05B 3D85A 4MQSB 3WLBB 1BREA 5IMMA 1YQVH 1P5VA 1OM3H 1F11B 1G6RB 1S7XB 3H42H 1E0OB 4X4XA 5KVFL 3VD5A 5D1ZB 2JCCF 2FX9H 2KKQA 5GRVK 3RRQA 4O2FB 3HI1A 4K3DH 4F33A 1LNUB 3R1GH 3RNKB 2NY2C 3SKJL 4YHZH 2VXTL 5EA0H 5F6HI 4PUBH 4Z0XA 4IMKC 5J6GA 5SWSB 4X4YA 5HI3C 3NPSB 1J8HB 5C08B 4OF0A 2VDRL 4OFKA 4PV9B 2GY5A 3UZEA 1E6JH 4BQ9A 2APWA 2GAZB 1QYGL 2D4DA 1SM3L 1GGBL 2YOCA 5E6ZA 3U4AA 1QRNE 1T2QL 5FYLD 5FYJH 3SJVE 2P46B 3C8KA 4QWWC 1T4KA 32C2B 1YEHL 1G6RH 4EI5C 1MWAL 3DYOA 1QBMH 4K3EH 2BHZA 2C7UB 1S8DA 2XWBB 5JMOC 2XV6B 5LQBL 1WISA 4JFEB 4OUUB 5IB1A 5I8OL 4RDQG 1IGFH 2BSRB 1RULL 4JO4L 2Z8SA 1FFPA 4PJ9C 1EZVX 4NT6A 1PZ5A 1MCFA 1IM3B 1BD2D 4EOWH 2Q20A 2YWZA 2OTUA 2EIBA 2WUCL 2VLRA 4I8DA 4KJPC 1KYOK 3N50A 3ES6B 1KFAL 4KUCF 3MLVL 2VXUL 3RVTC 3VA6A 4BH8A 3CDFA 1BQLH 4KUZH 3CVIL 3I6KA 5EZJA 2JJSA 1J8KA 5JNYA 2COQA 2RJMA 2DLTA 5ACMA 5GS2H 5L6YH 4XNMA 4L3EE 2ZUSA 1X5GA 5KVFH 1N8ZB 5IVXF 3BWAB 5TGBB 1CIDA 3GKZA 1YNKH 4X7SL 4HPYL 2XTJE 1YDPA 2VE6B 5ALCL 1K2DA 1SY6H 2ICWJ 1FZOA 3TVMD 2P48B 4QEGA 3SKJH 2VXTH 4JRYD 2DBLL 2YD9A 4UT9H 2P4AB 1YN7B 4P48A 3MMEA 5HTSA 4LLVB 3BYTA 3QEHB 3MGTB 3QUYC 5EU6B 2VDRH 5D7KD 1QSED 2NXYD 2MNUA 2QKIB 5JHDE 5I19L 1SM3H 1AHWA 5JHDA 1DE4A 4P2QD 4MXWH 5FGCE 1T2QH 3KYMB 5A2LH 4M4PA 1LVEA 1DANU 5HGDB 3ZHLA 5KSBE 4U1IB 1YMHA 3AUVA 3AREB 4PBXA 1V5JA 1E4XH 4OBSA 5LQBH 4HIXL 4RFEA 5I8OH 4O2CA 1UJ3B 5KVGL 3OQ3B 2AEPH 1RULH 4JO4H 4NQEE 3SQBA 4Z95L 1QLFA 4NQEA 1JIBA 2K3TA 2V5MA 4J4PA 3CZFB 1EERB 4D0BB 2WUCH 5TQ2L 2A6IA 3GMOA 4U05A 2NLJB 4JY4A 5EULV 1EFXA 4LHUD 1RD6A 3C60B 3PL6C 1YY8A 4LSRH 2P45B 2IGFL 1KFAH 2VXUH 1LEGA 4FN0A 4H20L 2HWZL 3QEUB 3CVIH 5I75B 4DWHA 1A1OA 5HDQL 1I3RA 5FGBA 3V52L 5F88B 3RVWC 4WO4A 1QFWI 1AJ7H 5HHOB 1UCBL 5F7EH 3DMMB 4N0CC 5FO9B 4X7SH 4HPYH 1LEKB 1PKQE 3FJTA 1U6AL 4H1LA 2KL6A 4XVUD 3GMPA 3MREA 5ALCH 1G7MB 3MRDA 4PRHE 1JFQH 4X98B 4N0UB 4RGNC 1JF1B 3NPZB 4R0LC 4G43B 2HFTA 1E4KC 2V6HA 2PXYA 2DBLH 3J8F7 4NOBA 4XNXH 4PJDB 5GRJL 5DHVB 1IAKB 1AGCB 4XH2A 4ZDHB 3ETBF 3VXQB 3OKYA 1PX4A 3RWGA 1MFAL 2ICES 2GK0B 1TQBC 4ZNEA 2IBGA 4DOHE 4OZIF 1BFOB 5DRZA 2QLVB 4TUKL 1MPAL 4XNZB 4KJWC 1KT2B 1NCCL 1W72B 1LO2L 3IU4L 3ARPA 1X44A 4G8FB 3D39D 4XC1L 4Z95H 2K7PA 5J6HA 2FO1A 2YA0A 4HX1A 4MZ2A 4NN7B 4WRLA 4EIZC 1J5OL 5DHVH 5E6ID 5D93B 1U93B 4HWBL 3DJ9A 4NQSB 3IJHB 4KKCC 4OM0L 5TQ2H 3DRQB 5MEOA 4YBQD 1OLZA 4PJGF 5FO7A 5B39A 1EEYA 1B0GB 2XZCL 4HQQL 2XQBL 3EZJB 1R3JB 3GSVA 5GS1A 2FD6L 4NO0B 2IGFH 4H20H 4R96A 4XBPA 4NWTL 5TE7L 3NACL 2HWZH 2FNBA 2VZUA 4X99A 4Q2ZA 1CFQA 5JOFB 3OX8B 1QQDA 3V52H 3RVVC 3MV8D 1D9KA 3LRSA 4R2GD 1M7DA 4RGOL 3LKQB 1AE6L 4JM2D 1E6OL 4MJ6B 1U6AH 1FRGL 1KLGA 1OCWH 1CZ8H 5L0QB 5EU3B 5I9QC 1KN2L 1Y0LA 3MCKA 4AM0B 1I8MA 4NQUA 5GRJH 4P2CG 3TIEA 3P73B 2YRPA 3AS0A 4UV4H 2JE8A 1J1OL 3QHFL 2YMXL 2HKHL 3WFBH 1C5BL 1RURL 1T21A 2VUOA 4N5ED 1RJZA 1U92A 3FO2A 4XTRD 4HF5L 5DC0A 3ROOA 1MFAH 1S7SB 4PD4J 4QRQB 3HPLA 3DRTB 3KPPA 3OKMB 3HR5A 3JWDC 3MV9D 1CDJA 4YAQA 3B9KB 1IKNA 4TUKH 4R97B 4XZUB 2ZOKA 4LLYB 2X4QB 1TIUA 3AM8A 3SGEI 1UZ8B 1JF5A 1NCCH 1LO2H 2HAZA 5IG7A 4WUKL 2C3GA 5C6WH 4XC1H 4POUB 4APQA 3WKML 4O51A 1OOAA 4B50A 3P11L 5IFHL 1UT9A 3MV01 3MBEA 5TDPA 3OKKA 4WCYL 4U49A 5JXEC 2ORBL 4HWBH 1BVKA 4OM0H 4U6XB 3LB6C 3RGVB 4HK0A 1YEFL 4TPRH 2XZCH 4HQQH 4MNGA 1MJ8L 4G42B 3UTTB 2FD6H 5TFSL 3C6LC 5KVEL 2B1AL 3D2UD 3DGGB 4X5WB 3NACH 1CYGA 4MWFB 3WN5B 3MXWL 4PGDA 2W07A 2ENSA 1NL0L 3F65A 3ZKXC 3WFHB 4HCRA 4RGOH 1CGYA 1I3VA 1CXKA 4WVRA 3OZ9L 1K5NB 5D1XD 1YMMD 1A4JA 1A7NH 4LSSL 3ESUF 2CDEB 1FRGH 5TDOA 4IIQA 1KNOA 1KN2H 5GRVL 3ARXA 2NY3C 2NYYD 2R15A 2DB8A 2Z91B 4YNYB 3T0VA 2RR3A 4UNUA 3T4AB 2X4TB 2EEDA 4QHKJ 1OGAE 3PNWA 4B53A 4LQ1A 1Z3GL 3QHFH 2HKHH 4CMHB 1RURH 5EO1A 5J7CC 1MY7A 1KF9B 4ZFOA 4G9FB 5E9DA 2WWMD 4MD0B 1PG7X 4Y19E 1QD0A 1KPRB 1HXYB 3ESVF 4XP5H 2OL3B 2XRAL 1HILB 1WBYA 3Q0HA 1D6EB 3HZMA 1CFNA 3N1FC 4G6FD 4F15C 2P8LA 3GJEB 3O81A 4PRID 3EOAA 1AKJB 3G6JE 3P30L 2CKBL 5D1QC 4ZO9A 3OKEA 3DTXA 4WUKH 2DBJA 1HSBA 1S7RB 2FIKB 1FNGA 3ARSA 3LPGA 3WKMH 5I6XB 1ITCA 3UTPD 3D25A 1CF8L 4H26A 1A6UL 3QNZA 5IFHH 4XPGH 2ORBH 1GZQA 2B4CC 4OD1L 1T7YA 1YEFH 1IZJA 3TO4D 2AV7B 2HRLA 4JQXC 1Q94A 1ZHNA 2C3WA 1MJ8H 5EU7E 3QUXB 4HLJA 3UJIH 5KVEH 4NJAH 1G7IA 1OVZA 5HY9A 3MXWH 1CLCA 1NL0H 4M7ZC 2ZSWB 4G8GE 3N1GC 5D70L 3KYOA 4U6HB 3OZ9H 1AC0A 1WLHA 3EYQD 4AIZB 4BQ6A 5KTEL 4MDJA 2ZUVA 4CNIB 4LSSH 3ZKMC 1RZ8B 1MHCA 4ZMAT 2CKBB 1KB5A 1S5IL 3OAYH 4U0QB 1AQDB 3MNZA 4NBYB 3HPJB 4ALAL 2HJLA 2GTWB 2BVOA 4FS0A 3OF6A 1YZZA 3QUZB 2FSEB 4YBLB 4UIKL 3EDEA 4PJ8A 1EAPA 5B21A 3INUL 2MKWA 4HAFA 4ZQKA 4ZS7L 2VAAA 2WIIB 3U30C 4MAUL 1EHNA 5DZOA 3VWJC 5HHQB 4PRAB 2DQFA 5D9SA 1CFTA 5IHZB 3CFEA 1LGVA 3QHTC 1SEQH 4XGZA 4U7MA 5CLWA 2Y36L 3MYZA 2CKBH 3AS2A 1EAJA 5I2IA 3B6SA 5FYJD 4LSTL 3OJDA 2OTWA 1CF8H 1A6UH 2BVTA 5ICYB 5C0BD 5IF0B 1MCPL 5MHSE 2EKSA 2FEEI 2LU4A 1NSNL 4X9GA 1AGDB 4ONHB 4HUUA 3FONB 4YGVB 3BPCA 3TFKC 4JFDB 5F89A 2CDGA 1B90A 3FT2B 5SWSD 2NQCA 2VZTA 3T4YA 1J8HD 3CSGA 4KKLC 5C08D 4P5TC 5D70H 5C0EA 4JFOB 2B7DT 1CT8B 3WD5H 5KTEH 5L2KB 5JOPE 4XMLL 1A6TB 1MCWM 2Y5EA 1S5IH 3MRKA 1F3RB 3EW3B 4M3JA 4F37K 3V9FA 3VRLE 4GXUM 4P46B 4W4NA 4DJMA 2DTSA 1CD0A 4QHLB 5GS2D 2LE9A 4UIKH 4P2OD 5FEBA 5IR1B 4Y2DA 4PJCB 4Y4KA 1OW0C 3TBWA 8CGTA 4JFED 4MXVF 4ZS7H 4HUWA 3B8SA 2MHAA 2VTFA 4FQXA 4WWID 5CGYD 4U1LA 5I71B 5IMKA 4JJ5A 3HE7A 2W0FA 5GZNC 4UDTA 2Y36H 1N4XL 5EZOH 4ODBD 2BNRA 3DGCR 3IFOB 5FF6B 1YJDL 4JO3L 4LSTH 2F19L 5GGSY 1KJ2A 3NIDE 5F6HJ 3V4VL 4Q9CA 4NFDA 2V5YA 4LAQH 4ZOBA 1MAML 1MCPH 5BRZB 3G5YA 2VZ3A 1D6VL 3CXHJ 3EHBD 1NSNH 3C09B 2R29L 4B5EA 4U1SB 2F74A 3PWPE 4IRJB 3GSNB 4Y8AA 3VGDA 5HYJB 1RUML 3LV3B 4ZO6A 4NC0B 3VXOA 1VB9A 4U6YB 4S10A 3MRFA 5CBAB 3AGVA 2CLVB 4XMLH 3F7PC 1YQ2A 4LNVA 3WIHA 4TSAL 3IDNB 1MI5E 2Q7NA 2JELL 4DTGH 2EYTB 2BMKA 1I9IL 5DRNA 1T7VA 4YJZL 4JG1H 2AXJA 1ZLWH 5GGVL 1R5WB 1FJ1B 5EN2B 3PGFH 2JLLA 2ADFH 3WNNA 5LXGL 1L7TH 1G7JA 3GSNH 1SJXA 4FXLA 5JZ7C 5TJWK 5DYOB 3MV7A 4JVWA 5KZCD 4G9DB 2JCCA 3BP7A 3C60D 4RZCB 1N4XH 3WJJA 3QIWC 4KTEL 3RBGA 4JO3H 4I2XB 5K33A 4OUOA 2F19H 1L9MA 4I3GA 4HH9B 4N8CL 2ZUXA 3V4VH 2J8UF 3VE0B 3RTQC 1MAMH 2NZ9C 2RCSL 3AU1A 4PY8J 4WEBH 3SDAA 1GGIL 2BCKB 4JFZH 1IE5A 1FL6A 2VAJA 5EU5A 1PJ9A 3WL9B 3H7BB 2YUXA 3P77B 2X4UA 1ODAA 1P4BL 3GGWA 4J3XA 2NW3B 4LLWB 2D7MA 3BVNA 3FCTB 5CUSH 4TQEL 1QR1B 4YHNB 2HVJA 2VRAA 4I3RL 1A8JH 4WHTA 3VU2A 5ESQB 2V2TA 5AEAA 3OHXB 5DUML 2QQNL 3VGHA 3FN9A 4YPJA 1I9IH 2J12B 2JJTC 3S4SG 1KCSL 4GAYA 4LLQA 1ZHLB 2PW2A 2W9DH 3EO1B 1WZLA 2GCYA 4ZXBA 3QH3A 1NUFA 5LXGH 4HT1L 1UXSA 2Z8WC 1JV5A 1KIPA 3NH7L 3LZFL 4ONGL 4C56E 3C9NB 5D1ZC 2DRUA 3IF1B 2D0HA 1T0NB 4YWGL 3AMKA 2APBA 5IVXA 4PJFE 1KPUA 4NO0D 3V6ZB 4JQVA 1QA9A 2BNQB 4WI7A 4KTEH 1XGUB 3I75B 3NPSC 3ZKSD 2KH2B 2XOTA 1EX0A 1IL1B 2RCSH 5A2IH 4E42A 4NPYA 4JRXD 1GGIH 3NGBC 3MSPA 5I76A 1JGVL 2C4FU 2F53B 4MAYB 2R2HB 2H9GB 4WTWA 3QXUA 4OCRL 2XPGB 4I5BA 3LQAL 2Y7QA 1KPVB 1KXQE 1T5WA 3QWQB 4J8RB 1M71B 5DUMH 3FN0H 1BAFL 4AEEA 2QQNH 2EDRA 1G9EA 5GSRA 4F7CA 4PTTB 1TZHA 1SMAA 4OD2A 1VADA 2O5XH 4MHHG 2LVCA 3TNMA 1ADQA 3PWVB 4LKXA 2RB8A 4R26L 5SWZB 3IXTB 3VXRE 3VXRA 1NMCB 3BIKB 5I1KH 5KANG 1VPOL 3QULB 3DSFL 3X3FH 1F2XK 1FG9C 5BW7C 4HT1H 3EOBB 1FL5B 4D0DA 3NH7H 3LZFH 4ONGH 3B5TA 2D3VA 3P4OB 1CGXA 3WCYA 3RGVD 5T1MB 4CADB 4EDXA 3UTTD 5FAAA 5E99L 5F8RC 1OAXL 1N5AB 4PJ5A 3CFJA 4YO0B 1UENA 3GSWA 3T77A 3BN3B 1EEZA 4JM4L 1QRNB 5EBLB 5EZLA 4LEOB 5J9PA 1GH7A 1LO0H 5SX5K 1IC7L 2NY1B 1U8HA 1WAAA 1PW3A 1JF6A 1XH3A 2YPVL 3LQZA 3ULUE 4FQQB 1JGVH 2C9AA 3VXNB 5CIPA 4M6ML 3KR3L 4LKCA 4K7PX 4UBDD 1NAMA 4A6YB 3CPLB 1UQSA 3FFCE 4OCRH 3QDME 4KK5C 3QDMA 4ONOA 5HI5C 1MSPA 1CVSC 2A73B 2EE2A 4Y4HB 5ITFA 4BSWA 5BO1H 1NDMA 1JZ5A 4Z7WF 4UZGA 1BAFH 5CEXA 3PXJA 5DC9B 5EO9B 2QR0A 1HE7A 2BSSB 2X1OA 4WJ5A 4Z78A 1NJ9A 3CDCA 5DZNA 4ENEC 5MERA 1I7TA 5IGXH 4YDKL 4R26H 4L3EB 4V1DE 5HSFA 1U8NB 3TBYB 5M94B 4PJGA 5JW4N 3ECBB 1VPOH 5H8DA 2XTJB 4HK3N 3OXSA 4KRLB 4A6YH 4NKIL 2HJKB 4KWUA 1Q9KB 1WUNT 3DMMC 2LAGB 1U3HB 5EUKB 2L7UA 3PWUB 4OGAD 3IVKB 1BOYA 2B8OT 3GSOA 3PWLA 5ID1A 3VFOA 5E99H 3RUGE 3FRPA 5J1TC 3CCHB 4OKVB 3RUGA 1OAXH 4X6FB 5KG9B 4UILL 1J86A 3GKWL 3LKNB 2VKWA 1G7QB 4JM4H 3S4SB 2AS5M 4PJIE 3SEPA 4PJIA 3ARDB 3WFZA 1IC7H 4QF1B 2KZWA 4U4BA 3RI5K 5KSBB 3MJ7B 2IH3A 5A2KH 1XF3B 2YPVH 4PLKC 3U4EA 2DQCL 2FGWL 1JPGA 3HG1D 3O2WL 3QFDB 4WU7B 3Q6FA 2FJGB 4WFEE 1W0VB 3KR3H 2AQ3A 1TPXC 4U2ZA 3TBSA 3R0NA 3QUZD 3IETA 3UC0L 5CKAA 1FL3A 5EOTA 3FQXB 2HN7B 3FB7B 1ITBB 4KRPC 1X5FA 5C0CD 1A9EA 1ERNA 4H0GA 2AABL 4ZAKA 5CD5C 1BPVA 1SBSL 1HKLL 5D96C 4OCNC 2K7QA 2CRYA 4IDJH 4NO2A 2MJWA 2WUBL 3L3KB 4YFLF 5F1NA 4YDKH 5KVMC 5DJYB 3E3QE 2J88L 5HGBA 3DARA 3KG5A 1T89A 3WNOA 1BFSA 2XICA 1PKQB 2AVGA 1A7OL 4PRHB 5CEYA 4NKIH 3NFPB 4L4TD 1B6UA 3NCJL 1HKFA 1WK0A 2OMNA 3O6LL 4OGYL 1TJHH 2H45A 1OTTC 3SDCB 3HE6D 3SY0A 3S98A 3WNLA 3BEWB 5F21B 4L8BA 4JFDD 4YEEA 1G7LA 3GKWH 3ZSTA 1BJ1J 2V7HB 1C08B 4ZD3H 2XG5A 4TNWK 4HWNA 1FZMA 3RWIB 3TGXA 5I1LB 4LSQL 1DP0A 4XCNB 2VLKB 4DGVL 4EN3B 1D5XA 1A7QL 5F1IA 4DOHB 3OAZK 3LPFA 3MLUL 1INQB 5D7IA 3G5VA 3F7VB 1FBIL 1LO5B 3HNSL 4CU6A 1SVCP 2FGWH 1BIHA 2OQJB 4NZUL 3KLAA 4PGJA 5JPNB 2F9BT 4H0IA 3B9KC 4P46D 4R97C 2XI9A 5TPWL 1LDPH 4XI5D 3UC0H 1Q72L 4QRPA 3BPLB 4P3DA 3RZCB 3M17A 3HHRB 5ADPL 1CK0H 3BZ4A 4AMKL 1U8LA 1XR9B 3IKCB 1BZ7B 4JZJA 4AH2B 3V5KA 2AABH 5C0IB 1HKLH 2AKRB 3LIZL 1AGEA 5IB4B 2WUBH 1TENA 2BXYA 3IXAB 4U3XA 5JW5B 1CDUA 2J88H 3CDGB 4AYFA 4GAGL 2JJVA 4J3VA 4PJHE 2V5TA 4OT1L 5INDA 1F8TL 5HHXL 1SJHB 1TCRA 4Z18A 1ZT4A 1A7OH 4YDVA 4R3SB 4POZC 2ERJB 1FN4A 3ARFA 2NMSA 5F6IC 5BRZD 4UDUB 1GOGA 3IDGA 3MGOA 2YXMA 3O6LH 2XNAB 5GRZA 2Q86B 1YEDB 2ARJQ 1P7QB 2HLFD 4LVNB 4U6VL 4IRJD 1I1YB 5D2LA 5DGQA 3P4MB 4ODXB 5HYJD 4XX1E 3GIVB 4MCZA 3C5SB 4WTZG 3TCLB 4LSQH 1A7QH 3TIDA 3MLUH 4CMHC 5EC2A 1WZKA 5K9OB 3QQNA 1AO7E 1FAIL 3PABA 3FQWA 5I1IL 1AO7A 1FBIH 3HNSH 4L8CB 1NFDF 1JNHA 3HRZB 5IQ9B 1HQ4B 4X7TB 5T1LA 4JN1L 5TPWH 2FCBA 3VXUB 1DEDA 3LN5B 4LCWD 5K9JH 1T04B 4N90E 4XWGL 4U31A 1KJMA 5D7LA 2L0DA 1XIWB 4Y16A 4LSUL 1EHXA 1B4JH 2NY7L 1OP3H 5ADPH 4AMKH 5IVNA 4ZFOL 4XXDA 4C57C 5EU4B 1F13A 5FB8A 5DMIL 3RWFA 5IMOB 5FCSH 1P9MA 4XP4L 3LIZH 4EUPG 5IROA 1XF1A 2R0KL 4DEPB 3KDMA 2IANB 4NWUL 5DJ0A 5EO0A 3QUXC 1OTUD 3KPLB 5JORA 4QCIB 4GAGH 3M1BB 2X6MA 1B88A 4LU5H 4JM2F 5I30L 4BUGA 4OT1H 1KCLA 1R0AL 4MJIB 5GGSB 4ELME 2OR9H 3RY4A 5HHXH 4NHCL 1QSFB 4NP4H 4M7LT 1MCCA 3AAZB 5B38G 2ZUQB 4QXTA 4I48B 2IWGA 4PRPE 4YHIA 5KSAC 5LAXB 1ZT7B 4OCXL 4IOFC 1OGAB 4P23A 1DJSA 3JV5A 5EH1A 2H26A 3OG4B 1NMAL 5C09A 4LPXA 1X4ZA 4YBLC 1AR1C 3BP6B 1XZ0A 4Y19B 4OQ1A 1EUUA 1UFUA 3PJSA 3I85A 1T22A 3T0EE 2QSCL 2HTLD 3ARGB 1KJVA 3T0EA 1FFOA 2AQ1A 3CZJA 1R3LB 5I1IH 3CNKA 4U1KB 4BZ2L 3G6JB 3QIUB 4IRZL 5LCVL 1NUNB 4NDMA 4U7SA 5KSUA 2LU3A 1UWXK 5ESAA 4JN1H 3X11A 1UM5L 1PD6A 3U1SL 1MNUL 4C4KO 5SV3A 3HUJF 1GAFH 2YPKA 4LSUH 1LQSR 2NY7H 2BSTA 4XNUL 2C1OA 4I4WB 3H8NA 2XKNA 5DMIH 2A1WL 3BO8B 4DAGL 1A1MA 5ISZE 1ORQB 4UMGA 1E28B 1OD9A 5CD3A 2MCPH 2ESVE 3HC0A 4OQTL 1U8QB 2R0KH 2XWTB 3NA9L 2VJXA 1AR2A 4NWUH 4G8GB 3U46B 3HS0A 2X4PB 1RHHB 3SDXE 1UA6L 5I30H 1R0AH 2BNQD 1RUKH 3GM0A 3JBG7 3O8XB 3QG6A 1CD8A 4M43H 4DZ8A 3WSQH 4GBXA 5L9DH 4GKSA 1IGCL 5F7KC 4B41A 4OZ4B 3HMXA 4PJXB 4HLZG 4RMSA 4Q6IC 2C3HA 3OPZL 3DV6A 4YFEA 1GHFL 4ZFFB 1NBYB 4WW1B 4OCXH 4TUOA 5BOZG 1K4DA 5DLML 2A77L 1NMAH 3MLZH 5FOBB 3QWRA 2A6KA 1LE5A 1JWUA 2H2PC 3JUZA 5I0ZA 1RZ7L 2Y5TB 3MR9B 3TYFB 2XZZA 4P59L 2QSCH 4JPKL 4GRWF 3GJFA 4GW1B 4WUUA 4XPHL 2Q8AL 4BZ2H 4K55A 1S7WA 5SX5H 5ETUB 1YY9C 2NX5E 4IRZH 2QTEA 3TNNA 5DJ2B 5T3XE 2BFVL 5LCVH 2UZIL 2R2BB 4ESKA 4UB0H 4X8XA 1UM5H 4U6TA 1CU4H 1MNUH 1FSKC 1AXSA 3U36A 1RSFA 3WV0A 3V2AR 5BVJB 2AXHA 1NCBL 1FG2B 4XNUH 4MJ5A 1A64A 2DMCA 4EEEA 1NCWL 2A1WH 5EUOB 4DAGH 1VFAA 3KS0J 1T1ZB 2AXGB 3GI8L 3KPSE 2RFXB 5ICXA 3IB4A 4OQTH 3KPSA 3NA9H 4FP8L 1A7PL 1KCUL 5E2WL 1GGYA 4R7DA 3QUMA 1IEAA 2ZOLA 4JLRA 5ITBH 5CLTA 3V7AE 3ZL4L 1UA6H 3MRBB 4RX4D 2Z0BA 3RL2A 4BSJA 2UYLA 1N6QL 1Q0XL 1QRND 3BGMB 1JZ7A 1FYTE 1KJ2L 2R69L 3SJVD 1IGCH 4D9RE 4WW2F 2F54B 4K8RC 2MTPA 4ZUWA 2NY1D 5IT2L 5ACZA 4XHJD 4NBZB 3OPZH 3IGAB 1GHFH 2IAMA 5FKAB 5SWQA 5DLMH 3ZE1E 3VJ6A 4OIIL 1VGEL 1F42A 4QHNB 4EUPB 3VFVB 4P59H 3WNMA 4JPKH 3K2UL 43C9B 3V8CA 1ED3B 5DSCA 4DK6A 3HTLX 4Y5XC 4I0PA 1JTTA 5IV2A 1N59A 2Q8AH 4IRSB 4JFYB 4NN6B 1P7HL 1UXWA 2ZJSL 3SDDB 2BFVH 2UZIH 2Q3AA 3L3HB 5A1AA 2ITDB 1K8IA 4JGJA 5CJ5A 1XMWA 2V9TA 3G5ZB 4L3ED 3H3KA 3SE9L 3HC4L 4LOUD 3DNKA 4UIMA 2XTJD 4N8VG 3O11B 5DVOA 5KW9H 5F9OL 4HIIB 2X1WL 1H5BC 1CICB 3GI8H 2DIJA 2DQEL 4EUPH 1JZ4A 1DQJA 4XCCL 1U3HD 5ANMB 1KGCE 4FP8H 1A7PH 1U3YA 1KCUH 4ODWA 1FO0A 5E2WH 1TNMA 1NGYA 1OSZA 5HVHB 3MLTB 3ZT5A 2Z31B 12E8H 3ZL4H 4JAMB 4PLJC 3QUKA 2YZ1A 1OTSC 3QDGA 1O7SA 3QDJE 2QQLL 4KK6C 1Q0XH 5GS0C 1N6QH 1OAUH 1MI5B 5IW6A 1PLGL 2R69H 2YKLL 3ARDD 3VFTA 5IT2H 4I18A 5E03A 5F7YC 3ZKQD 3A6CL 1HEZA 1FQ9C 1CGUA 4PJEF 3T1FB 2P24A 4MB5A 5IW3A 4LFHD 3WO4C 4HWEL 1BF2A 4OIIH 1EGJA 4G6JH 4N0RA 4LRNL 4NQED 1VGEH 5AUMB 2FR4B 2GY7B 1U8MB 4OCSH 3OKNA 3K2UH 4PBWD 5E00B 3THML 3T2QA 2KQMA 2UZYB 5KJRL 4ZNCD 1DN0A 1S78D 3OAZH 3T3MF 3MUGA 4HJ0C 2GSGB 2ZJSH 1JRHL 3VFPA 4JCLA 3T8XA 2GJZA 1KC5H 2CRMA 5L2JB 5AZEH 3O2VL 2YUWA 1A6ZA 3EO0A 1T7ZA 5K93A 5DDHB 5LVEA 1WCBB 3SE9H 3HC4H 2WLZA 3U9PL 5LGHH 5F9OH 4PRHD 3RWCA 2XZQH 1KB9K 2XQYG 5C0AE 3HNVL 5JIKA 4M1CC 2VXVL 4URTB 1FPTL 3P9MA 5IHUH 2DQEH 5A16B 4XCCH 1NCTA 1JGUL 1BZ9B 1LWRA 2P7TB 1WWAX 1DLHB 3B3IB 4RGNE 4TYUA 2CRIA 2DDQL 4L8DA 4JFQB 3IU3B 2FECL 4Q9QL 1MELA 3MRHA 4MAYC 4KZEL 2QQLH 3O6FD 4RIRA 4EN3D 2LQRA 1OAQL 2WLYA 4LLUB 3Q48A 4NM4L 5JIIA 3WJLA 4UUJB 5SV4A 1IQWL 4CVZA 3WFCL 1YEKH 3A6CH 3E2HC 1JGLL 5I74B 1Z9OA 4F7MA 3EYVB 1A2YA 1FGNL 3RDTB 2X7LA 1C5DB 3HN3A 3G9AB 3WIFA 2KQNA 4LRNH 2WBJB 5F9WB 4IHOB 3A0OA 1EJ6A 4M7JL 2Y06L 3UTSE 3THMH 3RZCD 5I16B 5KJRH 1I85C 3X12A 5C70A 4Y5VC 4G80A 2NZIA 3OR7A 3MBXL 5CSBA 4PJFB 4UTBL 5SX4I 2CR3A 8FABA 2ED8A 5J1AA 4BUHA 1S7UA 1HOCB 4OI8A 4G6ML 1XGPB 2BNUA 4Y1AE 1GZPA 4Y1AA 4YGAB 3O2VH 4M4RA 3S7GA 5B3JF 1KUMA 3HLAA 2G75A 3O4OB 1BJ1H 4DKDC 3VMPA 4XCYA 4QRUB 3U9PH 1IC5H 1MUJA 3BN9D 3H0TB 3HZYB 1BQHA 1G9ML 3NIGE 3HNVH 5LGJA 2JK5A 2VXVH 1FPTH 4JFHE 1TZIB 3MRNA 2WINA 1JGUH 2X4RB 4KDTC 5H2BB 3GRWL 2A74B 3QDHA 3U4BL 3OKOA 2DDQH 3TF7C 5C0DB 1UYWL 3QRGL 4YHKL 4TTGA 2E6PA 2BVQB 5I0DA 4KZEH 3VI4E 3DVIA 2EECA 1NC4B 2Q3ZA 5EZIL 4JPIB 4LQFH 5HYFA 4XPTL 3CH1A 3K1DA 3KJ6L 5MENE 1NLBL 5IBLC 5MENA 1IQWH 1CGSL 1BD2A 2QHLA 4PB0H 1PYWA 1JGLH 2QSTA 5T1DL 1QFWM 1YNLL 3ULUL 3U82B 1NC2B 5HYEA 1FGNH 4XP9L 5EC1B 1OQOA 3R4DA 1T03L 1EUTA 4M7JH 2HVKA 2IQAA 2Y06H 3QBTB 1XIWD 3OR6A 4WEMB 4HC1A 1NCUA 5F1SA 1F2QA 1YPZE 4YXKL 5E8OA 1F3DJ 4UTBH 1FE8H 1RHFA 3FOLB 3ARRA 4HV8B 3TBVA 4F2MA 2GITB 2ATKB 3DX9B 4XAKE 3TVMA 4K7FA 1GCFA 4JRYA 2D31A 1BWWA 2ZCKL 1GRWA 4Y0GA 4CJ0A 5H94A 1H8OA 3DOSA 4M93B 4K2UL 2YC1B 4OLXH 1NBZA 4ZTOL 1QSFD 5GGUA 3W11D 1QSEA 3C87A 3KPRE 3HZVB 2FLRT 4KVNL 2H8PB 4P2QA 3DIFA 3GRWH 4FMKA 3U4BH 1DQQA 5I1GH 3FFCB 4LLDB 4M61A 4Z5RA 3C5ZC 3D0VA 1OGAD 1UYWH 3QRGH 5HGHB 2JB5L 5HGAB 1EV2E 1YEEL 2VL5B 1M7XA 3JTSB 5TDNA 2VN4A 2WW8A 4HJGA 2VITA 4AT6B 4M48L 5EZIH 4Y19D 3ARBC 4EI6A 4MXQD 4XPTH 4XX1G 1HH6A 1HINL 1JWSB 3JV6A 3KJ6H 1Z5LB 3ULSB 1NLBH 1CGSH 5E5RB 4PGEB 5FECA 4P4KB 3H2WA 4MQXD 4V1DB 4JN2B 1YNLH 3HFML 1S7VA 4H25B 4XP9H 2RQ8A 3O3DB 5D71L 5IOPA 3X14A 1F3JB 3H9SE 5D1XC 2HFEB 1T03H 3H9SA 5IEKA 3L6FB 1IAIL 3D3VE 3N1QC 1PAMA 3D3VA 1FNEA 3UPAA 1LEIB 1AD0A 3ZO0A 3R8BB 4YXKH 1EZVY 4AJ0A 2X70A 5C07E 3L3GA 3PP3H 3V8OA 1V7ML 3LSOA 5T5FL 4GRLB 2ICEB 1HI6A 4PG9B 3P0VL 2CLRA 4PV8B 4E5XB 2A2QT 2B1HL 4G8GD 1MHHB 3EJYC 3MC0A 3B2VL 2P8MA 1ETZB 5GISL 1LP9E 5FCUL 4K2UH 1CFSB 4ZTOH 1YYML 3O8XD 4PJBE 4HS6A 4JFFE 4PJ7B 1K4CA 5DJZB 3ZKNC 4CGTA 1TVBB 1WICA 4R7NA 4ZUTB 2YRZA 1B2WL 3GI9L 1KEMH 1UZ6F 4Z7NE 4KROD 2ZCLL 3QIBC 3PDOA 5D4QA 1HHJA 2JB5H 4HKJB 1Q9WB 1HHHB 4LF3A 1YEEH 1RAMA 3BW9B 2O5ZL 3O3BA 4RISL 4ZPTB 5CJQL 4QY8B 3D39A 1HSAB 1TTFA 3VGGA 2ADIB 2IPKB 4P4RA 1OLLA 3LRHA 5E6IA 1RPQA 4GKNA 1W0WB 2W1NA 3VWJA 5FA3A 3HFMH 5F7LB 2A0LD 5D71H 4AENB 3LEVL 4GG8B 4K71B 1JZ6A 1EO8L 1XF5A 3T2NH 2IBBA 4JANB 3B9AA 2H32B 4ZFGL 5JA8B 5FYKE 3GMMA 4PRDA 5MHSD 4WW2C 3MV8A 2ADGB 3DV4B 3QCVL 2XN9E 2QADB 5INCA 4Y7MA 5MEQA 1RZKC 1V7MH 2Z8VC 5T5FH 4JDVA 3MRLB 4KAQH 5DURD 3P0VH 2CUIA 4NUJB 5JO5B 4XBEL 5ELIA 1JYXA 4NQVB 4DFIA 2B1HH 5E5MB 4LVNC 2G2RB 1DUZB 4OZGB 3WEXB 4N1CA 4TUJA 5GISH 5FCUH 3UBXA 5JOPD 2IBZX 1YYMH 2FBJH 2IADB 4S0SD 4OZHF 1ZHBB 4L8SA 4KI1A 2EXWC 4PREA 5CWSB 3GMNA 2H32H 4M1GL 5BZDB 3LQMA 1P4LB 4D0CA 3QJHA 1IQDA 3C5JB 1B2WH 3CFDB 3NBNA 4RNRB 3GI9H 4ZSOE 3MV9A 1GJIA 4PYHA 4Y4KD 2ZCLH 1JPSL 1RZIB 4AQ1B 1YEIL 1FVDA 4X6CB 1JHKL 2IC2A 3EYUL 1NAKL 5T5NF 4JPWL 2O5ZH 4GQ9H 4OCMC 3GO1L 3S35X 4ZUUA 5E94A 4RWHA 5F3HA 4HMDA 3VWKC 5ERWB 4C58B 4RSVA 3QT2A 1F97A 4X5XA 3QO1A 4HKXB 4RMRA 1I75A 3MRRB 3BZFB 3KYKL 4FQJL 2GFBA 1FZKA 1FVEB 3KS0H 5BXFB 3QO0A 1AD9A 4PJHB 3NTCL 2OZ4L 3LEVH 4F7TB 2EDYA 3C6SB 2AK4E 2H3NB 3RAJL 3UX9B 2VZVA 3FOMB 2AK4A 2Y6SD 3D2UA 1EH9A 4ZFGH 3ZHKA 4D2NA 4H1LG 3DHJA 4YH6A 4PP1C 3QCVH 2VABB 4P3CL 2NTFB 1ZANL 4XPAH 3BKJH 4GW4B 1YMMA 2EH7L 2N4IA 3FTGB 3PWPD 4P2OC 1CICD 2MWCA 5GGTA 4QKXB 4XBEH 2IPUK 4UQ3A 3H6JA 1DDHB 5CZXD 3G6AA 2VLJB 3T3PE 1CDYA 2CGRL 4KKBD 2NY5L 2Z31D 4GJTB 3BP4A 5FDWB 2WSKA 3DETC 4H8WC 4NZTH 1L0XA 1NDGA 3L3DA 4GLRI 2NR6C 3D85B 2W60B 1MI5D 4D3CL 3PV6A 3ARGC 4U1NA 2E9BA 1TMCB 1S5HA 4M1GH 3DO7A 3CSPA 4NO5A 1SMOA 2BY0A 1T3FA 3SKOB 3P3YA 3EAKA 4YC2B 1JHKH 3EYUH 4Z7VA 4KJYA 1NAKH 1ZA6B 5DQ9B 3BGFC 4JPWH 4PRIA 2MMXA 4KQ3L 3NFNA 3GO1H 5IM7B 1RIUL 5A43C 1Q1JH 3ABZA 4DN4L 3QQ9D 1ZSDB 2DQJL 4XRCB 3VW3L 5J57B 3CSBA 3KYKH 1QHOA 2Z93A 2DWEB 1UVQB 3RWEA 2OZ4H 3TO4A 1HCVA 2OJZH 2VDLL 4HDIA 4ELMB 4S1DC 3DSNA 4FQ1H 2VQ1A 4PJAF 4DZBA 2BXZA 2J5LB 3S5LG 3KPNA 2PO6C 4I13B 2CK0L 5F9AC 4OLEA 3MRIB 4CDGC 1EXUB 1I4FB 1TVHB 4FFYL 4P3CH 4CW1B 1ZANH 1QBAA 3GBNL 4OZIE 1XCTA 2EH7H 2BRRL 3LS4L 4PRBB 3VXTA 4HZLB 3BQUC 3MZTA 1SEBB 3VFWA 4X4ZA 5ECJE 3VG9C 1CCZA 1PY4A 4LNRB 1QR4A 4ZUSA 2NY5H 3A6OA 3MRGA 4ODUB 2YEZB 3K8MA 3E6HA 4P5MB 4S1SL 5B8CC 4D3CH 4U0RB 5KS9E 4Y5YC 3D69B 2EDLA 2GJ6E 1I1AC 5KS9A 3RVUD 2BVPA 1OY3B 2PW1A 4NZRL 2DYPB 4GG6E 1Q9OA 4ZXBD 1YDPB 1HH9B 5H35B 4E0RB 1Y18B 1FLTX 3I02A 3FT3B 4OJFL 3ARZA 3QXTA 3CFBB 2FJFB 3SGKC 4UU9B 1TTGA 1RIUH 4C56D 5GRUL 4LCCC 5ISZB 4DN4H 2X4SA 3PDDA 4QLRA 3WLBA 2DQDL 2ESVB 4RRPA 4KK9C 2DQJH 2D4FA 2EXYC 1F11A 1G6RA 5E4EC 1S7XA 4D9LL 3EGSB 1MJJA 3TBTB 5C0BA 5D1ZA 3RL1B 4P2RE 4KI5F 1LO4H 4MA1C 3SDXB 1IEBB 4O2FA 2VDLH 1FP5A 5T3XL 3VI3F 1MJ7L 3RNKA 1Q0YL 1MVUB 1FORL 4P9HL 4V2BA 2CIKB 5SWSA 3BKYL 1J12A 3FZUD 1J8HA 5C08A 4HG4J 4PV9A 3GBNH 3UPRB 3WLWD 2GAZA 2BRRH 3LS4H 4IOIB 5AYUH 2B20A 3QFJB 4N5UA 3G5XB 2WBKA 5DJCB 1ZGLB 2H41A 2DMKA 3FO9B 1QFHA 1MIML 2K9UA 1EO5A 1WCQA 5HD8D 1NGWB 2JF1A 2DLFL 3QUML 32C2A 4LGRB 1EFXB 5E8PB 3B43A 3WXVL 1YY8B 5CJOL 2C7UA 1E27A 4UT7H 1BECA 4HEPG 2XWBA 4PJEA 3VFRB 4S1SH 5B4MD 2HH0L 4ISVB 2NX5B 4WO4B 4JFEA 4OUUA 1EBPA 4HBCL 3TPKA 2BSRA 1SY6A 4NZRH 3W2DH 4Z7UF 5JIPA 1JHLL 3FQTB 1IM3A 4IRSC 2EO1A 4NN6C 4H1LB 1HIML 3MREB 3SE3A 1BOGB 3SDDC 3VXRD 5D7JC 4TVPE 3O45B 1HYRC 5DVKA 2ZPKL 4OJFH 2PXYB 4QYOB 3ES6A 4OLWL 1QSVA 4UTAL 4XH2B 5GRUH 4X9IA 2AJZB 3EYFA 1X7QA 3TZVD 1VKXB 1BX2A 2AJSL 4RGMC 5ICZB 4CKVX 1QSZA 2NY2B 1ZEAL 1N8ZA 3QNYB 5D2NC 3BWAA 1P5UA 5TGBA 4HGWB 1C5CL 5D6DA 5HI4C 3L5JA 2VE6A 5DRZB 5T3XH 1JYWA 1U8IB 3BZDA 4XCEB 1IZKA 1MJ7H 5HVHC 1Q0YH 4WFFE 4P9HH 1FORH 5CAYB 3IFLL 3BKYH 3O4LE 5EU6E 4LLVA 3MGTA 3ULUD 1WT5C 3F7RA 2QKIA 2QL1A 1S9KC 1GYAA 1V3MA 2P1YA 3N85L 1J10A 4X7EC 3KYMA 3OL2A 4PG2C 3FFCD 1G9NL 1NCAL 2DLFH 3EO9H 3QDMD 3BT2H 3W0WE 5HGDA 5C7XL 2X5PA 5GS1B 3GSVB 4N8PA 4JO2L 4QNPF 4U1IA 4R96B 4XBPB 4HUKB 2VLME 5CJOH 3NA4A 5F7HA 3AREA 1BFTA 1CFQB 1OHQA 4ZS6C 3F8UB 1CGVA 1UJ3A 4HBCH 4NO3B 4UV7L 3G04B 1HDMA 3PGDB 3BXNB 1EFQA 1F3DH 4IBLT 3S5LB 3WS3B 4Z7QE 4P4KD 1HIMH 1KIUA 3CZFA 5E95B 1Y6NR 4V1DD 2OR8A 2ZPKH 2NLJA 1Y0LB 3BWUC 2HYMA 1KG0A 4L4VE 5F9JB 3C60A 4JJHA 4FFZL 2ZG2A 3O6KH 4UTAH 4J3TA 3QEUA