3MLXL

Crystal structure of anti-hiv-1 v3 fab 3074 in complex with an mn v3 peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
211
Chain Sequence
SVLTQPPSVSAAPGQKVTISCSGSSSNIGNNMVSWYQQHPGTAPKLLIYENSKRPSGIPDRFSGSRSGTSATLGIIGLQTGDEAEYYCATWDGSLRTVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVRAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab light
total genus 44
structure length 211
sequence length 211
chains with identical sequence M
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlxL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlxL01
5HGDA 5DJ6B 3MRQB 1Q94B 1WWAX 2BK8A 4KGJA 3BN9C 4JFPB 4UTAL 3QXDB 4G3YL 3X11A 1B3JA 5LGKA 5DMKB 4WUKH 2VTFA 2IANA 3C60B 2IJ0C 3GMMA 2J8UB 1S9XB 32C2B 4XPBL 4CDGC 3QYCA 1MHEB 1A1MB 1P4BL 2FB4H 3BSZH 4HMDA 3FT4A 3BZ4A 1XMWA 3FCTB 3PGFL 2HT3C 3QH3A 1LK2A 1NFDE 2WIIA 4RCAA 2EE9A 2YD8A 3MX0A 4NQXA 1A6UL 2GK0A 2JB5L 3BEVA 3ISWA 4Y88A 2X09A 4XPFH 3K2MC 1XF2A 5HXMA 3F12B 3UCRA 3ZKND 2EDLA 1NDGB 4M48H 2AK4A 4K7PX 2YWZA 2DN7A 3TFKD 2NY5L 4PJCA 1J0JA 4O2EB 3MMEA 1IRAY 1JGUL 3MRPB 3EDDA 5F72S 4NZUH 4EVNA 5ANMB 4JKKA 5ENWA 2FLBT 3WFDH 3O6ML 1VFBA 1AGBA 3DYPA 3FO2A 3W9DB 1OGAE 4JLRA 3VFWA 1AFVH 5HY9A 1HNGA 3CK0L 1DUYA 1W72A 3RJDA 1QYGL 5I9QB 2X9YA 4P23D 3QXWA 1N8ZA 1Q72H 1ACZA 1J8HD 1MCOH 3DV6A 4LDLB 5EU4A 4DUXA 5ISZE 1YY8B 2Z4QB 3ULVL 3C8KB 3IKCA 2NX5B 4YHKL 1PLGH 5GSVA 4ZXBC 3V5DA 3TESA 1QBMH 4ODHH 2XXCB 3FTGB 3CCHB 3RPIB 5LBSL 3HMWL 2EZ0D 5GJSL 3V2AR 3REVA 4M7KH 3QZWA 3WFHB 2XWTA 5KAQG 2P49B 2IH1A 2YXMA 1U95B 4WI2A 3TA3D 3KDMB 1MQKL 1GOFA 2OZ4A 5AAMA 1IARB 1PSKH 1NH6A 3CFEA 5ANME 2A6JA 2VE6B 5KVMC 1RIVL 4N1CA 5IF0A 3RGVB 1BD2D 2FJFA 4WO4D 1NMBL 5L0QB 4XH2A 5I1CL 5C2UB 2CR6A 4X80L 2RFXA 1AGDA 2QR0A 4POYA 2EYRB 4XAKD 3KPSA 4UV7L 3WBDA 4UAOC 3QFJE 2AJ3B 1LEIA 3IFPA 2NY3B 3VWJA 3EYOB 5D93C 2NY6C 1FFQA 1R6VA 5CGTA 1KYOK 1KN4H 1BHGA 4P2RE 5DQ9B 3GMQA 4OGYL 2DQJH 3LKPA 4ZS7L 4F8TA 1JZ8A 1S5HB 1J8HE 4P5TC 4AENB 2OSLB 5I1JL 3PE9A 3KPRE 3KLDA 4MCYB 4MSWB 3MNVB 4J3XA 4P3CL 3WEXB 4EDWL 5BVJB 3NFPA 4OCXH 5KSVA 4F33B 1UQSA 4UIKL 5JTWA 3BPLC 5JZ7C 2OTUA 5C0IB 1MJUL 3V7MA 2NY6B 5IIEA 5CSBA 3O2VL 3QUYB 2YUWA 2C7UA 1I1AD 4QHNB 1NDMB 4NO0A 4AM0B 3KXFE 4LIQE 1PZUB 5CHNA 5F9AC 2YK1L 4G8IA 3V4UL 4JB9L 3DX6B 5E4EB 2CLVB 1KIRA 2YMXH 3W11C 1PKQA 5DGRA 5IK3A 4EUPB 2F54D 3DVIA 3GRWH 4XPTH 4HULB 4XZUA 3MLXL 1QA9A 3EDKA 4KJYB 2JJWA 3BH9A 4LMQI 2FX7H 4JO2L 4R7DB 3ZKSD 1HQRA 1S9WB 2I60L 3MLPA 2NY5C 1B6UA 1P53A 3F7PC 4LHUB 1ZE3C 3RTQB 5GIRB 2P8LB 3ULUE 4QGYA 1WBZA 3MV9A 4XAKE 4Y1AE 2EYTB 4JM2F 5JO5B 5I1CH 2VQUA 5FYJL 3EHBD 2J7LA 5EOCL 1F4WH 1MWAL 5HPMA 3TIDA 5HVHC 1IAKA 3FONA 1PAMA 1FDLL 2WP3O 4UILL 1WBYA 2IBBA 1LE9B 3PQYE 4ZXBB 4PLJD 3QWRD 4LCWD 4PJ5D 4NKDA 1BJ1J 1J10A 3PGFH 1FG2B 2IC2A 3WL9B 3DOSA 2ZUWA 2BY1A 4M1DH 3DI2B 1WWBX 5MEQA 4WI5A 4WGVB 3DWTA 3V6FB 5JR1H 2V5SA 2RCSL 1LO2L 3MRCA 4WWKA 3G5XA 4GKSB 4AJ0A 3CUPA 3I9GL 2BZDA 1J1PH 2P24B 1F11A 5EO1B 1IC1A 2F74A 3K46A 3D18A 1DTUA 1EBPA 3RNKB 4GG8A 3LS5H 1P69B 1UEYA 5INCA 3HE6A 2BY0A 3OGOE 3IFNL 3OXRB 3TJHC 5F1OB 2CPCA 4PRNB 4MXWL 1U8IA 2VKXA 3N50A 2C26A 3QUXC 2IAMC 1XFPA 1UWEL 1IAOB 1X6NA 5CEZE 3BZFA 1F3RB 2P7TA 5ELIA 4JFQA 1YEDB 4NFCA 5IG7A 4IBLT 2QEJA 5AZ2H 1LO5A 3BP4B 4Z7WB 3QHZH 5TDPB 1YY9D 4OZIF 2APVA 3LEXB 4NNXA 3TBWB 1MCQA 5EOCJ 5IW1A 4OGXH 4QCIB 5F3BA 2EO1A 3MBEB 3MA9H 5C09A 5BS0A 2D31B 1NAKH 2XT1B 2X4OA 2APFA 5FDYA 5HHPB 1A7NL 5F96H 4HUWB 4X6DB 4M4PA 3P4OB 4HXBL 1T5XB 2VR4A 4PJCF 2X05A 4K94C 2P5WE 5TFSL 1C5DA 4RQQA 1I3VA 1Q9LB 3R1GL 4GQ9L 3WDIA 2IMMA 4WV1B 4OFIA 2Q6WA 1R0AH 3BUTA 4NNPH 3T4AB 1H8NA 4X5XA 3CFKA 1T21B 4XNZC 1K8DA 3H42H 3D5OF 4IOFD 3EZ8A 3IRZA 4QHMB 4R2GC 5EWIH 3SJVA 3D2UA 3MR9B 2ATPB 3VFGH 3VRIA 5C0RH 4X6CA 4F7MB 4QNPE 2WWMD 3HFMH 4NP4L 5E8PA 5B4MD 5TPWL 4HZAA 4AYFA 1ITBB 2G2RB 1Z0MA 5IVZB 1EERB 2J8OA 3JV6B 1A4JB 3MREB 4QF1B 3S5LG 3TVMC 4JFYB 5CBAA 3PWPD 1QPPA 2X70A 2PN5A 4FQJL 4PRIE 2AV7A 5CD3A 1WCBA 1HQ4A 2XN9D 4N8CL 3RUGF 5C08B 4MJID 3CVHB 2WINB 2PF6A 5DZNA 3TC9A 3AU1A 1INDH 3QIUB 1S9VA 1YNTB 2WUBH 2VDLL 4KFZC 1SYSA 1RIVH 3O4OC 2A6DA 3MACH 5IB4B 3MO1A 2JLLA 1PYWA 4PG2C 1N3NA 4ENED 5KSBA 2PW2B 1A6WH 5H37H 2JB6B 4UT7L 2PO6A 3IXAB 1CDGA 1S7UB 1WFTA 4Z7WF 1JPSH 4JRYD 2X41A 4HUMB 4Z7UB 3PWPB 2B8OT 3CSBA 4XPBH 3QP3A 1ZTXH 4M43L 4KRPB 1PD6A 1K3ZA 3O4LE 1Z3GL 4X5LA 1HNFA 3W39B 2A9MH 3NCJH 5IW6A 1CGSH 1RJYB 2ZG1A 1VGKA 5DS8B 2HT3D 4H26A 3KLAB 4YHML 1MAMH 2XPGB 3FRPG 1IBGH 4JZJA 2ZOKB 3MZGB 1FL6B 2VDMH 4S1SL 3C5JB 3DECA 4JGMA 2KQMA 4N0UA 3MJ9H 5DZOA 2DQEL 1T83C 3MA9L 3QUKB 1IGJB 4FZ8H 1L9NA 3B6SA 2IGFH 4Z7UA 1A02N 4JFZL 1U93A 2VDKL 1FSKB 3S3SA 2XZQH 4TVSa 1AHWC 4FQ1L 4X7SH 4Z77A 2DMCA 3QWOA 5J11B 4N68A 4JN2A 5JXEC 1PYWB 3WHE1 3NCFB 3MO1B 3NFSL 4ZYKA 8FABB 5D1XA 3RDTA 5CJXA 5I76B 5D72H 1Y6NR 3QG7H 4PS4L 4Z9KB 2WWKO 3F65A 2Q3AA 1M6OA 3OB0K 2PW1A 1KPVB 1AGEB 1YPZA 1D5ZA 5DJXA 3MLUH 3HZYA 4X4MA 3WN5A 1KXTB 5T1DH 5EWIL 4A6YA 4A2MA 4Y5YC 4NBYB 2X4QB 1VKXB 5C6WH 1CG9A 4P4KD 1A14L 2DS4A 5IWLC 3R8BB 4FP8H 4JFYA 5I18L 3OKKA 3JV6A 2G2RA 5FYJU 5A16A 5LGJB 3T0EA 2DWEB 3L3JB 1IC4L 5E8PB 1BD2A 5JW4Q 3ARSA 5GJTL 3UTSD 4YAQA 4HX1B 1N5YL 4MB3A 4V1DD 3IU3B 3DUSB 4XPGL 3HB3C 1QRNB 4L3EB 1UACH 5FM5O 3SJVB 4TTDC 4RISL 5HGHB 4NQDD 1OQXA 1LGVA 2A9NL 2GJ6A 3VA2C 4F7TA 4TTGA 4U6YA 5EU7E 5DLMH 4XC3L 4BSJA 1YJDH 4OLYH 1Q0XL 5AG9A 5E2VL 4WV1A 1IQWL 2KPNA 4LVNB 3Q6FB 4R4ND 4P3DA 1CLZL 2AEIT 5F7LB 3MV7E 1TJIH 2JIXD 5EU5A 4M1DL 1MCWW 4L29B 3WXVH 1JN6A 3BWUC 2IFFH 3KYMB 3UJTL 1E28A 1QLRA 4Y4HC 4UU9A 3B83A 4HHAB 5ACMA 3T3ME 1NKOA 4X0KB 4MD4B 1R5IA 2QADC 5IBTH 5FGBA 4JPVH 2ICES 2X9WA 4HWBA 3GB7B 3ZT7A 2CD0A 2E7CA 5GZNC 4NNXB 4CU8A 5DEZA 1S5IH 4IRZH 4ONHB 4Z6AT 4HIIA 3P40A 2OYPA 4OCYH 2I27N 2BVQB 5INDA 4L1DA 4XC1H 3T77A 4EUPG 3MZTA 2XKNB 2DLGA 2FCBA 3PV6B 4PJAF 4NO2B 3HUJA 25C8L 3VGAB 4YHOH 2FZ3A 1YEDA 5E2VH 2JF1A 3C08L 3QPXH 2AK4D 3STLA 4RZCA 5HYJB 3HC0B 3FFCD 1AJ7H 4HGWA 4G6AC 3ZYOA 3V5HB 2DQCH 4JZOA 1G7MA 2QJDA 2C4XA 1K4DB 2A2QT 5E5MA 3DARA 3EYSL 3P4LA 1L9MA 5INCB 2CUIA 4EDWH 1U41A 5GRZA 5TQ0L 3I2CL 3QFJB 4ZPVA 1EEZB 1NAKL 2VLKA 1IAIL 1V05A 1MEXL 3BXNA 3IJYB 5TF0A 3LAFA 3EFFA 1CICC 2F8XC 2YD1A 4J3TA 3U82B 2WQ8A 3V6FA 7CGTA 1WV7T 4CMHB 3AREB 4EN3B 4DCQA 4PGJA 4JKMA 4ELKA 5HPOA 4U3HA 4WU7A 5EZJB 2FR4A 3KPMB 3PHQB 3L7EA 1DUZA 4G8FB 1NMCC 4PJGE 1MCEA 2VN7A 4WNQB 3MA7B 4F15B 4LCYA 1HINH 2BHUA 5EU6A 2HN7A 5E8NB 3SGKC 4B5EA 1G6VK 4LRIC 2IALA 2CRZA 1NGQL 3AB0B 4H88L 5H94B 1XR8B 4C58B 4HFWA 3PQYD 5FHBL 5E03A 1A6ZA 1OTSC 4M6NH 2C5DC 5C0NC 4LHUA 1NFIB 4TSAL 3KPRA 1M71B 1CLOL 3HNTH 3S3PA 5F7UA 1BPVA 2V17L 3RRQA 1TCRB 3L5WB 1L7IH 5E94B 1ZA6A 4NZUL 4N8CH 5D2NC 1QA9B 3DVGB 3NCJL 4J3SA 3DX7A 3OGCB 4KRPC 1R3IH 3GIVA 1WTGT 4LPWA 1MAJA 3DX6A 4HUNB 5SWSE 4ODXB 2VZVA 2HH0H 1I8LC 3D85B 2DMKA 5MENB 4PRPD 5JIHA 1LO4L 2DYPD 4MVBD 3MV9D 3V6OA 3LIZL 5ICYA 5IIEB 3RZCD 5DFTA 4DQOL 3QEQD 1TVHB 4Z18A 5I1AA 4ODVH 3P9MA 1BBDL 2BNQA 3JWOC 3MLUL 3RBGA 5JXAH 4WFEE 4FFWD 5DHVA 1JP5A 3CC5B 2ZPKL 5IJKA 2DLHA 4FFZH 4NWUH 2OSLA 3RL1A 3JXAA 5HVHB 3T1WA 5MERA 4XVJH 1OTTC 1OQOA 1NBYA 2X7LA 1U8NA 2L0DA 3NFSH 2Z92A 4YPJA 1OAUH 3GMQB 3P9LA 4DFIA 1OPGH 5D1QC 4ZAKB 4K3EH 1U8QA 1BFOA 5IVXB 5ALBL 1HEZA 5SWQB 3ARVA 1VESA 3UYRL 1AGDB 5D7SH 4YJZL 4JRYA 4W81A 1TJIL 4JN1L 3RGVA 2VXQH 1X3DA 3LQZB 2BVPA 4R97B 2E8YA 3TYFA 1IVLA 4OCWL 1H8OA 5HD8C 4RIRB 2GT9A 4I5BB 1U95A 2IH1B 4X6FA 2OL3L 3X14A 1TITA 2IBGA 4GRLC 3REVB 4NN5C 1CDCA 3U9PH 3FT3A 3V0WL 4X8JB 3V4VH 3JTTB 5CCKH 4ZODA 1A1NB 1T2JA 4I0CC 5C0AD 5AG8A 5DHVH 3U7WH 3WLBB 3WDHA 4APQD 1J5OH 4XNUH 3S4SB 2ADGB 1NLBH 3IKCB 3BE1H 3U30C 2Z4QA 5DJZA 4DK6A 4R4FL 4WIQA 4ERSH 2R4RH 5EU3A 4ALAH 4HPYL 5DJ8A 4LHJB 1A3RH 1BFVH 3CJJA 1NC2B 4F7PB 4ZTPH 3H9HB 1F4HA 2VERN 4QRRB 3O3DB 1BJ8A 1I1CA 3KNBB 4JCLA 4PJIB 2IANE 4JRWA 4OZGB 2Y7QA 1FVEA 3O6LH 1CXLA 3NCYS 3AB0C 4PJXF 3WSQH 2IH3A 4KK6C 4X6FB 3D85D 2A38A 3DO7B 1T4KB 4MD0A 4HWEL 4PJCB 3D0VA 4OD3L 4DUWA 5HI3C 3F12A 5DJDA 5TF1H 5A2FA 4PJBE 3ULUC 3JV4B 3N1GC 5KTEL 3MJ7B 2ICWJ 1X4XA 1YMMD 3ULUL 3AREC 4Q97A 2Z8SA 2AEQL 2MWCA 2JCCE 1JF5A 5ESAA 5F8RC 4HMEA 5BW7A 5D7LE 3FCTA 4PRPA 3NBNA 2ZUVA 2XQYG 4NN7C 2P47B 5D2LE 5C0JB 4M7LT 3QCUL 4HWBL 2XG5A 3V4PL 4UTBH 4PRID 1A1MA 1AD9B 3VJ6A 2HFEB 2IGFL 2J8UA 5F7YC 3P9LB 3RBSA 3QXDA 5KVGL 4QEGA 1U8NB 3ARGB 1CQYA 4UB0H 1S9KC 2OP4H 3JWOL 4LPVA 1OT2A 4HKZB 5E9DA 4PJGA 5ICXA 2BVOA 3CPLB 3QXTA 3SQOH 4NN6C 5E2TL 4U6HB 4HK0B 1YDPB 4PJHA 4O5LH 1SBSH 4Q2ZA 1NC4A 3SO3C 4G6KH 4PP1C 1VEOA 2VL4A 3GIVB 3QHFH 4YHYB 1QSFB 2ESVE 1MRFH 5GZOC 3OGCA 2Z0BA 4ZXBD 5DD3H 1T0MA 4MAYB 5C0AB 1DQTA 5C9JB 4HV8B 4LLWB 5E24E 2R0KL 2DQDH 4F2MB 3EJZC 1SQ2N 3LN4B 4XC3H 2R0LL 4QRQA 4N90E 1R3JB 2BHZA 3QQ4B 1CFNA 1MJ8L 1ND0B 1IGYB 3TIEB 1T89A 4DN3L 2VZUA 2DMBA 4BYHA 5FF6A 2FWOB 2G9HA 4B0MM 1GZPB 1DBKL 1MI5E 3SDDB 2YA1A 4WNQA 1TETL 1ORSA 4PGZA 5TQ2H 3WD5L 3L7EB 2P8PA 3KPMA 1FL5B 1U2HA 2P5EB 2D0FA 1TQCB 4V1DE 3X17A 4OLYL 4J4PD 3IDMB 1ZHKB 4XP4H 3UTTB 4I77H 1JPGB 4MLSA 2ZSWA 3VW3L 3IVKA 4Q0XL 3BXNB 1G7JB 4WCYH 1RZGA 1LNUB 2VLKB 3BKYL 4XMPH 1PJ9A 4FOMA 2GEEA 5T3XH 1UYWH 4YDJB 1BEYH 3DURB 3ARDD 5J6HA 2DQDL 1AH1A 1U8MA 4PJFF 4G6FD 3VXMA 5C86A 3FMGH 4F37K 1YMMA 2FL5A 3EO9H 4JKPL 1E4WH 3MV7A 4J3OC 1CL7H 3OPZL 3Q5YA 5ETUB 4U6VH 4YH6A 3TWCL 1DBAL 4V1DB 4YDVB 5ACZA 2G60L 1IT9H 4BH7B 5ITBL 1QP1A 3JWDH 4UBDC 4LEOB 1A6PA 2AAVA 4PREB 2OXGA 2ED9A 3IETA 3DSFH 3OXSB 3BI9X 2H41A 5INDB 3G04A 4X7TB 5T3ZL 3IDUA 4D0DA 4S1DC 3O6FA 4HLZG 5DRWB 1Z5LB 4DTGH 5F9JA 3G6JB 3B9KD 1QFWI 2ITCB 4LASL 3SDCC 3ZE1F 4NT6A 1BF8A 3GB7A 3O3UN 4OGAD 3OKMB 1ZANL 2GJ6D 5HGGS 3CDCA 4OZGE 4K8RD 1WJ3A 5IB1B 5J57B 4GBXD 1WWCA 3SCMA 4NSKA 4HHAA 3ZE2E 5I8CB 3MJ9A 4MXVF 4U0RC 2CUHA 1ADQL 4G8EA 1LMKA 2NXZB 3GSNB 1LEKA 1J1OH 1CZ8L 1SEQL 5C08D 5F9OL 3EYUL 5GGSY 5EU5B 4QT5A 2JK5A 5B4MC 5JR1L 1YPZF 3GO1L 2G60H 5BZWB 3VXMD 3LV3B 4Z7UE 3GJFA 3TGXA 1U8KA 2NY4C 2ZCLH 4LEXL 1A5FH 4KQ3L 5HVGB 1J7VR 4K07A 2V2TB 3C2AH 1KFAL 3DUSA 4M6ML 2XWBB 1AQDB 3FRPA 2YWYA 4TVPD 5TQ0H 4YPGA 5EOTB 2VMFA 1HYSC 2R29L 4K3JH 4KROB 5HHVH 2DIBA 1MPAL 4HD9A 1BZ7A 3VXTA 3FO9B 4U7MA 4HMCA 1E27B 3UJJL 5I1GL 3PHOB 3O4LA 5HVWA 1OL0A 1JPFA 3GBLA 4Y4FC 1IT9L 2APTA 3U1SH 1SHMA 1SJEB 1TTUA 4DK3A 3G5YA 3IJSB 4ZUSA 3ARBA 3AS3A 4M7LL 3CDYA 4UB0L 3RDTB 3STZB 5EO9A 4ZYKB 2CLRB 4JN2B 5CP3H 4H20L 4L4VB 4GXUM 4UQ2A 4JB9H 4Z77B 3NIGF 1XZ0A 4GUPA 3KPPB 4OGAC 3CMGA 1U93B 2ARWA 4BH8B 1N59B 2J5LB 2I5YH 3R1GH 4GQ9H 4JPIA 3OAYK 2EDRA 1ZXQA 5J06A 4OB5L 2ADFH 1HI6B 2KZWA 1X5FA 1YNLH 4Y8DC 5JA8B 1L7IL 3C5JA 3MRMA 1KV3A 5C2BL 2B4CH 4Y1AB 1P7KB 4F9PA 3W0WA 1YUHB 3UTPD 5GRYA 4LFHD 5EUKB 5H2BB 1JPTH 4R2GB 4ODWA 5CLWA 1F58H 3QUZD 4KC3B 4PY8I 3SEPA 4ZAKC 3PWPA 1EZVY 2D9QB 4TN9A 2UYLA 1BFSA 1MVUB 4WHCA 3MRIB 1MLCB 3GSRA 4LVOB 5IBTL 1RIUL 2PW2A 4R8WL 4JM2C 5F9OH 1RJLA 3C5ZB 2NXZD 5CIPA 1WZ1H 3UBXG 1SYSB 1RJZB 1URLA 2QL1A 4EI6A 4WFGE 3S4SG 3NAAL 5DD6A 5EC1B 5DJ0B 5HYSA 1FYTA 5MEOB 5AZEH 4Q74A 5EUOB 2ZOLB 5EBMA 3BDYH 2IMNA 3DUUB 4QTHB 4D9LH 4K7PY 3VXNB 3TBVA 2PXYC 3A67H 2GITB 5D9SA 2YA2A 3L9RB 4DN3H 1KYOJ 3DMMA 4YHMH 5LBSH 4CN6A 4BUGA 1YEFL 1NGZB 1IGML 4YXHL 3HMXL 3M17A 5I1IH 3UEZA 5L2KB 1T21A 3D25B 1JPSL 4P23A 3VXRA 3EO1B 5I74C 1MREL 1RZ8B 2W65A 2ICEB 2D03H 1C5DB 1EHNA 5DUMH 4OLVL 3MRDB 2Y6SD 4GW4B 4Z0XA 4MNQA 3NIDE 3I6GB 4HUVA 3P4OA 4OIBA 4O51B 2A83A 2L7JA 4MVBC 4PP1D 3QG7L 4YC2B 3ULSB 5ACLA 1IL1A 3D39A 1J11A 1UM4H 1N4XH 5K9QG 4X6DE 4QCIA 5F3BB 5IW1B 5C7XH 1JZ3A 1ACYH 1BVKA 1R24A 3OF6A 5EZOH 5FDWB 2J8UF 3QFJD 1N7MH 3EOAB 5EZLA 5I1HH 3LEXA 1EO5A 4DGVL 4PJAB 4NCC1 1F3JA 2YD6A 5TDPA 4KVNL 5L8JB 5C0ND 2OI9B 3LIZH 2RR3A 3LN9A 4PIRF 2AQ1A 1KEMH 4JRXA 4LHUG 1FORH 4JFQB 4U6XB 4MQXC 4GO6B 1DVFA 4MA1B 4S1DD 2ZJSL 3BT2H 1FYTE 2ED7A 2ADJA 5TGBA 2AJZA 4AL8L 4L8SC 1A3LL 2Z35A 1Q9OB 4KKLD 4I13B 1U8IB 4GSDH 43C9A 5JIKA 1UJ3A 4NN7B 2D7PA 3QWRA 4LCWA 4ONOA 4PJ5A 3E6FB 5GJTH 3S5LB 4XCCL 3H9SD 1WFUA 2ZUXA 3BKCL 3QDMD 4DFHA 4NQCB 4KROC 1A2YA 1HCVA 4MDJA 2BSRA 4EQ2A 5C0DB 2WUBL 5EFIB 4O5LL 3SGEI 2HJKA 1GAFL 3L1OH 2VXSL 4YBQD 4JZNB 5T1LA 1MUJB 4ZMAT 3GSUB 1K8IA 1EFXB 4HT1H 4OI9A 4NZTH 1IEAB 5J89A 5JPMA 3VWKD 2IAMB 3MV8E 4G43A 1ZT1A 3TJEL 1GGTA 4ZUWB 1WBYB 4GRLD 4KV5E 2WUCH 3ARUA 1KCRH 4YZFE 5F1IB 4ZUWA 4S0TD 5CJBA 1NUNB 3MXVL 3PGCB 4P2QA 1NANH 4NUJB 1BWMA 3GSVA 5C07A 5C9KA 5IMKB 4K7PL 1S7QA 2V9TA 5B8CA 4MYWB 4S1SH 4D8PA 1N6QH 5T1LB 4JZNA 1UXSB 2IBZY 3EYSH 5EFIA 2Q8BL 1T0NA 2BCKB 4XBPA 5FO7B 4KJYA 2EDHA 4BZYA 3RNQB 3MLSH 5C0AE 1A3RL 3DVNB 1MF2H 3WO4B 4NJAL 4G9FD 4AL8H 2H8PB 5HHOB 2R0LH 3NCMA 3ZDZE 4UZGA 2UWEF 3S5LA 4K9EC 1CFTA 3QJHB 5F89A 5K9KA 4LCWB 4PJ5B 1VSCA 1NDMA 4LGPB 5BVPL 3VXRD 5C8JB 3E6HA 5J0BA 1NMCB 3RWIB 2AJZB 4P57A 4N5EC 1I1YB 1UGNA 2O61A 1EEYA 5IBLD 3FQXA 1HSBA 3LS5L 1X5XA 4UT6L 2FYYB 3CH8A 3MJGX 3FQRB 3LKPB 1DN0A 3VCLB 3ZTJH 2Z93B 4MD5A 3SE4A 3EOAA 2B4CC 5F97E 5FDWA 1DBML 5KVEL 3ZKMC 2I07B 3WKNA 3EYOA 3UPRA 4UOW1 5LGHH 3Q6GH 2AJ3A 1ZKAA 1JNLH 2R2EB 4K7FA 2QHLA 3MLWH 2MCG1 3TO4C 1MQKH 2EYRA 2QR0B 4LLAA 2GAZB 3PWNB 4LL9A 1KJVA 1ZGLB 4OZGF 4Q9BA 3DTXA 1HINL 2NW3B 1OGAA 2FJFB 3CU1A 4LLUA 5SX4H 2HFGH 1TZIB 4KH2A 3MRFA 1H15B 5JPNB 4MNQB 3CFEB 3GJEB 3U48A 1MCJA 5EC2B 5BCAA 2C3VB 4F3FA 2W65B 4LAJH 4NO5A 4YHPA 1FFNA 5HJ3B 3EO1A 3VXRB 3VI4F 4TRPH 4XVTH 2VAAB 3C5ZC 4JO2H 3QISA 4KZDL 5FKAA 1VGEH 3T0AA 3R06B 4M62L 3RPIA 5FUCE 3WNKA 4HCRL 3VXSB 3SE9H 2R8SH 4FQXB 1NGZA 4XNQA 4IRSA 5GGQH 3GJFK 1OM3H 3MLTB 5GRJL 3F6IA 3WE6B 3C6SA 3C8KA 4U1IB 1WBXA 1ZSDA 3DV6B 1QNZL 4XBEL 1OPGL 1JYWA 2ENSA 4WW2A 3T08A 5EBMB 2NLJA 3Q1SH 4LLDB 4OZFA 4P9HH 5KOVC 1D5XB 1YNKH 5EULV 5FGRA 4YQXL 1QFUL 1C12B 1HHHB 4NRZA 4EI6B 2EDKA 1A7PL 1KUMA 4MJ6A 3SGJA 5J3HC 3E0GA 1T7VA 4CL7A 4XNUL 3UPAA 1ONQA 2V9QA 4FQQA 1YQVL 3FB6B 5EIIB 3UO1L 4PJ9D 1YEKH 1Z6JT 4HWUA 2KQNA 2UYLB 4O2EA 4CVXB 12E8H 1NDGA 4GAGL 1JBJA 1CK0L 2QQLH 4MQ7A 4P4KB 3T0ED 1CGSL 5ICZB 1BFVL 2G75B 2MTPA 1RI8A 4GW1A 1FIGH 1QFHA 3U0WH 3FT2A 1YC7A 4MZ3A 4NQXB 4ODWB 1RUKH 3HE6D 3WV0A 1ZMYA 1WC7A 4N8VG 5IR1B 1RFDL 1TVBB 4NQDA 5EH1A 1YUHA 3QIBA 5I1GH 1QBAA 4YR6B 1IAII 4LFHG 1MHEA 3HI6H 1DANT 1OAZL 3OZ9H 1GZQA 2LV4A 2OMNA 1OLZA 5DQDH 4MHHG 3NABH 4UOJA 2M8XA 5I1LA 4U6TA 1BAFL 3HR5B 4P2QE 3X13B 3RWHA 3PP3H 4LSRL 5HYSG 4X7EC 5EU7C 2ERJB 4PJEA 2P5ED 2IBZX 5K59E 5GGTL 4OUOA 2W0FB 4X80H 3STZA 1P4IH 5GS1C 4DGYH 4Q9RH 3QDGB 3HCVA 1MFNA 3RDTD 1FGVL 4OD3H 4OF8A 2BOCA 3NIDF 2EDFA 4OD2B 4XB8A 5I8EB 5HHOE 4NO3B 1SJEA 3BGFB 1YZZA 4XX1E 4U1NA 5IUSA 4GRLA 1IQDB 4HSQA 4HCRH 4PJ8D 3F58L 3PHOA 3MUJA 5JXED 5HI5D 1G7HB 2GSIA 5DO2D 2KBGA 5BVPH 4GMTH 2BFVH 2ILLA 4MA3A 3IYLW 4MWFB 1RHHA 2IPTL 2CRMA 1SJVA 4NJ9L 4CRPA 1FJ1A 3OKDA 1FNLA 4GRWF 4YGVA 5GGVH 3WFCH 5IT2H 1U8LA 4HZLA 1P2CB 1KCUL 3L3GA 4KI5E 1U8JA 3FFCB 2MHAB 5F6HJ 5B3JF 1Z9MA 4FFZL 3QNZA 4MS8C 1AQKH 3U4EA 1JNNL 4OJFL 3OKEA 5HHXH 5JUEL 1X5HA 5BV7B 4I0PB 1ZT7A 2NCMA 1S78C 5E6IB 5FKPB 4L9LA 1XIWD 1F4XH 4TNVF 5LGHL 2GCYB 2PKDA 1J05A 2KUTA 4G8EB 4TOYH 1W0WA 4GAFB 1U3YA 2F58H 3ZMRA 1ZGLM 1SBSL 3P9WB 1TXKA 2X1OA 1FNEB 4JPVL 5FM5M 4C55A 3VWJC 4KY1H 3OKMA 3ZT6A 2NY2B 4M93C 3SJVD 4OIAA 4M8QA 2DYPB 1I7UA 3AMLA 3O6FB 4PJDE 5DRWA 5A43C 3BP7B 3BEWB 3NA9H 4X7TA 1W8NA 4C56A 4EXKA 3W9EA 3BGMB 3IDYC 4ZO6A 5LAXB 2WMPA 3HZKA 3RWFA 5CKAA 1S7RA 2C3XA 1BM3H 1CD8A 4EI5C 4AY0A 2VDOL 3BQUD 5BRZB 2DLIA 1IGCL 4MQXD 4NQTA 4FQCL 3IT8D 4HIEA 1HKLH 3AXLA 4JPKL 1BQHG 5D8JH 3WS6C 1D9KA 3GI8H 3MV01 5ETUA 1NAMB 9CGTA 1JWMA 5LAXA 1UVQB 5F3HB 1A4KB 3VWKC 3CXDL 3RU8H 3GSNH 4I0PD 4U1LB 3BEWA 3BP7A 4GXVH 4OV6F 1U8MB 3MRGA 5CZVH 4IRJC 3LMJH 1J0ZA 5T5FH 5D7JD 5SX5K 4JDTL 3JV5A 3QNYB 4APQC 4ZFFB 3AM8C 6FABL 3HRZB 4PJFB 1WVZA 1G7JA 4GQPH 1G7PB 2JJSC 4C59B 2ID5A 1AD0A 4TULL 3PABA 3LKRB 4JRYE 5FFLA 1J0IA 4DEPC 1Y6KR 2Q7YA 4OZFH 5DJCA 4PV8A 2GCYA 5L7XL 4YQXH 4HF5H 4L5FL 4Y19B 4I0PA 1V7MH 4KKLC 3OQ3B 3L1OL 4MCZB 5DMJB 1BZ9A 1NMBH 1AO7D 1IGYA 3TIEA 3G6JE 1KCKA 4Z7UF 1LP9A 2MHAA 1U8JB 4JQVC 1I3RA 2YPVL 4WRLA 1P2CA 1HHKB 1U8LB 3O6LL 4HC1L 4L8BA 1CBVH 3B2VH 1ZLWH 4PB0H 2VOTA 4RX4D 4R2GD 3ZHDA 4F2MA 2BNQE 1CXHA 2EIDA 4IOFC 5JQ6H 5LWYL 2DM4A 4MWFA 3TH4T 1MVFA 4AT6B 1EEUA 1FNAA 4BFEA 4DTGL 1YJDL 1C7SA 5C0AA 3GJFH 5IFJB 3SDCB 4MAYA 3RWDA 1EO7A 1G7HA 4N9GB 4WW2F 3EBAA 2VXUH 1T04B 4XMKL 1EEQA 3IDXH 3VDCA 4X9BA 5DMGD 1BIIB 1BLNA 3R0NA 4EUPH 2BOBA 4FNLH 2R4SL 3QUXA 4U1SA 4JE4B 3S37L 2F5AL 3C09B 1YQVH 5EN2B 3C6LB 3T8XB 1VHPA 3TH2T 4XXDB 1Q0XH 4JFDA 4HKZA 1DQJA 3HR5A 4Y5XA 1NCDL 4LNRB 4OFYD 4HGKC 3KPQA 5I1LB 2Q7NA 1XH3A 2OJEB 2B5IC 3G5VA 4Y16A 3VI3F 1F2QA 4Q9QL 5E2WL 1KCSH 2BDNH 1QQDB 1F3DH 2E6JA 1CI5A 1UM5L 3ULUD 1JYXA 1EV2E 1KLGA 4YR6A 5C0JA 2ZPKH 1Z9SA 4HG4J 1G6RB 4Z95L 4I3SL 5KVFH 3C5SA 3KR3H 1P9MC 1RUQL 3MJ7A 5F9WB 4U49A 2BNQD 3AY4C 4P49A 4ZS6C 1S5IL 2X4UB 5GGVY 3Q5OA 1ADQA 4Q9RL 3ROOB 3FQWB 5BO1L 3MQIA 1T4KA 1VDGA 2ORBL 4PJEF 3GFUA 3ET9F 5EIIA 1T7WA 4M9PA 2I60H 2OL3B 2P4AB 4YHKH 5HI4C 3B3IB 4OQTA 4HLZH 1EDQA 2R2HA 1YEHL 4ORGB 3MGOB 4XHJC 4ZUVB 4KVCL 4DVBB 5C0GA 3ZKNC 3TO4B 4UT7H 5E1AB 1CD9B 3MPCA 2ADIB 4RWYH 1JGDB 5HDBE 3UAJC 2UWEA 1KN2H 3ULVC 1WF5A 5F88A 5AD0B 3B9DA 1RUAL 2VISA 4M7LH 3HPJA 1IGIL 3PWUB 4OUUB 2B20A 4OSUH 2GUOB 3HUJE 4K9EL 1T66C 3O81A 3SO3B 5DEFA 3VWJD 5D7LB 4LIQL 4GKZB 1HK6A 5FKAB 1VADA 4TUJB 3ULUF 4OLZL 4PRDA 2P5WB 3QEUB 4DN4H 2DM7A 4C56E 1FFNB 5T1KA 1AC6A 4NO5B 1RULL 3M8OL 4F3FB 1I9RL 4U1JB 1II4E 5AWNL 1PG7X 4MMXC 4BZ1L 3KJ6H 4H1LA 4NQSA 2XYCA 4RA3A 5JPNA 1U3HB 3MRFB 2NW2B 5C0FB 1NEUA 2B4CL 1YMME 1TZIA 2AJSL 2O26U 3IDGA 5EBWB 3UZVB 3OTTA 4JPWL 4M7JH 1I4FA 3EO0B 3GBMH 3Q3GB 3DTXB 1S7TB 1YEEH 2VLJD 1HEZB 4TQEH 3ZL4H 3LPGA 2LU4A 1EH9A 5EZIH 3VDAA 2R2EA 4K7FB 4S11A 4BQBA 4DKEH 1EFXD 2NY6D 2XY1A 3JBG7 2FX8L 3QSKB 3B9KC 4MJ5B 5T33L 1PSKL 1P1ZA 2LFGA 1TZGL 3LKNA 3HMXA 4ZQKB 5KJRH 5LJYH 5JDSA 1F8TL 4QHUA 1BECA 1LHZA 3IDJB 2FYYA 5KSAD 3T0EE 1EBAA 1ZANH 1UKQA 1CFVH 1NAML 4QXUL 3AS0A 1R0AL 2OJZL 3QRGH 2YUVA 5DHXB 5FUZL 3CXDH 4QRRE 4EIGB 3WLWC 3P9MB 1VENA 4YBLB 1KEGL 1YPZE 1I7TB 1DEEA 1YYLH 2MOVA 1YC8A 4NKQB 3S96B 4YEFA 3PWPE 5DJAB 4PJ7B 1XGRA 4W70A 3HPLB 1W72L 3RL2A 5EBLA 2UVEA 1KENL 1LDPH 3LRHA 5HHOA 4XVSH 1OTUD 1I1FA 1UH4A 2JKXA 2N4IA 1WT5A 3GRWL 4HW6A 1TFHA 4QTIL 3V0VB 3T2NH 3DX7B 4GBXC 1YN6A 3W0WE 1FNHA 1RZ7H 4PRHA 4EN3C 2A77L 3VFMA 4E5XB 1SYVA 2B7DT 4PGCB 4HJ0C 1UXSA 1EAJA 4HLJA 1V7ML 1NFIA 5C7XL 3HI5L 4XP1H 4HF5L 5A1AA 4PJHE 4U3XA 4HFWB 3F7RA 5IHBA 4F7EA 3PGCA 5GSRA 2AI0H 2WP3T 4IRSD 4AEIL 4XX1G 4LSPL 3WIHH 3RY4A 1NC4D 2DQHL 3S35H 3P77A 4KI1A 1S7XB 4OLWH 5CS7A 3ZKXC 5I2IB 5JMOC 4G43B 3HAEG 3PHQA 3T3PE 4NQED 2YRLA 1IEAA 4BZ1H 5CCKL 2HJLB 3ES6A 1EFXA 4MAUH 1MUJA 3O2WH 3NN8A 4ZFOB 3MGAA 1J88A 3LSOB 4QKXB 3KPNB 1MWAH 5HYIA 2XA3A 3IDXL 1MNUL 3TJEH 2FJHA 4OCWH 1ROWA 4P9MH 4Q9QH 5BV7H 5D1QA 4ACPA 4O00A 2JCCA 3GMLA 3IF1B 2ZUTA 3DPBA 4HGMA 3RVUD 5C0CD 1GAFH 3V79C 5EO0B 1A6AB 4PRIA 2NY0D 2I24N 4KAQH 2VXTL 1WITA 1PVHA 5E8EA 5CEXA 43C9B 1IGTA 1RU9L 5JOFB 5ADOL 1ZLUK 4GW5A 4XP9H 3HC0A 3EOTH 2N56A 2RHEA 5EPMB 5DZLA 5FA4B 2AJUH 1CFQB 3P73B 4JM4H 1H5BB 4NRYA 4JO4L 4PGBA 3HE7D 4HJGB 1QSVA 3F8UB 5KSAC 4UNVA 3KPLA 4FQLH 1ZT4A 3O8XA 4WFGD 3VH8B 1YYLL 4GXUN 4G80B 2YD4A 4FQ1H 5C3TA 3DX9A 2LTQB 1RY7B 4M6AA 2D7QA 4HUKB 1R3KA 4U7KA 4L9DA 3TZVD 1FNSH 3SDXF 2E27H 2YA0A 1FNGA 5I8KH 2DQHH 5C6TL 3MROA 4N0YH 2BVTA 4O51A 2IEPA 3P3YA 3HE7B 3KYMA 4Q6IA 4JVWA 4YHNA 1P4LA 1ZLWK 3I6GA 1ZV5A 2VDNH 2BRRL 5MEPA 2AEPL 4PBXA 4R0LC 3MUGA 3ZE0E 1N5YH 4IOIB 1FLTX 2DIJA 1QHPA 5GHWH 2XIDA 2W9EL 2E9WA 1LE5A 2H6PB 5L2KA 1EGJL 1RUML 4OV5A 4HIXH 5HGHA 5JNYB 1CDUA 3QI9C 1DE4A 2NXYC 4B41A 2VQTA 3BUYA 2WV3A 3IU3A 3TA3C 5J1AA 1AKJB 5EZOL 4ONGH 4YX2H 4YAQB 4JDTH 5EUOF 4KKAD 2GITA 2CLZB 4LNVA 3T0EB 1KC5L 5A16B 3GM0A 3TBVB 4DVRH 5LGJA 3BH8B 1G6RL 1L0XA 3OKKB 1SVZA 3ARED 1KB9J 4OFYA 3OJ2C 1G7QA 4ZOAA 4R96B 2ZNWA 4JFDD 5DK2A 1AGEA 1YPZB 5TE4L 1R5VA 2X42A 3C9NA 1CD1B 4DAGL 5DD6B 1S3KH 4OM1H 1CXIA 3DHJA 1AE6H 4QRTA 3W5MA 4W6YB 2HFGL 1HXYB 3UJIH 4YFLI 5C0RL 4NOBA 1W0YT 5T5NG 1AXSA 2R8SL 3VFTA 3QCVL 1RJLB 4LPTA 1ZOXA 1VPOH 5KS9B 3UZQA 4WW1B 1RQ5A 2XTJD 3GSRB 4IS6B 4U1KB 2AP2A 2YEZA 4YEEA 2R15A 4J4PC 3B9AA 3QULB 1IGFL 2ICWA 4DKEL 1DN2A 2CIIB 4PG9B 3UPCA 1FN4A 5SWSA 5IHUH 4F37F 4RBPH 1E0OB 4RFEA 1D5IL 4Z7VB 3ZDXF 3SKNB 1I8MA 4D9RE 5JW3L 2MMXA 5GGRY 4P99A 4Y1AA 4RFEB 1HXMB 4Z7VA 4H26B 3REWA 1KSRA 5DS8A 3QIWB 1VGKB 3OJMB 3C6LD 1CYGA 5L0QC 3DMMD 3ARXA 1OB1B 5E8DL 1FE8H 3L3DA 5DMIH 1N59A 1VGEL 2YPLE 4KKCD 4NQEE 5T3ZH 2XZCH 2IPKB 1J18A 1KTDA 3IXAA 4PY7B 2J1KA 4IS6A 3WNMA 1ORQA 2DWDB 2GTZB 1A9BA 5E9DE 1N3NB 3DXAD 5EU6E 5KSBB 3SBWC 3LRSB 3BKYH 2A6DB 4XNZB 5BJTA 5ITBH 5I6XC 5FCUL 4OFPA 4WFHD 4BSWB 2V7NB 4IRJD 4Y2OA 1U58B 5LXGH 4ZFZB 1MJ7L 4L8CB 1CD1A 1NUDA 2YPLA 2DKSA 2EKSA 4KTDH 4WI9A 5DK2B 5D70L 1HQ4B 1WCBB 1A14H 5CAYB 1RMFL 2XTJE 5DURD 2VLMD 4G6AD 1SVCP 2KDGA 2VXVH 2WIMA 4LSVH 1HH9A 1A4JA 2VLKE 2JJTA 3MSPA 3FO0L 5DYOB 2FHFA 4O2CA 2P44B 3C60D 3HMXH 4X6CB 1AKJA 1UACL 4HEPG 2ATPA 2EEDA 1P4IL 1NL0L 2B1AL 2BSED 2MSPA 4RDQF 5D7JA 1JZ4A 4ISVA 4GMSL 4ZNEE 4OV5B 4Y4KD 1K8DB 1GSMA 3NGBC 2GFBB 3T4AA 1CIDA 1VFAB 3KPSE 2AJXL 5CBEA 5BZWA 2EDXA 5DXWA 3ZDZF 3BESR 5KS9F 1AHWA 3MUGB 3WFBH 4RQQB 2XV6B 5J4MA 3EOTL 2NY1D 4Z78A 1XT5A 3BP6B 4L3CA 1SJHA 3TBTB 4XNXH 4XP5H 3MRBA 1NCCH 3LQAC 1FYHB 4LEXH 1P4LB 2JELH 4I18C 4X6DA 5J7CC 2KKQA 3LQAL 2V2WA 1PY4A 4RRPA 3L6FA 3BQUB 4X7DC 1J1XH 4N5UA 3ZE2F 3KJ4C 1QEWA 3MBEA 3EYUH 1J12A 4C56D 3T4YA 3MCKB 1A7QL 5HSFA 3O6FC 1INEH 5F9JB 5FGCB 4YZFF 3ESVF 2JB5H 3FAXA 5DD3L 4G80A 4K8RC 1LK3L 3OXSA 4MQSB 4Z7WA 3FN0L 3HLAB 2ARJB 2NX5D 4HJGA 1BVLA 4RMSA 1KNOA 3LZFH 2EE2A 2HTLD 1AQKL 3BZFB 4KTYA 4C54A 1IEBB 4D0BA 6CGTA 1MCBA 2VXUL 4FXLA 4R7NA 1A7OH 3D9AH 4CNIA 5BMFL 2ZKHH 1JV5B 2EDWA 2DBLL 2CO7B 1UM6H 2DQGL 4YHIA 4U33A 1UFUA 3IFLH 4H0IA 3CVIL 4ZOCA 1B6DA 3RX8A 1FZMA 3MRHA 5DR5H 3R0MA 4H0HB 2P24A 5HHNA 4FQIH 1E4WL 4PLJC 4EJ1C 2Q86B 1TZGH 1DQML 2HTLC 3IVKB 5D6DA 5ESVB 7FABL 5KW9H 3ARDC 2ZUYA 3BP5A 5BRZE 2YD9A 2P5EA 4FTVB 1KJ2A 5FM8A 3P11H 4P2OD 2WBWB 1NL0H 2OR9L 5I2IA 5FYJD 2VR5A 2D3VA 2FD6L 1VA9A 1FO0L 4R4BB 3RPKA 5I30H 1RHFA 3OV6A 3QXVA 5HYQA 3MRJA 3ARBC 4L4TB 2VDKH 3BO8B 2F58L 3GSXA 3S98A 4OCSH 3TIDB 1CL7L 3OPZH 2VR9A 3EJJX 1IKFL 5GSRB 1MCHA 3OG4B 3VD7A 4W4NA 1DQDH 3MV9B 1WBZB 3GK8L 3BKJH 4O9HH 2WQRA 3LN4A 1D5BA 2P48B 1LK3H 4XTRC 1FAIL 3BGAA 1S9WA 3WIHL 1HDMB 1E4XL 2AK1L 3BH9B 3SOBL 5DLML 5IKCB 4PRHB 3RX5A 4EUPA 4QYOA 3LKSB 4Y4HD 1JMZA 1T2QL 1V3JA 2NR6D 4G8IB 1NC4B 3RL2B 2K7QA 4IJ3C 2YPKA 1KJ3H 4NO0B 4DKFL 4JY4B 4YLQT 4AIZA 4PGEA 5C0EB 4CBPA 4HC1H 1CE6B 3OR7A 4NUGH 4ZD3L 1AR2A 3RTQD 3SKOB 1I8KB 5BVJA 1TZHA 4OCSL 4MS8D 4G6JL 4LKCB 1T22A 2OR7A 1OSZA 2M26A 3T0WA 5E2UH 1X6LA 3IDJA 4Y5YA 5CZKA 3ARGA 5FGSA 4LCCB 4PB9H 4YDIL 2QSVA 4CVWA 1IGMH 5DQ9A 4WHYH 5FV2A 3LKNB 2J6EL 3EDFA 3RTQC 3I02B 3VWJB 3QHTC 2XZAL 3BHBB 2WBJC 4Z7VF 1YEGL 1GCFA 5C92A 5D1ZD 4XCYA 35C8L 4PLKD 5J6GA 3UC0L 4PRHE 3WUZA 2D03L 4AEFA 1TPXC 4FQIL 3MRRA 5C0CE 2AXJA 5DA4A 1X5LA 4RNRA 1I7ZA 5EBWA 3CK0H 4WV1C 2HFTA 2XA8H 4XCCH 5I8OL 3PWLA 1U3HA 1WFOA 5TE6H 5EOCH 4P5TA 5EZIL 5T3ZD 1DFBH 1HZHL 3CDGB 2GSGB 2XWTB 2VN4A 1I1RA 1FVEB 2Y7QB 4OZGA 4NRXB 1JWSB 2ZJSH 2P5WA 4QRRA 1CE1H 3C08H 4LSVL 2UVFA 1B2WL 3BYYA 4Y2DC 1NC2A 4F7PA 2CXGA 2YD2A 2CO6B 1A6WL 1NGWB 4R3SA 1EHXA 5C09E 2O5XH 3NA9L 1OGAD 3NA4A 1P7QA 3PGDA 5IBLC 3PWUA 5CUSH 3X3GH 2D2OA 2Y5TB 2NTFA 1T7ZA 5CJOH 1X5GA 1RIHL 2FGZA 3ZDXE 4OF0A 4LPXA 1RIUH 5E1AA 4PTTB 1DUYB 1W72B 4HKBA 4DVBA 3VG9B 4IOSD 2VXSH 3JTTA 4P46A 1UZ6F 3SDDD 3UYPA 3O0RL 3VFWB 1LP9F 4M6NL 5L8LB 3B3IA 1MCCA 5ENWB 1E6OL 2DQEH 2VDPL 1FO0B 3U79A 1U3JA 1BGXH 3TYFB 3VFOA 3ARGD 2BVPB 3MXVH 4H5SB 3HHRB 3FOMB 3VXOB 5IB2B 1XF2B 2EDYA 5DRXB 2OQJB 4XAWL 3C5SB 1OF2B 5DC4B 1DQQA 3ARDB 5SWQA 5D5MA 3ULUH 1LK2B 5AEAA 5F71A 4CMMA 5CILL 5JHLL 1CICB 3EJZD 3CSGA 3BZ4B 5H8DA 2H26B 1CLOH 3HNTL 4H1LH 4NM4H 2ATKA 5LQBL 4HS3B 4ZAKA 4P4RA 4KXZI 1FZJA 4LARL 5DMKA 3BDYL 3ALPA 3CMOH 3WIIL 4J2XA 1K3IA 1KLUA 3KJ6L 5I71B 3WXWL 1I8IB 4MA1C 5DJ6A 2V6HA 2LU3A 3NZHL 4EOWH 2N1KA 3U0TB 4Y5XB 1T22B 5SWSD 3FOLA 1QUNA 2Z91A 4UDUA 1DBMH 4YNYB 1C5BH 1RVFH 5ECJE 5F8QC 4DGYL 4P2QD 5I1AB 3QFDA 2EC9U 3T8XA 5C0CA 5ICYB 1FGNL 1I9IH 4AIZB 4FQPA 4U1SB 3D85A 1CR9H 1I3GH 2Y36L 1BLNB 2FEDD 4CU7A 4WHTA 4DKAA 1U8HA 1R5WA 4GBXB 3CLFH 3LKSA 4WFED 5F9WC 4N9GA 3DVGA 3GMOA 2OZ4H 1U92B 1G1YA 1TTFA 3L5WA 1CCZA 4U1MA 1SY6H 2MCPH 4OLZH 2DD8L 1PKQE 1M71A 3JSSA 4PP2B 5MP6L 1JF1A 1ULVA 1JGLL 5MI0B 3BPLB 3KXFA 5FB8B 2VDNL 3VFVA 2VZ3A 3GGWA 1XR8A 1LP9B 1GGCL 4G9DB 2WAHA 4U7SA 5GISL 5HI4D 3GM8A 5E8NA 3GHEL 2HN7B 3RGHA 4MCZA 5EU6B 5KSBE 4M00A 5HYQB 1HHJB 1FAIH 3K80A 4LCYB 4Y19A 4E0RA 1NGXB 3QQ9C 4OAWB 3WD5H 1VEMA 5I8KL 5F1SA 2DTSA 4F58H 3QJFA 4I4WA 1KJ2B 1I9JH 3EYQD 1UB5A 4WU7B 3SKMB 1UZ8B 3SDCD 2VDLH 1M7DB 4JRXD 2HVKB 2VLME 1IEHA 2X4NA 4OT1H 1F97A 2Q86A 2YN5A 3CX5J 5EIVA 2R39A 3MJ6A 3QFJA 1AIFA 3VH8G 1LQSR 3BMVA 2A6IB 4RGNC 3GI9L 4IMLA 1AXIB 3BIKA 1RZ7L 2LABA 3CD4A 1KT2A 3SJVE 1A1OA 4XBGA 3ULVD 1JHKL 1DVFC 1G7MB 2W60A 3FMGL 3ILQD 1B2WH 1D9KB 3PV7A 1LP9E 2F8OA 4OFVA 5BRZA 2Y07L 1T03L 3CVHH 1KNOB 3LPFA 4HFUL 5T3XL 2YZ8A 1S7RB 3BX7C 1WWWX 3HC4H 5FM4A 4YXLH 2J8HA 3NIGE 1JK8B 1OAXH 1S7VB 5B39B 4NO2A 1MH5A 1C08A 1ZLSL 4YWGH 2HRPL 3BGMA 1EVUA 5TE7L 1VFMA 4HIIB 1A7NH 1D5MA 4NWTH 3DV4B 4LSSL 5BS0E 2H2PC 3UBXI 1I7UB 1MFEL 3INUL 5A2KH 4M8QB 2D7OA 5I19H 3ILPA 5GRWA 5LCVL 3IXTB 5ISZA 3W11D 5EA0H 3BAEL 3OZ9L 3TT1H 3L6FB 4JHBA 4TPRH 2AJVH 3SPVA 3VD3A 1FLRL 4YO0A 2XQBL 3UDWC 5FO8A 2VL5B 3KPRD 1NSNH 1MFDH 2FGWL 2IADA 5DJ2B 4JDVB 1HYRC 1MCNA 2PTUA 4P3DB 5IQ7H 4LSRH 2C4FT 3QUZA 4M48L 1VFAA 4HQQL 5CBEB 4ZPTA 4I9WE 3SDAA 5D1XC 1CBVL 5BOPA 3PJSA 4RFOL 2GJZB 3V95A 1KG0A 2UZIL 5D7JB 1E6OH 2DDQL 2ZUUA 3L3GB 4ZO7A 4KQ3H 2NY4D 3EW3B 3G6JF 3U36A 1FPTL 5BRZD 4YGVB 1FJ1B 2HWZL 3EJYD 3OKYA 4WWKC 1BD2B 4GRWE 2VLJE 4FQXC 4MA3B 3FO1B 2GI7A 5F7WC 2DM2A 5GRVK 2IAMD 4U0RB 1HYSD 2UZYB 4NZRL 2D7TH 3GNML 3MXWH 5JHLH 4LSUL 4NPYB 4WFFE 5FIEA 4JR9H 4MXVE 4WO4C 3VWKB 2H1PH 4LF3A 1D5ZB 4I48B 3S8WA 4O4YH 4OD2A 4ZSOE 5DVMA 1X4YA 5I75B 1U58A 2QKIB 3PDGA 3LB6D 2NXZC 1UZ6E 2FIKA 4K3DL 4KDWA 1A8JH 1OW0C 5DC0A 4OCLC 2HKFL 1OARH 5I1KH 3OAUH 1M1SA 4PJEB 3IS0X 5CLTA 3RP1A 2K7PA 1KTLB 2VLJB 5EOQL 3DROB 4BQCA 2H2PD 2J6EH 5CMAB 1BEYL 2PETA 1IKNA 1OCWL 4NC2B 4NC1E 5CZXC 4N0UB 2NY2C 3JWNC 4KI5C 2R0ZH 3QIWA 5KSAA 2I9LB 2ZCKH 4IMKA 4RAVB 1G84A 3SKNA 2X2YA 5KVDL 3QDJA 3UMTA 5IMOB 4DZ8B 4MXQD 2NXYB 5IW6B 4QXTA 1G0DA 3W39A 4Z7OE 4GW1B 4C57C 3MJ9L 1WFNA 2ICWB 1T80A 3HG1E 3O3EB 4P4KA 4UV4H 2H3NB 4ODUB 4ZDHA 3QUYD 1XIWC 2W0LA 3SCMC 4KJWC 3FHAA 2BERA 5ITFA 5KS9A 4Y4KB 2P43B 1MRCL 5IVXF 3LHPH 3OKLB 4ZAKD 1M7IB 1VB9A 4Z7VE 4QRTB 3QBTB 1IM9B 3SDDC 3AU1B 1R5VB 5AZEL 1RZJH 5A3IC 4IHOB 4XVUD 5CFHA 3H2WA 2WM0A 4OZFB 4OLWL 4WW2B 4S1QH 1JHKH 3A0OA 1WBXB 3MUY1 3SCMD 1UENA 1R3IL 1N0XL 1H3VA 4F9PC 4YHZH 1D6EB 4ELME 5F93C 1J0KA 4QXGH 2YS4A 4IRSB 3CGTA 2CK2A 2QQNL 3PWVA 1OAUL 1XAUA 3UXFA 1DSFL 4HJ0D 5I1DA 4WEBH 5L7XH 2RQ8A 4JM4L 1NCTA 1SM3H 2LAGB 2MJWA 4X5XB 4AIXA 3WNNA 2NTSP 4LU5H 3Q0HA 4BKLB 4YHPB 2F53E 2FDBP 5C0BD 3S36H 1G7IA 1Q9LA 5JXAL 2C3VA 4BK5A 2F19L 1FAKT 5FEBA 3EZJB 4KAQL 2IQAA 3LN5A 4HIHA 3TBYA 3BZEB 1T3FB 4EI5A 3HE7A 4GG6E 1D5IH 5GS0C 4LLUB 1DQLL 4NHUA 4XNYL 3V4UH 4F7CA 3MLVL 1MJ7H 3OJDB 2OK0L 3EAKA 2IPUK 3CFCH 1KJVB 4G3YH 2DOCA 1ZGLA 3T2QA 2Z9TA 3QPQD 1U9KA 1ZWIA 1JUFA 3O6KH 2NY7H 4S1RL 4PJ7E 4JHWL 1T1WB 2EKJA 4TVPH 1R3KB 3B9EA 4E42B 1T83A 2XZCL 4H20H 4L8SB 5JW4R 1A7RL 1GC1L 1EPFA 3ARFB 3MBED 2IG2H 4Y5VA 3VH8A 3G08B 4PV9A 1LO5B 4R0LB 4ONFL 4PLNC 5CP3A 1SJXA 1HSBB 3VGHA 3P0VH 2EIBA 1CFQA 4L4TE 2CDGA 4R26H 3PL6A 4KUZH 3TO2B 1IAOA 1IJ9A 2YC1B 1INDL 4ODSL 3TM6A 3UTZB 4CKVX 3G9AB 3RWIA 1HHGB 2NNAA 1A3LH 5JOFA 5C8JA 1MFDL 2DAVA 1NFKA 4AG4L 2HT4D 4G42B 3WJJC 2FSEA 3ZYJA 5K9KB 2CIKB 1CFTB 3EOYG 3GHBL 1FZKA 4PRIB 1NLDL 5C0BB 2X89A 5EO0A 4X4ME 4NGHL 3VE0A 1X5IA 5FGCE 3IF1A 4R9HA 1U3HD 2JCCB 3O11A 4NUGL 3DVNA 4ZD3H 1F11B 2UZIH 3SGDH 3CUPB 1EGJH 3G5XB 1OP5K 3OX8A 3ZSSA 1RD6A 3B43A 4M62H 1QFPA 4KMLB 2ZG2A 1W8OA 2R56L 1G0XA 3NN8B 4ZFOA 5IQ7L 4N9OB 2P45B 4RAUA 4K71C 2X1XR 3WL9A 5IMKA 4JFXA 4MLIA 4N0CD 4Y4HB 4N0FA 4P2QB 5EIQA 1CS6A 1JFQH 3NH7H 4X98B 1T1XB 5TDOB 5BO1H 5HHQB 3VFSA 3FONB 1LO3H 5F96L 3B9VA 5L2JA 1T1XA 2ITDA 1Q9KA 4ZTOH 1QSFD 4R90H 2NQCA 1GYAA 4LVNC 3ARTA 2EYTA 4Y4HA 1QFWH 4I3SH 1MOEA 4KVCH 2XRAH 4FXGA 3MYZA 5GIRA 1K8IB 1BJ1H 1HQRB 3LKOA 4I9WD 1SYVB 4FMKA 4MJIB 1DFBL 5FYKL 3Q2CA 1FIEA 5C0DA 4MNHA 1TJGH 4MDJB 2DL9A 1T5WA 3GUTB 5F9DC 1WSST 3ZKXB 3LH2H 2WNGA 3BD4A 2GQHA 4BFIA 3RY6A 4QRUB 4QRSA 5C0BA 1XGRB 3L7FA 2XTJB 5CJ8A 3WKMH 3VXQA 3ULVE 4LLMB 2CRIA 3V0AC 1HHGA 2YPVH 3LDBB 3UP1A 2MQCA 1MWAB 1Y18B 5LXGL 3UTZA 1D9KC 3GMNB 4F33A 4J8RB 3NFPB 3EIFA 1FBIL 1Q1JH 3MLRH 4KGLA 5C1MB 3RUGB 1QO3B 4JRXB 2WW8A 1I3UA 2J4WH 3O2VH 4P48A 4WHDA 4QHUB 3W2DL 4Y5VB 4UT6H 5D2NA 4YHLH 3MV8A 5K9OB 4PJAA 1X5KA 4X6CE 5GGRB 4AK1A 2FIRT 1OAYL 3GKWH 4L8SA 1OLLA 1SY6A 3WO4C 1P1ZB 3QQ9D 2X6MA 2FO4A 4HPOL 4U2YA 2IPTH 4MJ5A 4BFGA 3RHWK 3O2DL 3O6FD 1BVKB 1KEML 3UYOD 5GZOD 1T1YB 3KPSB 1ZWIB 4LRNH 1ZHBA 4PJ7F 4U2ZA 2RFXB 1CN4A 3EFDL 3D39B 3BD3A 3F62A 3N9GL 4PJ9A 4XH2B 5GS2D 4F7CB 2A83B 3RKPA 4YFEA 1GHFL 1T3FA 3D69B 5IMLA 3MJ8B 4HIHB 2IQAB 3LN5B 4K8RH 3MRDA 4LCWE 4PJ5E 2C1OB 4NDMB 2BVUA 2BNRE 1M05A 4FQJH 5E2WH 4KK5D 1JTTA 3CFCL 5FYKH 2CDFA 4KQ4H 4UNUA 3MFFB 3U83A 3LY6A 3NCEB 2XKSA 3B9KB 5E56A 3IU4H 3FTGA 1KCLA 4MB4A 2F19H 4HBCL 2VQ1B 1LDPL 2WLYA 3WFBL 4CGTA 1D6EA 1CXFA 5GSVB 5D2LB 5D9SB 4EDXA 2PR4H 4DKFH 4ELMF 3HI1B 1YY8A 1QG3A 2VISB 1KTRL 5J1TC 2CKNA 1LVEA 5HDOA 2ZZUT 2VLRE 4IHOA 1AXTH 5DJ0A 2BXZA 3S34L 4P2OC 3WIFA 5JOPE 3FKUS 5E8OA 3U4BH 4M4RA 1PLGL 4XP4L 4PJ8A 2R2HB 4ORGA 1CICD 1X7QB 3HI5H 4LLQA 3VMOA 3O2WL 1AO7B 4OM0H 4Y4KA 2X4TB 1XGTB 3MV8D 4CN1A 2YRPA 3VRJA 1NBVH 4Y16C 2G5BB 4LHQB 4TNWF 1VEPA 5E95B 1T1ZA 3IJHB 1QFUH 5CZXD 2W0PA 4EQ3A 3W2DH 4QXTB 4PUBL 3MUZ1 3FHQA 4XWOC 5TDNB 3HC3H 5H2BA 1IGCH 2WIIB 2EH8H 4K23H 1XF3B 4IJ3B 5FXCH 1OGTB 1H3TA 1U91B 1S9XA 32C2A 3GMMB 3CDFA 1JTPA 2IANB 3C60A 1EX0A 5F7NC 5MEND 3X11B 2V7HB 1HI6A 2MPAL 2VLRB 2OJEA 4KROD 1XH3B 4M6MH 5T1DL 1EVTC 1S78D 3MRQA 4ZOBA 3NPSB 4JPIB 1P84K 2BXYA 2FLRT 3MV9E 1QTYT 4BH8A 1KXQE 5DEGA 4JFDB 1MFBL 3NZ8B 1NCWL 1KIQB 1JNJA 4LGRB 4NNYB 2CLRA 3CXHJ 3FB5A 3LRGA 5EN2A 1UXWB 1ZHNA 4JFFD 1E4XH 3ARBB 4ZUSB 1ED3A 1UKSA 4CADB 1FVDA 3C5ZD 2DB8A 4Y1AD 4GRMA 3KJ4B 4X9HA 3GIZL 2HA1A 2VXVL 5HI5C 1T04A 3O4LB 1S7SA 1QFWL 2SEBB 3TYGH 2E8ZA 3SY0B 4MJIE 4RGNE 5SX4I 4XCFL 4MA8H 3RWDB 1MIEH 2B5IB 3SDCA 4KJPD 3H7LA 4QWWC 1I85C 4AT6A 5EOTA 1YJDC 5CILH 1OTSD 1MIMH 1AQDA 3QCTH 2YXFA 4YFLF 4UIMA 4RMWA 1NKRA 4OTXL 1KG0B 1Z3GH 3OB8A 2VAJA 4KWUA 5D1ZC 5HHVL 1BZ9B 2E3VA 2W07A 3QUZB 4W4OA 3TCLB 4Y7MA 3QIUC 2Y9RT 2PXYD 1B0GA 2X1WL 5E08L 4XWOD 2IADB 5DJ2A 1CDBA 1EFQA 3T2NL 5FO8B 1BREA 3TVMA 1RUMH 3PUCA 4JFOB 4QRPB 2CJUH 3E2HC 1XCQB 5J11C 2VB5A 4G8GB 5JDJA 5ID0B 4P2RD 3O3AA 4KY1L 1JI2A 4GSDL 3S37X 1L7TH 4Y4FB 3UTOA 2QLVB 4Y8AA 4RGNB 4WCYL 3G6JA 4HUXA 1Z5LA 3RVXD 1BQHA 1NBZA 5DHYA 4U1LA 5GRUH 5HDLA 1EMTH 2HT4C 2EXYC 1KB5A 1UVQA 2NY1B 5F3HA 5A2IH 1OAKL 3I3EA 2Q76B 1JWMB 4FQ2H 5B39A 4XWGL 4Z76B 4G8GD 3LD8C 4P2YA 4RGMC 4QHKI 1GGCH 4XNMB 3U46B 3H3PH 2YSSA 1KJ2H 1NMAL 2V2XB 4JGJA 2BJML 4J3WA 2Q76A 4IRSC 5D6CB 1BQUA 1A1OB 4XBGB 3VXSE 2PXYB 1NBZB 4FFYH 5DHYB 1SY6L 5E7BA 2A6IA 3NOIA 4P3WA 1EXUB 3B4NA 4X4YB 4JY6A 3MNZA 4H25A 3P0GB 1FCCA 2IF7A 1LNUA 1RU9H 1KN4L 3BGFC 1CIUA 3PP4H 1ZHKA 2YMXL 1XCQA 4MNGB 1M7DA 5C08E 5IP4A 2EICA 1UZ8A 4PFEA 5E6ZA 1KCVL 5EG6C 1H3PL 1FL5A 1N4XL 5D7KE 5E2TH 1G9EA 3BPOB 1PQZA 5FKPA 5JIIA 4EBQL 2DJUA 1XEDA 3DX8A 1HHJA 3QNXB 5FF6B 4NP4H 2YBRA 3JVGC 2J88L 2DLFH 1WZLA 3GGWB 5D7IE 5B22A 3VFVB 4F57H 4KK9C 43CAB 3LOWA 1RZJL 4OZHA 1JNLL 4QRQB 1U42A 1EMTL 4QGTA 2Z31B 2NXYD 2R1XA 5K9QI 3K3QA 4PRAB 4HV8A 2HRPH 5C9JA 1NFDB 5ID1B 2PTTB 4L8DA 1NC2D 1U92A 4B53A 2HAZA 4OF6A 1BJMA 3TBSB 1QSFA 4PLOB 4GRLB 4JO3H 1F4YH 2X10A 1NCWH 3BJ91 4H8WL 5D96B 4NQCD 4OD1H 2JJSA 1YDPA 2UV3A 4HK0A 1HILA 1ZHLA 3H3KA 4P5MA 4TPRL 1V3MA 1F6FB 3MLWL 4W6WB 4XPHL 3ZDYE 4HS8L 3KWWA 2W0FA 3V0WH 4OI7A 5E9DB 3SE9L 1BWWA 2D9CA 3F5WB 3MRNA 3FOLB 3RWHB 3GKWL 1OAYH 4P2OB 3INUH 1MFEH 1EHLL 1DL7H 1YECH 1H5BC 3HC3L 2UY6A 1DSFH 1KLUB 1UT9A 4QXWA 2WBKA 3L3IB 1KCVH 1R3LB 3QCTL 2ATKB 1IM9D 1E6JH 2FBJH 4LDEB 1PEWA 2H26A 3P2TA 5J12C 1Y6MR 3QIBB 3G5ZB 3ULVH 4LVHB 4Z95H 2AJYL 3S7GA 4XCFH 1ZLVK 2HKFH 3CU7A 1DQQB 5BZDA 2JCCF 4MAYD 2ESVA 2G75A 2DL2A 1T1ZB 3IJHA 3JV4A 4PRHD 1QBLH 4WUUA 4PJEE 4HDIA 1CXEA 5GS0D 3D0VB 1GGBH 1FH5L 3DO7A 3VRJB 2F9BT 3QQ3A 4M7ZC 2W0KA 5IESH 4M6OL 1KLFA 1AO7A 4XP1L 3OKNA 4YXKL 3OAUL 3O3DA 1EAPA 1EHLH 1PBYA 4PJIE 1MIEL 1C12A 1HHHA 4NRZB 4I2XA 4HKBB 4NQDE 3IFOA 2IFGA 2AEWA 1A47A 2XTJC 3SGKA 1OD9A 1NCNA 4XPTL 2NLJB 4JHAH 4X4ZA 5DJ8B 4F58L 2WUCL 4HXAL 2XNAA 3CX2A 2COQA 1WIUA 2AS5M 4O4YL 3V52L 3HI1A 4AEHH 3PGDB 3WE6A 1NGPL 4EDXB 5D2LA 5C09D 4PRPE 3VGBA 1A22B 5HHMD 2VQ1A 2LQRA 4FQXA 1SMOA 4OT1L 1YECL 3SE3C 3CFJA 3RAJL 1K9TA 1X5JA 1NMAH 1A1NA 5I15L 1WAAE 2C3GA 1UC6A 3B2VL 1JWSA 3DGGA 2CDFB 2VUYA 1KFAH 2HKHL 3FQTB 5E8DH 5GS0L 2GSGA 1BIHA 1HKFA 2GT9B 2B0SL 1F90L 1ZA3B 4ETQA 2D7MA 2APBA 2C1OA 5ERWB 1FFOB 3OAZH 3MJ8A 2R0WL 3K1KC 5KJRL 2BSSA 3H3BC 4X4XB 1B4RA 4X6BA 1JHTA 4E41A 1OGAB 4PYHA 5AYUH 1LD9A 4NKIH 4PJ9B 5DT1L 4MNGE 3EYQC 4LCIL 1CDYA 3CH1A 2EYSA 2VJXA 4DOHB 2OR9H 5GGVL 3P0YH 1FH5H 5FYJE 1FLRH 4OKVB 4JO4H 1H3PH 4TYUA 3UPRB 4K2UL 4P5KB 1BBJB 5IVXA 4Z8FL 1SMAA 4WI3A 2NMSA 5IVOA 3QR2A 4CVZA 1U8OB 4YBLC 4MD5B 1F8TH 3ZTJG 2Z92B 4WWKD 1DLHB 2VSCA 4POZD 4M5YH 4LCCA 4KJQD 5I1HL 4FRWA 1IMHC 3RL1B 5HI3D 1OSZB 3VFPB 2LE9A 4LKCA 3RUGA 3PWJA 3CC5A 1EIBA 4WEMB 4J8RA 3GMNA 4U1GC 4GMSH 4CAGA 4WGWB 3QHZL 4LLMA 2E7LC 4JY4A 2NY3C 2VRAA 4NCDA 3ZO0A 5IB5A 4QRUA 5AYUL 1G9ML 4KHTH 4X5WA 2OJZH 1MCPL 3TT3H 4PJXA 4JQIH 1U36A 5BOZG 1IM3A 4LCUB 3O3BB 5FO7A 4LU5L 1TCRA 1R3HB 4KZEL 2M2DA 3K8KA 2BY2A 2DQUL 2QQKH 5IM7A 1KIUA 3KYOB 4JO3L 1KJMA 4LLYB 1QBML 3U0WL 3U9UB 1NCBH 2B2XH 5DF0A 3IRPX 1G1CA 1CGXA 4WI6A 5B3NA 1UJ3C 2Y1VA 3GSXB 2Q8BH 3VFSB 1RK1A 4Y16D 3ZSTA 3L95A 1KN2L 2LVCA 2OI9C 3UO1H 1MJJA 1QKZH 4RMQA 3QUML 5DQJA 5DVOA 4G8FA 4N0FB 4X6EB 2IAMA 5J8OA 5JPMB 1P6FA 4FTVA 4U1GB 4UDTA 1HH6A 4ELKB 4S0SD 1OSPL 4DCQB 4M03A 4QY8B 3ZHKA 3RVTD 3DLQR 1H8SA 2HP4A 1JHLL 2Y25A 4K3EL 1KULA 4FFVC 4PS4H 2Z31C 1NCAH 5HHNB 4UTAH 1EEZA 4ZPVB 2NY5H 3H8NA 1IAIM 2D4DA 3IS1X 1MIML 5I6XB 2CGRL 1BOGA 4R26L 1CF8H 1S7WB 1K4DA 2CIKA 3O9WD 3D3VB 4HBCH 4J12A 2VXTH 5ABDE 4GAYB 3ELAT 2JE8A 4HGWB 2OTWA 2EH7H 4WI7A 2ZCLL 2YC1A 3HTLX 3NCCB 2F8VA 3ECBA 2HVJA 3PL6B 2CDGB 5IV2A 1AKJD 4U6XA 5EDXA 2EDNA 4YIQA 1A6TB 5FYKE 5I17B 3T1FB 2ARJA 3HLAA 1JJUA 4PV9B 4OZIB 4N1HB 4L1HA 1CZ8H 1SEQH 2XKNA 4ELMB 1AJ7L 4J1UB 1E4KA 4NWUL 2AJSH 1MRDL 5BXFB 2R56H 3WNLA 1N64L 3P4NA 1HIML 1T1WA 1Q72L 2X4SA 1MCPH 3TT3L 4XPFL 25C8H 3CSPA 1JUFB 4AH2A 2VDPH 2F5AH 3BDXA 2A0LD 1CFSA 3C2AL 1IL1B 4HUUA 3ORJA 3OJDA 2V2WB 4EBQH 1E28B 1QLRB 4HUVB 2X4PB 3BZEA 1FCGA 3RIAF 3WO3B 3F7VA 1SJHB 3LH2L 4GW4A 3TBTA 2HLFD 3BP6A 4L3CB 4Z78B 5JIPA 3NCYP 4I1NB 2UUDH 3QEHB 4DJMA 1G7IB 1V7NL 5K9JL 3MRKA 2AKRB 1RZ8A 3T65B 4BKLA 1T20A 1OTUC 4FXKB 2GFBA 2V5MA 4YUEL 1MY5A 2I5YL 3D25A 4P23B 1G9MC 1OAQL 3L3OB 2C3WA 4ISVB 4KMQA 2FBOJ 4LQFL 1JWUB 5IEKB 1QRNA 1IAIH 3WXWH 2FATH 2IAND 3D39E 5CEZD 4OLEA 3GMPB 4H8WH 4TSCH 2CKBA 4QTHA 3HMWH 3DUUA 4A6YB 4Z7QE 3I9GH 1FYTB 3ALXA 5DJXB 4AMKH 1FVCA 2X1PA 2EKSB 1KPVA 4CJ0A 1IM9A 3A67L 5FA3A 1RUPH 2NZ9C 3RWCB 4BSWA 1RJZA 1JZ2A 2ED8A 1C16B 4K7PH 5CIPB 2NY4B 3TYGL 2FNBA 8FABA 5TH2A 5KVFL 4S2SA 2GTZA 1G9MH 2W1NA 1KTDB 1J0HA 4ODUA 4ZDHB 5F6IB 4IIQA 3DI3B 4XI5C 3EYFA 4HCRA 1OAQH 3GSNL 2DJSA 4F80A 2YKLL 3QG6B 4KQ4L 1IGJA 3GBNH 4MA7L 2GJ6E 2O5ZH 2V5RA 1I1AB 4WW2C 3PIQB 4HXBH 4HH8A 5CEZH 2J2ZA 1MAKA 4DZ8A 1J87A 1C1EH 1FL6A 3SN6N 2ZOKA 4JZJB 3W0WB 1BD2E 2V9RA 3D48R 5F7MC 4ODTH 4F8QA 3K4AA 3MLXH 2IFFL 4K55A 3PIQA 1I1AA 5ADPH 1RULH 3ZKQD 2DLEA 1OAKH 3QG6A 1MREH 1U3HC 2QBWA 1QKZL 3GI9H 5DD5H 2VDQH 1UEMA 2YEZB 3LPWA 3RZCA 4LSSH 2VO5A 4U1KA 4YXKH 3OMZA 2JB6A 1QRNE 4WW1A 5LG1A 5TH2B 4G6MH 3IKKA 1D6VL 1RZJC 4PJIF 1PG7H 2QADD 2RCSH 1KBGL 4M61B 3RWCA 1G7LB 3BKML 1YNTA 5FA3B 1LEGB 3EGSB 4WTZG 3V52H 1FVCB 1BGXL 3VWKA 3QUMH 5CD3B 2AV7B 3I6LE 3I84A 2AGJH 1E27A 5DUML 5CBAB 5ALBH 1TJHH 1EUUA 4QF1A 5IVZA 3GMPA 5C70A 2CLZA 4QRPD 1QSED 3U7AA 4X6CF 5I15H 5JW4M 5KVEH 1J1PL 5LVEA 5DUBA 5FYJH 1XR9A 1EO8H 2XWJB 4N8PA 3U36B 4EEEA 5IEKA 1JWUA 4QHMA 5DK3A 2V2TA 5JNYA 3HS0B 3D3VE 2B1AH 3GBNL 3L3OA 1U8KB 1YEIL 3RDTC 5AZ2L 3CFKB 4AEHL 3SDAB 1PZ5A 1B0RA 1MHPL 2HJFA 3EYVA 4NQEB 3K0WA 2Q6WB 4P2CG 3QEHA 1UWEH 3WKML 1F42A 1HIMH 1T5XA 4FZEL 4JJ5B 4UINL 3DSNA 4M7KL 5HHPA 3V6BR 1UM5H 1SM3L 1MFCL 2XZAH 4PY8J 3SPVB 2D0HA 3SCMB 4JHWH 1JYNA 1CFSB 4MA7H 3HZVA 3L3KA 4FG6D 3TP4A 3LVEA 2P5WD 4NT6B 1GHFH 4HS6B 5E2UL 1RK0A 5JHDE 4KPHL 5CJ5A 4MA8L 4NIKB 3G04B 4BQ6A 1WAAF 4N1EA 1BZQK 5DRNB 3T1FA 5IG7B 5I17A 4UTBL 4YIQB 3TNMB 2HKHH 4GKNB 4JHZA 4WJ5B 4DAGH 2P7TB 3NGBB 2HVJB 4YDVA 1LILA 5FA4A 1Q8MA 3RVUC 4MNQD 1A7QH 1U3ZA 2OTWB 1VACA 4LLVA 1V7NH 5K9JH 5F6HI 2D7TL 3GNMH 3S35X 5GXBB 5KTEH 5E8EB 5CEXB 1YMMB 4U4BA 1RURH 3OXRA 3TZVB 1CDIA 4UAOB 1HOCB 1KB9K 3LKQA 3BIKB 4LRIA 4IMLB 3X3FH 1BOGB 5CUSL 3X3GL 5J6HB 3JV0A 4PJDB 3RNKA 4YDJA 4A6YL 3GMLB 1FFPB 4NQVB 3UAJD 3ULVF 4HS8H 1MY7A 5EO1A 2NPLX 1PG7W 3UYRH 2OP4L 4JFFA 1CLZH 3P4MB 5KVGH 2X4NB 4G6KL 2R1YB 4YFDB 3UTTA 5IEHB 3NACL 2K9UA 4D9RD 5MEQB 3SHSA 3O41A 3CVIH 5IBUG 4PJXE 2P8PB 1QSEB 2FD6H 2XI9A 3QJFB 5HD8D 2VKWA 4B7IA 4ZXBA 1ORSB 2YKLH 4J6RH 4OAWA 3T3PF 3K4DA 4CUCA 2AK1H 4E0RB 3QWQB 1BFTA 4JO1L 1KELL 2DQTL 3VXME 3HNVH 2KH2B 4JREB 4G7VH 2P1YA 5D7JC 5EBGA 4BJLA 4IRJA 4XWGH 1ND0A 3I85A 3GK8H 5I74B 1KGCE 1CFNB 4GRWH 1KJMB 1TETH 1JF1B 4KDTC 5CKGA 1XGPA 3ZZ1A 3VXUD 4FNLL 5F1KC 4R7DA 3NPSC 4H8WC 2X40A 4KJPC 1R3HA 1FO0H 3WMSA 1ZLSH 3RIFK 1YN6B 1TENA 1MJ8H 3V0VA 3UTTD 4JG1L 3AFLA 4HKXA 3DNKA 2DKMA 3S88L 1U8HB 2CLVA 4XXCC 5EBLB 3SDXB 1KJ2L 4PJHB 4AM0A 4XP5L 3HB3D 3S96A 3VFUB 3L3HA 2DDQH 3CPLA 2BVOB 3RGVC 3UTPE 4LVEA 1HWHB 3WEXA 5DK0A 3T04D 4DW2L 3PWJB 2Z91B 4KKBD 2AJXH 2FRGP 4LVOC 4AENA 1MAML 3U0TA 4ZTPL 3ZKMD 4PB9L 4YDIH 4W68A 1I8IA 3TJHD 5JDSB 4LCIH 1NCDH 2HLFC 3DYOA 4P4RB 4HS3A 4L3EE 5TE6L 3MUHL 5EUOE 1AD9A 5FOJA 2V17H 4TNVK 3VJ6B 4FS0A 3IFPB 1LEIB 2AGJL 5ESAB 4D9LL 1CWVA 3KHQA 5D5MB 4DGIH 3CH1B 3LQMA 1AC0A 1OF2A 3V9FA 1H3UA 4H88H 2OQJA 4LASH 4X99B 5DJDB 1JHTB 5IF0B 4AEIH 1PG7L 2APWA 5C0FA 2A6JB 2Q1EA 5CWSA 2I26N 1FFOA 1RZFH 5ERWA 4UV7H 3QDMA 4ETQB 1ES0B 2RIKA 5BV7L 4URTB 1HWGB 2O5YH 4NKMA 4PJIA 5CP7B 5E1HB 3KNBA 3PXJA 5E7FA 3LEVH 3TWCH 1XGQB 3I75B 4O2FA 1NJ9B 5D7LA 4MAUL 3CCHA 4PTTA 3GMRA 4EXPX 3WUWG 4X7CC 1DVFD 3JVGA 5DMYA 3OKOB 2CQVA 2ZNXA 4P2RA 3KS0H 4GAJH 2NTFB 2E6PA 5EU3B 3D39D 4DN4L 4WUUE 2GUOA 2MKLC 1P4BH 2FB4L 1YEIH 4PTUA 5JOEA 2UWEB 3BSZL 3S4SA 1N8ZB 1T0PB 4YK4B 1GVIA 3O45B 3Q5TA 3QI9D 3QT2A 1FIGL 1OHQA 1J1OL 3TO4A 3I75A 4O2FB 5C0GB 2IPUG 5IB3A 1O7SA 1GOGA 3B8YA 3MGOA 1EAPB 5CP7A 1GH7A 4NRXA 3G6DH 2OL3A 4Y5VC 3CDGA 5ANMA 3HZMA 4PB0L 4RIRA 3HE6C 5HYJE 4P5TB 3AVEA 1TTGA 3FN9A 4ZO8A 3PWLB 1GGIH 4NN6B 3ROOA 3LQZA 5BS0D 3U9PL 1MELA 3ZYZA 4WUUB 5F7KC 1ZVSA 3SKJH 4Q7DA 1PW3A 4Z7QF 4XMKH 1JVKA 4POZC 5EORL 1J9CT 3MRRB 2PYEE 2IWGA 1NCAL 5L9DH 5DD0H 5D6DC 4ENEC 4NJ9H 4P46D 3QH3B 3EUUA 3G5ZA 5C6TH 3IAGC 3U2SB 2GKIA 2H45A 1BFOB 1Q1JL 3ARQA 4M1GL 5DD5L 3R4DA 4Z7OF 3QXUA 1VFUA 2QSTA 4HXAH 5HGBB 4D3CH 1QSFE 3WFZA 2NYYD 2YD7A 2VWEE 4PYGA 3G5VB 4Y16B 1NBYB 2QSCH 5FYLH 4Y5YB 2RGSA 3KPQB 1CQKA 5HGDB 4WUUD 1B4JH 2FHCA 3F5WA 1FYTD 2B39A 3CFDA 3RAJH 3BKCH 3SKOA 1JNHB 1RZFL 5A2JH 2CUMA 5HDQH 3P0YL 3C6LA 3O6KL 4ALAL 1T89C 3VFUA 5MENA 1HILB 1ZHLB 2YPKB 2BOBB 2WLZA 2XZQL 3N9GH 2DQIL 1J8KA 2VDRL 4U6VL 3JUYA 3ETBF 2IG2L 3T3MF 4CVUA 3O2DH 4LSTH 5SWZA 4XB7A 3H9ZA 5IFJA 2PTTA 3QPQC 1NFDA 4L8DB 5ID1A 5GS0H 3RU8L 4JO1H 4JZJC 2NY7L 2Q20A 1A6ZB 4UQ3B 5FYLD 3W0WD 1I3RB 2YD5A 4YHLL 1LDSA 2I9TB 1L6XA 4FQCH 4IRJB 2IALB 3V6OE 1Z2KA 1DL7L 1NANI 2YRZA 1DBBL 3WUWB 5DI8B 3MA7A 5D7IF 5GGUA 1QR1A 3VFNA 3OG6B 3ZT5A 2DQFB 4AIOA 2VITA 3SE4C 4D3CL 3O41B 3JTSB 5DVNA 4HWNA 2ZCKL 3QDGE 5GS1A 3A6CH 3DXAB 3S88H 3ROLB 2R1YA 1AD0B 5DJYB 2QADB 1G7PA 4AG4H 3IJYA 4PJFA 2BVEA 4CW1A 2DBLH 2Y72A 5L2KD 3OBAA 4YXHH 1JPST 5EOQH 3SGJC 3PNWB 5KN5A 1FFPA 4JVPA 1EXUA 4YDLC 1FZMB 3MRHB 1GGBL 2XACC 5DMIL 3MRGB 2MQ0A 3WS3A 1BBDH 1C7TA 5J1SC 1VFOA 3DRTB 2DF3A 5E5MB 2ICCA 4TNWK 4PRBA 3NABL 3VFGL 4OF5A 4HG4K 1JV5A 3V5HA 1NAMA 3BRDA 5CEYB 1BMGA 2V2XA 4DGVH 4R7NB 5KSBF 1IQWH 4JQXC 1T66D 3KS0J 3QUMA 3NVQA 4Q6IC 1GOHA 4Z76A 4WJ5A 4CMHC 2BY3A 4GKNA 4UNTA 5DRNA 3HZKB 4XCNB 3PV6A 3SOBH 1OAXL 5DTFB 3HUJF 2O5ZL 5CD5D 4RA0C 2DQUH 4C56B 1DBJL 2BVQA 5D1ZB 5IFHL 1INQA 2HLAA 2NY3D 3QPXL 4HUXB 3FB8B 1V3LA 4HS6A 4OBRA 4PJDF 1OM3L 1MI5D 4J3VA 3DGCR 1E4JA 3F58H 1DQDL 2CMRH 1RAMA 3LB6C 1EJOL 1R5IB 3K2UH 4MD4A 4O58H