3MLXL

Crystal structure of anti-hiv-1 v3 fab 3074 in complex with an mn v3 peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
211
Chain Sequence
SVLTQPPSVSAAPGQKVTISCSGSSSNIGNNMVSWYQQHPGTAPKLLIYENSKRPSGIPDRFSGSRSGTSATLGIIGLQTGDEAEYYCATWDGSLRTVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVRAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab light
total genus 44
structure length 211
sequence length 211
chains with identical sequence M
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlxL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlxL01
3CU1A 1AI1L 2VIRB 4Z7VE 5T1KA 1JHTB 1MHEA 3ISWA 3NFNB 1MIMH 3QHFH 4XHJC 5L2JB 3HG1E 3HE7D 4OF5A 5HHQA 5EU7E 3A67H 5FOJA 2HJKB 3BGAA 4W4OA 5FO7B 3BSZL 1JZ2A 4HQQH 3HPLB 4AM0B 5CSZA 1IT9H 3EJZD 4LNVA 2P24A 1BLNB 1NGQL 3IGAB 5HGHB 2ZSVA 1A5FL 1LO4L 3MV9B 1FFNB 4HX1A 4WHCA 3BZ4A 5EN2A 3PGCB 1LMKA 2X4SA 1JV5B 3RHWK 1K2DA 2RCSH 1CFNB 3HPJA 1TVBA 4PJGB 5GXBB 3TYFA 1Q9WA 2FO1A 5E8EB 4LLQB 5IJVA 1BPVA 1I1AD 2D0HA 1IAMA 3RUGF 4BZ1H 4JM2F 4PP1C 1VGEH 2EDKA 2X7LA 1OCWL 1KB5L 2DQGL 4G7VL 1T20B 4EUPG 3VMOA 3V4VL 5TQ0H 2MOVA 3Q5YA 5BMFL 3KPRD 4FXKA 1L7TH 2JK5B 3BO8B 1XGPA 4N90E 3MRNB 1Y0LB 1QBLL 2BERA 4N68A 1JRHI 2DYPA 4X6DF 2AGJL 1MIML 2QQNH 4NWUH 3IDNB 5IB2A 1NGZA 1AI1H 1JGUH 1F42A 1PQZA 5DJ8A 3H9SD 4Q6IB 5E4IA 2HRLA 4OLWH 4OLVL 3VDBA 3B83A 1J8HA 3RGVD 3E2HB 3D18A 5IF0B 1XR9A 1Q0YH 3U4EB 2ESVE 4KY1H 5E8OA 4HULB 2HWZH 4K9EH 3C6LD 3V7MA 4ZPTA 2BCKA 2W65B 3QT2A 5D1XA 1CL7L 3O11B 5C1MB 1N5YH 2I07B 1TZGL 4KROD 4KK8C 4Y1AB 5GGTH 4MVBD 5TJWK 3TO2A 5M95B 1IBGL 3DSFH 1GZQB 1IGCL 2Y23A 3TT1H 1WVZA 4OLUH 5FHAH 1WT5C 1HWGB 4LSVL 2ZUSA 4D3CL 43CAA 3GNMH 4LPXA 4PJ8A 3CSYB 3LEXB 3VFPB 5EC1A 3GIVB 1T03H 2AJVL 3NIGE 4JHAL 4NQEA 5ISZB 3F5WB 1NL0H 3HRZB 5CP7A 1W8OA 1FZOA 5KSVB 3BGMB 4XMKH 3PWVB 4OCWL 2R2HB 5DJYB 2CLRB 2I60L 4X6BB 5J4MA 2FZ3A 4PTUB 4X9FA 2BSTB 3I6LD 1JF5A 4XH2B 4G9FA 2AJXL 3LEYL 3RWFA 2VLRB 4L8SC 5IR1B 2DJUA 3O9WC 5HHNA 2GJZB 4XCNB 4JB9H 4QTIH 3BSZH 2EXWD 4MJIE 4YIQA 1NEZA 3PWNB 1ZHBB 5DRNB 3DLQR 3SDXE 5FYJE 1VHPA 3S35H 5H37G 5BVPL 3KWWA 4G8GD 2KL6A 1DQJA 1EGJL 1T2JA 2C7UB 3KNBB 4PLNC 5M94B 3SGKC 4WUKL 1Q0XL 5D71H 5IMOB 4DVRH 2P5WD 4CN1A 4Z18A 2FHCA 2HTKD 4X9HA 2GT9A 2CIKA 2IPKB 4UNTA 5JW4R 5D2LB 3RZWA 3STBA 3IAGC 2A0LD 3FB5A 4HDIA 3DRQB 2CGRH 3FQXA 3QH3A 3DYOA 1ZTXL 3PUCA 5KW9H 1B88A 5BOZG 1A6WL 1G7HA 3H3PH 4ZSOB 1EO5A 1ITBB 3NABH 3T0XA 4OLZL 4JKMA 4NUJB 5EZOH 4JZJB 5AZ2L 1CQYA 1HDMB 3UTZA 1FNHA 3VFMB 1KCRL 4GAYB 5JR1H 5HGDB 3G6JA 2BVQA 3CUPA 4NKOA 3X12A 4PJ5E 2CMRL 4YQXL 1PY4A 5EUKB 4ZS6D 4Z5RA 4RAVA 5JUEL 3CMOH 1R3HA 1J12A 5HD8C 5T5FL 4PJCB 1R3IH 4MSWB 3X13A 1LO0L 5MENE 1Z5LB 4WY7L 5FGBC 3BD3A 3VWKB 1MCWW 4YHZH 5ESVA 3L5WB 3V6BR 3VGFA 2R15A 5KSAD 3U4BH 4EXKA 3QUMA 1NFKA 4M1DL 3UTTD 3FOLA 3F7VB 1NANI 2NY6D 5E5UB 4EI6B 3R0NA 4IJ3B 3KDMA 5DRWB 4BKLB 5GRJH 3SDAD 1KOAA 4NKIL 3HC3H 3O8XD 4RIRA 2E7HA 1QR1A 2FZ3B 1MEXH 2WZPD 1QP1A 2GCYB 4WI7A 3JSSA 5I6XC 5MEND 1VB9A 2UYLA 3CDFA 3MV01 1N59B 1TNNA 3D2UD 4GW4B 3VJ6A 3GSUB 3D85A 5FGCE 5ESAB 5F9AC 2D7TH 4MWFA 1QVOA 2OI9C 2E6PA 3WDHA 4M3KB 1KELH 4OZIA 4MA7L 5I74C 4G5ZL 4Y4HD 4K2UL 5F7LB 4MCYA 4QXTA 1HILA 2C1PA 3C5ZD 1P1ZA 5JA9A 3IDYC 1WZMA 4HD9A 4LKCA 5MHSE 4JKPH 2NW3B 3TC9A 2CKBH 2OK0L 1MJ8L 2HLFD 4U0RC 1OARL 5BZWB 3FT3A 4L8BA 3K46A 2VZTA 1H3VA 2AV7A 1M05B 4JY5H 3FZUC 5J3HD 4YHPB 1AE6H 3AB0C 3C5SB 2HTKC 3WS6A 2VAAA 4XPAH 3QUXC 3TIEA 1RVFH 4MDJA 1RMFH 4XMPH 1H8OA 3V0WL 3QCTH 5IJVB 5GJSL 1TCRA 1KPVB 1FG9C 5EH1A 1TNMA 2CMRH 1HSAA 1AY1H 1SEBA 4KPHH 5I8OH 2DTML 5D1QC 4PGBA 3ECBB 1MF2L 2K7PA 4XZUA 4ZFGL 2H32H 4PIRF 4PRPB 1UA6L 5EU6E 4YE4L 1T66D 2MQ0A 3LKQA 3BP4B 4NQED 3VXUB 3NABL 5DO2C 1HE7A 3H6JA 4HH8A 1RU9H 2EDRA 1XGPB 5DHVB 5F7FA 1OLZA 3V6OE 1CI5A 1CT8A 3EGSB 3UX9B 1U92B 5D7JA 5HGBB 2J4WL 2KQMA 3VWKA 5I30L 2V17H 2UVFA 3HZKA 4IRZL 1U3JA 3NTCL 2HN7A 4N0RA 3T3ME 1INEH 1JVKA 3INUH 4DWHA 3DX7B 5ILTH 4HZLA 4IIQC 4F37K 4L4VD 4NSKA 3WHE0 1RJZA 4PJBE 3PWNA 1XZ0B 1WBXB 4TTGA 1T7ZA 4YHNA 2M26A 4U2YA 4LARH 2NYYC 3QIUD 1UB6A 3S7GA 5L8JB 3NCYP 2B4CC 1DUZB 3D39E 5JW5B 3EJYD 4JM2C 4Y1AA 5LXGL 1HI6B 2VE6A 1AD0A 2HT3C 2MJWA 3MV9D 5F1IB 5BQ7B 1YNLL 3O6LL 4ZD3L 3NAAH 1YYMH 5SX5H 4MHHG 5DYOB 3QG7L 4MWFB 3VFWA 1SM3L 3BPNC 1ADQA 3VFGL 2CK0H 1OQOA 3KHOA 4OZHA 3DBXA 3PV6A 3UPRA 3HZYA 5I8EB 4Z7QE 5ID1A 1MJJB 2IGFL 2L0DA 5ITFB 3HI5L 2Z91A 3TFKC 5F97E 4QO1A 5IB2B 1CZ8H 3LRGA 1C5BL 3MRFB 5C6TH 2COQA 4R4ND 5AZEH 3R0MA 1RZKC 3IDYB 2ENSA 5DC0A 1NMCC 4K3JH 1JF6A 1G9MH 2A74A 5HYQB 4R4FH 3M1BA 1XIWC 4RMRA 2FNBA 3UTTB 4Y2OA 3WFHB 5F1NA 4C56D 4V2CB 4UZGA 1IKFH 5GS1C 4E41B 4M7KH 5AWNH 5F7NC 1U2HA 5FM5M 3KS0J 3KPRE 5DFVC 2VISA 4XVUD 5FO7A 2Y06L 4XRCB 2WBJA 3OKOA 4FQ2H 4S1QL 1BFSA 3QEHB 2BRRL 4YX2H 1XGQB 3IDGA 5KBNC 15C8H 4LF3B 5EU3A 4G80B 3D0VB 4KZEH 2GI7A 3SDXA 4OI8A 5EN2B 2ZWLT 1AGEB 4PJ8B 4RIRB 3B5GA 2YA2A 2KQNA 3FO2B 3ROOA 3O6KL 5E0QA 3G5XA 2MPAH 5J8OA 3BP7A 2JJTA 4P57A 5A43C 1GRWA 1F45A 1MI5D 5E6IB 2NXYB 1IAOA 1D5BB 2HT3D 3S6CA 2P46B 1R3LB 3EYOA 5FUCE 3D2UA 3ES6A 2D9QB 3CAFA 5EZIH 5HSFA 4M6NH 5JO5A 3HE6A 1KPRA 2FHFA 5KOVC 2BMKB 3EIFA 2P1YA 4PJ5A 3IAQA 2QQLL 3LQAL 5IKCA 3PV7A 2XQYK 2O5ZL 3H7BA 2NY3C 3TO4A 1MLBB 3P9LA 4XP9H 1YMMB 4MS8C 3GJFH 4U0RB 5KTEH 1PX3A 2PO6D 4YIQB 5GRVK 2E7CA 1ZANL 3EFDH 3Q6FB 3HR5A 1NLBL 5IV2A 3FJTA 1JJUA 1EEUA 4OSUL 1NBVH 1VEMA 2WUCH 1ND0B 1P84J 3RWEB 3CFCL 1S9XA 5CD5C 5CSZB 1CTOA 2DQJH 2ADIB 5EIQA 3C6SB 3NGBB 3LMJL 4HKZB 2DKSA 1U8NA 1AR2A 1U41A 4HEPG 1PZ5A 4M5YH 1MNUH 1A6PA 4LVHC 5D9SA 4XPFL 5DURB 3M8OL 2H8PB 4D9RD 2AXGB 5F6HI 3QUZB 4ONHA 3SBWC 4KHXH 4QRRE 5EC1B 1Q72L 4JZJA 1FIEA 1T83C 3GKWL 1JTPA 4V1DA 1OT1A 3O6FC 4NN7B 1GAFL 2XKUA 2WBJB 4WI3A 2UY7A 5LKNA 3MA7B 1JYVA 3T77A 3DX7A 3BDYL 1B0GA 3RKDD 1QFWM 5DGRA 4ERSL 5D7IF 2XKNB 5ADOH 2X4TA 4HJGA 1T0MA 3GBNL 2OX5A 3PWPA 4RWHA 4PBVC 4PB0L 2I24N 1FSKB 1W2KT 3S96A 4TVPE 1GHFH 1I4FA 3S5LG 3C6LB 1WAAF 4FQHB 1KB5A 3VXSD 5FYLL 5HHNB 1UXWA 4WI5A 4HUUA 1YEDB 1JN6A 3BZFB 3WFCL 5DRNA 3TA3C 3KG5A 3GJFA 4P2OC 1IJ9A 4NHUB 4XCCL 3CK0H 2CUHA 2K1MA 4G6MH 3K81A 3PV6B 3UPRB 1N3NA 4LASH 2EDEA 2EDXA 4ZTOH 1RULH 2UYLB 2V5MA 4XNUL 1B90A 1J0IA 3LRHA 1WFUA 1AXTH 2YPKA 1DBBH 5CJBA 2VLMD 3FQNA 1QQDB 1D6VL 3PQYE 1A2YA 1P5UA 4Q9CA 4GW1B 4YC2C 3PDDA 3UTTA 2PO6B 3O4LE 1LDSA 3P4LA 4RMWA 5EOCJ 1UXSA 2A6DA 3CC5A 4JFDD 3REVB 1GZPA 3DUUB 2AK1L 3LHPL 4ODXB 4GRLA 3QEHA 4O58L 3ULUE 4UBDC 4LBEA 4AEEA 4FXGA 4HCRL 4N0UE 1G1YA 3QIWB 3DUSA 1A3LH 2FBOJ 3TIEB 2VLJB 5F6IB 1ZA3A 4U3CA 2IJ0C 2R4SL 2VITA 2F5BL 1TPXB 3STLB 4RGND 4CVZA 3FQTB 4JREC 1NEZB 3FT2A 2W0KA 3MJ9A 2IANE 3RVWD 3RVVD 3VXRD 4KC3B 5I8OL 3VDCA 4PREB 2WBWB 3JVGA 2NNAB 5IGXL 2DL9A 4JDTH 2ZUQB 2Y7QB 3DUHA 4O9HL 2L7JA 2BFVL 3GI8H 5IGXH 1S7XB 1T1XA 2R56H 5I19H 4J6RL 4JQXA 4NRZA 3X14B 1I4FB 3SHSA 1EPFA 2FIKA 4KK8D 5ICZA 1BZQK 1F2QA 3AM8A 3SJVB 1KIPB 2IG2L 2IBBA 4PRNB 2OZ4A 2XT1B 3L3OB 4NQEE 1IGJA 1K8DB 4CVXA 1HCVA 5LGJB 3MLSH 3QNYB 4LSTH 5BO1H 4NKMB 2WWMC 4HWZB 4X99A 3O2DA 3KJ6L 4HIEA 3WKMH 4ZUSB 1C16A 1J1XH 3ARDD 3TVMA 3BUYA 3W9EA 4JFYA 5DHXB 4F7CA 2AK4E 2CQVA 5GGSB 1RURL 1JHKH 3OGCA 3QWRD 3QHZH 1QD0A 1BOYA 5TFSL 1J88A 5FV2A 4LOUD 2AV1B 5C7XH 3GMQB 3G5XB 1KTDA 2J8UF 5GGRB 1CIDA 1ORSB 5D1ZA 5C3LD 4P2OA 4XP4H 4Z0XB 1BBJA 1NEZG 1RUML 4HKJB 2VLKB 5GSVA 4QRQB 3CNKA 3CXHK 4XBPB 4HUWB 1FPTL 1R5IB 2YUZA 2IQ9L 1T0NA 4Y1AD 4LKXB 3UROR 1S9WA 2DBLL 4K7PL 1MFEL 1RZ8B 3FCTB 2E27L 2PTTB 3QDJA 1F6AB 4EI5B 4DN3H 4UB0L 4KRPC 1FIGH 1YA5A 1QEWB 3BKML 3D9AH 3LB6C 2ICES 1TQCB 2VLRE 4MNGA 3OL2A 1ZVSA 4LKCB 4BFIA 1YJDC 5C71A 3VFOB 3D9AL 1JZ3A 3T0VA 4JFXA 32C2B 3QSKB 5JIKA 4NHCH 1ZTXH 2IMMA 2X5PA 3FMGH 3O2DH 2WUBH 2G60H 2R4SH 3N1FC 2OQJB 4A6YH 3B4NA 5MEPB 3CFIC 4KKAD 4LEXL 1YNKH 4JHBA 2A0LC 5EBMA 3HE7A 4LSUL 3BRDA 1W72B 5D71L 5L2JA 1T89A 2QKIA 3GMRB 3PWLA 4GAGL 3KYMA 1D5MA 1ZE3C 2NY2C 3IFLH 2CXGA 3E8UH 1IEAA 1IQDA 3AY4C 2AXJA 4ZUSA 6FABH 3DIFA 2W07A 3BP4A 5FF6A 4M6MH 3R06B 1NAML 4MD5B 5GRVL 4DKFH 3MXWL 3KPMA 3TO4C 4F37F 3TBYB 1T2XA 5IFJB 3VI4F 1EJ6A 5EU4B 4EEEA 1TJHH 1UWGL 1OL0A 4RISH 3QQ9D 1S5IL 1EEYB 2GJ6D 4YXHH 3GMQA 4LHQB 1CLYL 5B38B 4Y19B 4HEME 4YEEA 1HSBB 5DSCA 3T4AB 1LO3L 4JRYA 2HT4D 4Q2ZB 2W0LA 4POYA 1WLHA 2QSTA 4MAUH 1T03L 5JZ7C 3GI9H 4QCIA 1JI1A 5ACZA 3W11C 3CZFA 4LL9A 2XFXB 1JNLH 3ALXA 3H9SA 3QYCA 3HE6C 3O8XA 3F7RA 4YDVA 1RUKH 4XCEA 4WW2C 4OZFB 5I1LA 4HWEH 5B3JE 1JF1B 4ENEC 1A2YB 1T80A 2P24B 1T6VN 3CD4A 2X2YA 3EJJX 4H20L 4GRMA 3S3SA 3GSRB 2IQAB 2A6IB 3UYPA 3FB7A 2FX9L 3B9KA 3WJJC 2EDYA 4M7JL 5L8LB 4AEIH 4PRHA 4X4XB 2IEPA 4XC3H 5E6YA 3TP4A 2BRRH 1CFNA 2NR6D 4XPGH 4PJHE 1T3FA 4U6VL 2F15A 4P9HC 4D0BA 1YMMA 1JGEA 4HIJB 5F96L 1UZ8A 3UYRL 1XGYL 5DWUH 4NHUA 4ODBD 5E99L 5LGKA 1E6OL 4I0PC 4NFBA 3SE8H 3OB0H 4CVZB 3GMRA 3MV7A 4OM1H 5A1AA 3SQOL 4PRHE 3ULUL 4PG9B 4X7SH 4PRBA 4JFZL 4WNQA 1VFBA 4ZAKC 3IETB 4X7FC 2DN7A 1K4DA 3F6LA 3IDUA 4NOBA 4Y19D 5HI3C 3S8WA 3JWOH 3C6LC 1NLDL 5EZJB 1PGRB 3O3AA 3WFBL 1T21B 1M05A 3HR6A 5IHUL 4PGZA 5E8OB 4NJAL 3DTXA 5SWZB 3EYUL 3GIZL 3VXUE 3OKYA 1GGBH 1GGBL 1NCCL 5HGAA 3ROLB 1U91A 2EDQA 2HA1A 1TCRB 3H8NA 2XZAL 3RWGB 4EVNA 4RFEB 1UVQB 5KVEH 4HMDA 2J1KA 3MXWH 3QRGH 1K8DA 4CVXB 4G3YH 4U6XB 3PWPE 4WGVB 4NZDA 4PJ5B 1I1FA 3PWUB 3QUZC 2YMXL 3S37L 5DUMH 3HAEB 5DQJB 4FOMA 3U2SB 1YN7B 5HBBA 1AXSB 3ULUH 2DQDH 2IPTL 5D5MA 5GGSA 4P0DA 1VKXB 5C0AE 3T4YB 4AIOA 3N9GL 4I0PA 4WU5B 4TNWF 2BDNL 3D39B 4YDJA 5I1JH 1BIIB 1U3HC 3PQYD 3VXNB 3G6DL 2D31A 1FLRH 2P7TA 3HAEH 4LU5H 2DDQL 3MO1A 3IKCB 4GBXD 1NGWB 1AY1L 1RV6X 2W0PA 4GW5A 3MNWA 5EUKA 2Q6WA 5E5MA 1UCTA 4U31A 4HS3A 4YDLC 3ZHLA 1EH9A 3RAJL 1CU4H 3GHBH 3O3DA 5SX4I 3WNNA 2W0FA 5A3IC 1KEGL 4HPOH 5I1KL 4WV1B 1I7TB 1BLNA 3I9GH 4XCFL 1FORL 3SDAA 3WYRA 5CHNA 3U1SL 4E41E 4EN3B 1J8KA 4HUMB 3EYQD 1I85A 1XEDA 3EBAA 1LP9E 3WN5A 4I4WA 4TYUA 4WFHD 5GS0D 3TIDA 4LAQL 1HQRB 3KGRA 4PLKD 5F7EL 5J6GA 2ADFH 2IF7A 5IB4B 1BOGB 4MYWB 5JLZB 1II4E 2FGWL 3HMWL 1BEYL 3B43A 2RHEA 3TN0D 4MXQC 4WW1B 4YJZL 1JGLL 2A9MH 4LCWD 1OGAD 2P45B 4JR9H 3OB0K 4QHMA 3CXDL 4QRQA 1MFCH 4J3TA 5DZOA 2IANA 4URTB 1R6VA 4ONFL 1BJ1H 1EAJA 3JV6B 1JNNH 5EU6B 4JO3L 1KCKA 4OFIA 4BH7A 5BW7A 5BZDA 1AFVH 4HGWB 5GPRA 5T5NF 1LQSR 4TSAH 4ZXBB 3W0WB 4F58H 2F54A 3ZKQD 3KLDA 1CL7I 5B39A 3E6FA 1R3IL 1FNEB 1OAXL 4YHMH 1S7VB 4KMLB 3S5LA 4M5ZH 3U7YH 5JUEH 3WXWL 3RTQB 3QG6A 3OKKB 1BIIA 4OCXL 4Q58C 3TBWA 2VXSH 3GMMA 1OPGL 1HSAB 3HC4L 3WNMA 4PY7A 2AQ3A 4NM4H 3Q5OA 4O9HH 2Y25A 1B0WA 4HUNB 1CE6A 5INCB 1RIUL 4XPAL 2L4OA 5DI8B 1OAYL 2P44B 3HE7B 4JPVH 4P99A 5E95B 5EU7C 3U36B 1KTLB 4S2SA 2VKXA 3A6CL 5TE7H 3BMWA 3ARGB 4KJQD 1WFNA 3V5DB 4C59B 4OZGA 4XWOC 5DUBA 3T1FB 3F5WA 4WI8A 5I8CB 3MYJA 2P5EE 3HZVA 2DBLH 2YK1L 4WJ5B 4MAUL 4IRJA 2RJMA 1H15A 1TVDA 2FCBA 1MCQA 5C0AD 4EUPA 1DBKH 2WIMA 4JG1L 3GK8L 1TITA 4PJBA 3TVMC 4MA1B 4WUUB 1JPSL 1RZKL 3LKRB 3Q1SL 1FQ9C 4KI5D 2YSSA 5ACLA 1IC4H 3ARBC 1CLCA 4L4TB 5ANMA 1LE9A 1EZVY 1C5CL 1OAQH 1OP9A 4HWUA 4XBGB 3FB8A 3PWPD 4XNZB 1YNTB 1R24A 2DOCA 1A1NA 3E2HC 5FOBB 3MREB 2V7NA 1RUPL 3M45A 2EH7H 1T5WA 2XTJD 1ITCA 4Y5YA 1S9VA 3G6AB 3BUYB 3RDTD 3SCMA 3JBG7 3VE0B 4DZBB 2XFXA 2R0LL 1P6FA 2B4CL 3X3GH 2D7QA 3CK0L 4XPHH 2J88L 4M7LH 4HHAB 1TQCC 3W9DB 1HYSC 4LSQH 3KPOB 4PRIE 3QEGH 4Y16D 5F9WC 2OTWA 3B9KB 4NHCL 2YPVL 4I3SH 4LRIC 1J0YA 5F3BA 3VFMA 4PLJD 1CGWA 1HN1A 3PF2A 3ZSSA 3QCUH 1QOKA 2VL5A 2X89A 2K7QA 5GRUL 1Q1JL 1AD0B 1I7TA 1UZ8B 3PHQB 2RB8A 4A2LA 2HKHL 2X4NB 2VDML 4YHKL 5CILL 1IM9D 1P84K 4GRLC 3T09A 3W5NA 4X5XB 2C4FU 4RGOH 1J9CT 5JLZA 1RK0B 1ZLSL 4N0UB 3OKMA 3RI5F 4HAFA 4WNQB 2VLJE 1D5ZA 2BNRD 2CIIA 4R96B 4XPFH 5TGBB 3KPQA 1CDGA 1QSFD 2BOCA 2KKQA 3EOYG 1TTGA 1V7NH 2IANB 2AEPL 4LFHG 2K9UA 2VTFA 3JV4B 1IM3A 2B0SL 2DYPD 1QBML 3RY4A 5EU6A 3FFCD 1HNGA 3LEYH 2WINA 3TPUB 3L7EA 3H7BB 3PWJB 5D72L 4QRRB 3OKLA 2WUCL 3VCLA 4O4YH 5IBTH 3FT4B 5EUOA 5JHLH 1S7WB 2C9AA 1A1NB 3UP1A 1A6VL 1DLFH 5JTWA 5DS8B 2XWBB 3RVUD 1NL0L 4GS7C 5D7LE 2QQLH 1ZSDB 2DMBA 5IQ7L 1F4AA 4ZUTB 3G6JE 3EYVA 4ZTOL 1YN6B 4N8CL 4JQVA 1PG7L 2CK2A 3KLAA 2Z4QA 3WNPA 5HHXH 1YPZF 2BRQA 1BFOA 5DJXA 4MNHB 1F8TL 5DGQA 4GQ9H 2NTFA 2YZ1A 4TOYL 1UADC 5T3ZE 2OJEA 3WIHA 1SYVA 4TULH 4ONHB 4G6AC 5LAXB 1BD2A 5LGJA 1ZGLA 4PLJC 1SEBB 5EC2A 5FA4A 1R5WB 5IW6B 3V6FA 1LEGA 5FHBL 4HJJH 2R29H 3RL2B 2VQTA 5HXMA 4JM2B 2DQCL 2D03H 3GB7A 5KANI 4NC1E 3OHXA 2X1OA 5MEOA 1QNZL 3RPIB 1GPOL 4ESKA 1VESA 1E6JL 4JAMA 4X7CC 4PJGA 3BAEH 1VCAA 3EO9L 2Y36L 3WLBB 3ZT5A 5JHDA 1A6TA 4DGIH 3MYZA 4OFKA 1S7QB 1N64L 4X8JB 1YEDA 3DURB 2XRAH 4BM7A 4GRWF 5JOPE 2BOCB 4I77H 3VRIA 2EEAA 1J0ZA 4OZGE 4AIXA 3ZE1F 1GH7A 4OI7A 1OGTA 4FXKB 3DHJA 1N3NB 2GK0A 4N8CH 5H2BA 2W1NA 1NAKL 3NIGF 4HV8A 1E4WL 4QY8B 1ZHKA 5JDJA 4GKZB 1RZ8A 3ZE0F 5INCA 3PWJA 1EHLL 1U3HB 3THML 2E7LC 2MTPA 2R1XA 1QTYT 1T7VA 4DQOL 5C09E 5F89B 1G7MB 4YDJB 3QUXB 1VFAB 2VZOA 4HK3N 3QUKB 4H25A 4L4JA 2BVEA 4KI1A 3IJYA 1RULL 2NY1C 4NO0D 4NRXB 4U1KB 4LASL 5DD6B 4GMSH 3S4SB 2VDLL 1KTRL 4DVBB 2JCCF 4ETQB 1C08B 3MRPA 5IVXF 1JPTH 3VFRB 2F54B 3QHFL 4POUB 2J6EH 2XRAL 5MEPA 2CLZA 5JMOC 1TLKA 5C07A 4NZJA 3VXOA 4G8GE 3DYMA 4QYOA 2MPAL 5INDA 4PBXA 2B2XL 1HDMA 3CLFH 3GMLA 4KU1A 1EEZA 2NR6C 3CX5K 5J57B 3QNXB 4NQVA 5D2NA 1P2CB 4ZXBC 4BUHA 2AK4B 1X5AA 4JG0H 2R2BA 4PJXE 1QSVA 5H37H 4HJJL 4KJQC 3PDOB 2ARJQ 4XXCC 4H88L 3SKNB 1Q1JH 4GSDH 3ARGA 3FO0L 1T1ZA 1NUDA 4ENED 1U93B 1X4YA 1OD7A 4ZQKB 2PXYC 2VJXA 4M7KL 3RA7L 4U1HB 3AXLB 5C0CD 1YEFH 4G8FB 5CEXB 1TTFA 3MJ7B 4Z7VB 3OPZH 4NNPH 3UJJL 3MMEA 4PGBB 3BN9C 5DRXB 1BP3B 1UACH 1G9NL 4G8IA 3UTSB 4QHLA 1HHGA 3VXQB 4W6YB 2CKBL 1TJIL 4TUJB 5IG7B 1X5XA 4IS6B 4OJFH 1ULVA 4X4ME 1MCIA 1N59A 3N50A 3VI4E 5J9PB 1B2WH 1EO8L 3UDWA 3OGCB 2R39A 5I0ZA 4HK0A 4OD3L 1PKQA 2DD8H 5TE4H 3S36X 1ROWA 1XIWB 3LN9A 4OBSA 3VWJC 2ZNXA 3PGFH 1LK2A 4X6DB 4PUBL 3X3FH 1K9TA 1IT9L 3TBWB 1FZKA 2ZOLB 1BD2B 4WV1A 4NZTH 2JB5H 4OCSL 3SDAB 4KI5C 4X4YA 1RIHL 4AQOA 3NCJL 5F7KC 2QEJA 3LN4A 5MI0B 1MRDL 2QADC 5IW1B 3PE9A 5DJ2A 1CGSL 3MLRL 4JM4H 4RAUA 5A40E 3KPOA 2CLZB 5GGVH 3INUL 3P0VL 4R26L 3WV0A 5DYOA 1FFPB 1LE5B 1DQQB 1ZLSH 2ADGA 1MH5A 3V8CA 4Z77B 4Z7UB 4OZHB 4LLYB 1RUAH 1SY6L 4H5SB 4XB7A 3BD4A 1T7XA 1R5VB 4DOHB 5GGTA 3GRWL 4KZEL 4NFDA 2HKFL 4M03A 3MBXH 5MERA 1S7QA 3PHQA 1EIBA 3QEQB 5J1TC 1SYSA 1KG0A 1DQTA 2EH8L 3TBSA 4V1DD 3WJJA 2X9WA 3VGGA 2ESVB 4WFED 4F8QA 5ENWB 5IROA 5J12C 3LB6D 4I3SL 1NFDE 1WTGT 2EIDA 4PGDB 1KGCE 3I84A 2PO6C 1QSEB 4GT7A 2DICA 3QFDB 2LAGB 2DBJA 4K3JL 2GW5A 2VUOA 3RWGA 4UINL 3AREC 4R0LB 3HNTL 4U6XA 4K23L 5C0AB 1PG7H 1CXIA 1P7QB 1IZJA 4Y5YB 4U1GC 3SCMB 2VSDA 2VXVH 5IQ7H 4QF1A 2Y5TA 4EOWL 4LVNB 1CGSH 2R8SL 2J7LA 1AGDA 1YN7A 2XTJE 4X0KB 2AJYL 2X9YA 4HKXB 3TYGL 1DCLA 2H9GB 1XAUA 2HMIC 5DQ9A 3HZYB 4U33A 5I8EA 1D5IH 2XZQL 3ES6B 1X44A 3VXNA 3I85A 4JRYD 4U1NA 4GRLB 4H8WC 1PKOA 3BKYL 3MC0A 5E9DA 2J5LC 4K8RL 1JHLL 1Q38A 3F7QA 4UILH 4MJIA 3P30L 4NKIH 5CZVL 4X7EC 4M1CC 4I5BA 4Y8AA 3CFEB 4WU7A 3VRLE 5IBUG 4OV5B 3ULVE 4CVUA 1V7ML 1IGTB 3TJEL 4RGOL 1ETZA 1CTNA 2HN7B 4Z0BL 5TGBA 1YEHL 3EUUA 3MUJA 4LPVA 1T89C 4GKSB 5B8CA 1S9YB 3GJEA 3FQWA 2E9BA 4N5ED 2DM7A 3LAFA 4G6AD 4S1SH 3F8UB 1WTLA 3QUMH 3WL9A 3BKCL 1HK6A 2EH8H 1OAXH 3P9MB 2HFGH 1AO7D 2NLJB 4RCAA 3TNNB 2HKFH 1A6WH 4TSCL 1L0XA 3ZSTA 1Z3GL 2F19H 4EZMA 3W0WE 1OARH 3QEUB 1I8IA 3MJ6A 5AG9A 1CVSC 4ZS6C 3ZDXE 4KV5F 1PFCA 2UY6A 4J4PA 1BQLH 2ZCKL 3ESUF 4ONGH 4QGTA 4R0LC 1H3XA 4JFYB 3ZYIA 2DIJA 4LLUA 2UZXB 3P3YA 3C09C 3QCVL 3EO0B 3NIDF 3HMXH 2ATPB 1OW0C 4RMSA 2QTEA 5DC9B 3Q3GA 2XZQH 4ZSOA 1U8MA 2A74B 5A16A 4JN1L 1U8PA 3LKNB 3RIFK 2VXUH 5FB8A 3BZFA 2A6JB 4LCWE 1H8NA 1MWAH 3KVQA 4Z77A 2BNQD 3CVIH 4JREB 3B9AA 2X4PB 3FKUS 3Q1SH 4AL8L 3THMH 5I0DA 1R5VA 1WZ1H 4W6WB 1G7IB 1H3WM 3MV8B 4LDLB 4KTEH 1NLDH 4S10A 2GFBB 5I1KH 5T1KB 4ZOAA 3P77A 5MEQB 3ARFD 4RWYL 3NA9L 4WY7H 3VXPB 1KJMA 4GW1A 2QSCH 4OBRA 4P59H 5JA8B 1FL5B 4NNPL 3OPZL 3S35X 3DROB 1SMAA 3OGOE 2BNUA 2H26A 25C8H 4X6EB 3EO9H 3GSOB 4R0LA 4XPBL 3L7FA 4MJ5A 2NY5L 1BZ9B 1X9QA 4IHOB 3HE6B 4LBEB 1EO7A 3BH9A 1NSNL 5EIVA 5CD5D 1XH3A 3H2WA 1ZLWH 5C8JB 3SO3B 3LN4B 2OTUB 2DLIA 5HY9A 3GUTA 3IU4H 2J8OA 4U1JB 4EVNB 1JN6B 4X0KA 2GJJA 3Q6FA 2EZ0D 4GKNA 4DK6A 5FOBA 1HILB 3T2PA 1MJUH 4PJHA 3HAEA 2AJSL 2D2OA 1FRGL 4ALAL 3TNMB 5L0QB 3MRGA 1Y0LA 1WWCA 1LWRA 3KPNA 5HYEA 3UTQB 2AV7B 4KRPD 4HKZA 3PIQB 1BFVH 3QQ4A 3WN5B 1MFCL 4OZHF 4KJWC 4E42A 4QWWD 1EFXA 3WXVH 2A9ML 3PNWA 4OCRL 4OGYH 3PGFL 3G08A 4Q6IC 2H41A 1S5HA 1WCQA 3G5VA 4PJEE 5KS9F 4OV5A 3K4AA 3NFSL 2X10A 5C0GA 2I60H 5F9JB 3KLHC 3BZEB 4DQOH 3NBNA 4ELKB 4H0IA 3TH4T 5MI0C 5I1CH 4OJFL 3GM0A 1WEJH 1S9YA 3MOBH 1LO4H 4J4PC 4JVUA 2XIDA 4KAQH 5SWQB 2IH3A 2GFBA 3PDOA 1A7NL 1IC7H 1MELA 2P43B 2ADGB 2X1PA 2ZG3A 4PJXA 4QNPE 3OR7B 4ZO6A 2LQRA 3VWJB 1XF4A 5JNYB 1F3DJ 3L3GB 4W68A 5FHAL 1JF1A 2XN9A 4PJ7B 2QL1A 5F89A 3HRZA 4FTVD 3DHMA 5JOEA 1F4YH 4OKVA 3SBWA 3GJFB 4YGVA 2AEWA 2JTDA 5ADPL 3HI1A 3UTTE 3BEVB 3CVHH 4N0YL 3T0AA 3SY0B 4HS8L 3RJDA 1QLEH 4JFFE 3NFPA 1PKQE 3QFDA 4R7NB 4R3SA 4FQIH 1N5AA 5F6HJ 2D7NA 3LQMA 3WFEH 3OTTA 2VQ1A 4OLVH 4OLWL 1AQDA 4NZRL 1UWEH 5I9QC 1T5XA 2F58L 2AQ2A 3EYFA 4D9LH 1YUHB 3NFNA 4C83A 1ACYL 1UM6L 3MA7A 5FHBH 4TQEL 1UM4H 3HUJB 4FZEL 5I16B 4ZUWB 1XR9B 3NN8A 1CCZA 4OKDA 3U4EA 3OJDA 1JP5A 2C7UA 2PO6A 3ILQC 3PABB 1A6ZB 2E27H 2Y1VA 2BY2A 4Q6YA 4K3GA 3EO1A 2YMXH 3S37H 5F93C 5LVEA 1F02I 4ZUTA 1MHPH 5E7BA 3IJSB 4HJ0C 4R7DA 5DJXB 1ZHNB 1LO3H 2FRGP 4ZO8A 1GGIL 1SJHB 5IESH 3MRBA 5DVLA 4AT6A 2EH7L 4FFZH 3VWKD 1QRND 1NUFA 2RCSL 3EYUH 2XNAA 3O41A 1KCVH 3LEVL 2EDNA 2WWMD 2NY4D 1LEGB 2E5EA 1KACB 2R0WL 4NNXA 5CP7B 35C8H 3CFKB 4MJ2A 3MLTB 5IBTL 2QADB 1NAKH 2YD3A 3FONA 1R3JB 1EMTH 3R06A 2Z31B 1T5WB 5E5RB 1NFIA 4PGCB 4YHOH 2LU7A 1Z5LA 1I1RA 1EJOH 1MFAH 3TV3L 4OZGB 1SVZA 3GMOB 3A6BH 4B7IA 1T2QL 5IVZB 3FO9B 3QXAB 3MRIB 2DQIH 2P49B 5F9OL 2FX8H 1EAPB 2DJ4A 1ZLWK 4FQXC 4Z7UF 1RZGB 4ZPTB 5HI4D 3C08L 5T3ZH 5EIIB 4LDEB 3WIHL 4MA1C 2DQEH 5DJ6B 1OAYH 1DVFC 2C3GA 1I9IL 3QQ3B 4JPKL 1DEEA 5A2FA 1PDKA 4ZS7H 4YDKL 5CEYB 2DB8A 3K0WA 2X42A 4JE4B 3N1GC 1KJ2L 1Y18B 4NM4L 4QHKJ 4OF0A 4FQPA 2VLRD 4UB0H 2O61A 1MH5B 3MREA 1W72A 4P9HL 2FO4A 1O5DT 1BQUA 3QP3A 2ZCHL 4NDMA 1S7SA 4G8GB 1RIVL 1D5ZB 1FFOB 5D7LB 4DZ8B 1X4ZA 1AGCB 4NP4L 1HIMH 3G6JB 2H32B 2FLRT 5IW3A 4XTRC 1INDL 3Q3GB 4M4PA 4QOKD 3RUGB 1E27A 3ARBB 3QJFA 1DLFL 1UM5H 1JUFB 2DRUA 4NYLA 5AD0B 4PJXB 1I7ZB 5FK9B 1TJHL 2XNAB 5BJTB 1FYTD 1W0VB 1BWMA 3WLWC 3MX0A 5EBGA 5LCVH 1F6AA 4B41A 4DGYL 1ZLUH 2F8XC 2XV6B 1KCUL 1A1OB 2H45A 5FCUL 1MFDL 5FO9A 2WNGA 3LKQB 4KRMB 4KMQA 1OM3H 3TJHD 4BH7B 5ISZD 2WP3T 4OZFG 2G9HB 1MVFA 1FH5L 1NFIB 4O51B 1W0YT 4MHHI 5BO1L 2G2RA 5E8EA 1H3TA 3MJ9H 1JCKA 4M48L 5C0BD 1CDUA 4KKLD 4XNMB 3BP5B 4H1LB 1BX2B 3ZO0A 3BEWB 3MLYL 4X7TA 1G7HB 2FBJL 3D5OF 2IADA 2ITDA 4WWKB 2JB6B 3W11D 1BZ9A 3RWDA 3BHBA 5EC2B 5FA4B 4PJ7F 2RR3A 5D2NC 3QXDB 4F8TA 3ZDYF 1IAIM 5HGDA 1ZHLB 2UZIL 4JDTL 2PYEE 4N1CA 2BX5A 2OZ4H 3BH8A 4WFGD 2ITCA 4DKEL 2YZ8A 4NBYB 2BXZA 3MACL 4U1MB 3P4MB 5T3ZL 1S7TB 4X5WB 3S88L 1OY3B 4NBZB 1GAFH 4NC0B 4IJ3C 5JHDD 1YEKL 4JAMB 3SKUD 4WCYL 4X9GA 3QIBB 3D25A 1FGVL 1NCBH 4L1HA 3ZMRA 2ZUUA 3MBED 3WHE1 4W70A 4ELMF 3NCCB 4RSVA 1P53A 2P48B 4BSWB 3M8OH 4CMMA 3MV8A 3VRIB 2DQDL 2W9LA 3QBTB 5HHPA 1MAML 3DUSB 4UBDD 3K80A 2HFTA 5GJTL 2BNQE 2DLFL 4XBEL 2K3TA 3B9KC 4OUOA 1K5NB 3VXSB 3CX5J 5B4MD 3MFFB 1OGAE 3OF6A 4O02L 5IMLB 1UZ6F 2HH0H 4RGMC 1YUHA 1HH6A 4KKLC 1QSEE 4OIIH 1TIUA 1WBYB 4I3RL 1I8KA 4NN7C 2PW2A 5EA0L 1CG9B 1G0DA 4MNQD 3C60A 3GDBA 2GEEA 3MR9A 5D7JC 2YWZA 2DWEA 4XI5C 5TDPA 5DLMH 3MLWH 5EFIB 4GLRH 4XTRD 4IOIA 5I1GL 4Z7WA 5A16B 2YD8A 2VLKE 3EOTH 2VH5L 2DIAA 5IMMB 4WEUD 3ARBD 3FN0H 4OQTL 4XWOD 1F90L 1TZHB 2A83A 4QLRA 3SE8L 4FP8L 2UZYB 2E6QA 1FVDA 5GZOD 1A7PL 3NCYS 1KB9K 3GI8L 2LE9A 3NH7H 5FDWB 4QY8A 2CIKB 3IKCA 1KTKE 3UYRH 5LG1A 1EHAA 3FOMA 1A14H 4J8RB 3AAZA 2DM2A 3QQ4B 1A1MB 4UOW1 1ZA6A 2APTA 4TUKL 5TDOB 4FMKA 5DHVA 1BQHG 1QSED 3HR5B 2F5AH 4N8VG 2KZ1B 2H3NA 4PFEA 3VG9C 2Y06H 1FL5A 4NRXA 4U1KA 4X6DE 4KKCC 1UGNA 3HE7C 4FTVA 3FO1B 2X4UB 4LHUB 3QXTA 4UV4H 3TH2T 1RUKL 3OJVC 1HHIA 4XGZB 3GGWB 1KB9J 2BHZA 5K93A 1JNLL 1RZGA 3TV3H 2A1WL 5D9SB 2CJUH 1JNNL 2LTQB 1UWXK 1N0XL 3U9UA 3NIFF 1F11B 4WDIA 4MJ6A 1A7RL 5DQJA 4GRWB 4GLRI 3L5XL 3RKDC 2BJMH 5I1GH 1AKJB 4LRIA 4Y4KD 4OSUH 1PG7W 3MRKA 4P4KA 1A7OL 1FE8H 3JZ7A 2E7BA 3SN6N 1DBBL 2A73B 3VRJA 5C0BA 4PJIA 3FONB 1YYML 1U0QA 3BEVA 4K94H 2NY4B 5CZXD 3BRGC 4L8DB 2BMKA 5IESL 4Y19E 4MD4A 3QI9D 3PIQA 3DRQA 3MA9H 1OD9A 4UDUA 2WBKA 1QPXA 5HPOA 4PRHD 5DFTA 4MXQD 3Q2CA 3TBTA 3IYLW 1GIGH 3GSWB 2P8MA 2XXMB 3LS5H 3AFLA 1MWAB 5FYLH 5CP3H 5F9JA 5C0GB 4IRZH 1FLTX 4IDLA 4AG4H 1FV1A 4BSVB 1T22B 3EYSH 4OGZA 1KCSH 4PJAF 4FNLH 4H26B 4KKCD 3BRFA 1IAIL 1A8JH 1SEQL 5CKGA 5ID0B 3ARVA 4YE4H 4NJ9H 2BNQA 2NW2B 2XTJB 4S1QH 2NXYC 3W5MA 3BOVA 1C5DB 2JJUA 4LSPL 4QXGL 4S1DC 3OAZK 2FO4B 2YBRA 1OP5K 4TVPL 4F9LA 5D1XC 3MV8E 4M7JH 5T1MB 1FBIL 4NT6B 2C4XA 4ZOBA 4OAWB 5ETUA 3UTSD 1CDCA 1CDBA 1MHHB 3QCTL 3SE9H 2BCKB 3S34H 5KSBF 1RVFL 5DEFB 4ODUA 2IPTH 2EO9A 4QHMB 5CSBA 1HHIB 3TJEH 3G5ZB 1I7RB 4K7PH 2Y6SC 1R3JA 3PXJA 2IQ9H 4NRYA 1IC7L 3CZFB 1KSRA 3ZZ1A 1KLFA 4RGNC 2FL5A 4LIQE 4KDWA 2HYMA 4R2GD 5IJKC 2UWEE 4Z76B 1T04A 3FN9A 4LIQH 3UPAA 5B39B 3OAUL 4X83A 4ZNEE 4M93C 3ARUA 2IQAA 4QHUB 4CU8A 2FJHA 2YD7A 5I9QB 4PRPD 5DD6A 2ESVA 5HGGS 3S4SA 3T0DA 1TZHA 5BZWA 1WT5A 1P4LB 1Q9OB 1M7IB 4XC1H 3WXVL 1GXEA 1FNLA 4JPWL 4D0BB 2YD1A 5HHMD 3T3PF 1PZUB 4JHWL 4KJPC 2AJYH 1HKFA 5T1DL 2ZCKH 4W4OC 4QRPB 3VXME 4WTZA 3BHBB 3E8UL 2IBGA 3IVKA 1MAMH 3BQUD 2ED9A 4KQ4L 2VZUA 4XCYB 1I1AB 5HHQB 4S1DD 3SDYL 4HLJA 1WBZB 2JIXA 2ZOKB 1S8DA 4ZXBD 2HFGL 4K7PX 5FA3B 2A6DB 3CC5B 1A6UH 1P4IH 1NH6A 1DSFL 1P2CA 4LVNC 4HLZH 1A0QL 4G6KH 4F7CB 2X4NA 3RWHA 4JZOA 4RBPH 3O45A 3HNSL 3WSQH 4TUKH 4X5XA 3JV5A 2DAVA 4HXAH 5ERWB 1CFBA 2HFEB 2HG5A 3FQRA 4JFEA 4PJEA 5KOMC 1F4XH 4KRLB 4UQ3B 2NY1D 1E4JA 3WL9B 2H6PA 3W39B 4ZS7L 1EA9C 1EBPA 4LCWB 1ORSA 4OLZH 2YUWA 4G6FB 1YNTA 3VH8G 5CMAB 1A1OA 5AYUH 3DARA 4P59L 3E3QC 1U58B 2ZZUT 1C5BH 4QHLB 4PJ7E 1K4CA 1CFVL 5KANG 5J0BA 1UCBH 1UB5B 3VXTB 5C0CA 2XOTA 3RFZC 4OT1H 4OLEA 3VW3H 1FPTH 5E2JA 4L8DA 5DLML 5CEYA 1RJCA 2BVTA 3PP3K 4KTEL 2DMCA 4WHYG 4Y2DA 3MRHA 5E2VH 3TA3B 4X80H 5ESVB 3EO0A 3MLRH 3MYJB 5T5NG 3OAZH 1JYNA 5DFWH 3TZVD 5JNYA 2AK1H 3LHPH 3FQNB 2EDBA 3ZKSD 4CBPA 4KMTL 3NOIA 1CXKA 3EYOB 1AJ7H 2NTSP 4DTGL 5FXCH 3PJSB 3ARZA 4NM8L 2P7TB 2XY1A 5F6IC 1QR1B 4JN1H 1JE6A 3RX7A 3V95A 3PHSA 2IALA 4GBXB 4QRSB 1C16B 1OAZL 5ANMB 1LE9B 1OTSD 2EC9U 2JELH 3P4OA 3HB3D 5CJQL 4JFQA 1DBML 5GJTH 1UH2A 5FYJH 3RTQC 4KVNH 2OJEB 5I66A 2NXZD 1TETL 3KJ6H 3SDDD 2EIZB 4N1EA 1SJEA 3F7YA 4LSUH 3DV4B 5F21B 3H9HA 1MHPL 2MSPA 5I2IB 1HIML 1NGYA 2E3VA 1AHWC 3ALWA 4MB5A 2ADIA 3RGHA 1PYWA 5D1ZB 1RU9L 3FOMB 4J8RA 4BH8A 5FO9B 3KPQB 4LSVH 4ETQA 2ICEA 3BQUC 1ZA6B 3S88H 1YMHA 1GL4B 4LLWA 1GC1L 4APQD 5J6GB 4Z95L 4TQEH 4L3CB 4NO5B 1ES0B 1LP9A 1KJ3H 1G9MC 1NDGA 1F3DH 2OJZH 4U1SB 5CJ5A 1UQSB 2LU3A 5CZKA 4P57B 2H6PB 4E0RB 4NNYB 1TQBB 2BC4A 4P2RA 4QYOB 2D9CA 3GUTB 1KFAH 4KRNA 2J8UE 1NGPL 4GAJH 4F33A 3DRTA 1AE6L 4EUPH 4F15B 2ZKHL 3QDGA 3MZGB 3MODL 4TPRH 2B1AH 5HHOD 3AVEA 2FJHB 1F11A 4FS0A 1UB5A 5IBUB 5C0NC 8CGTA 3QXUA 3WE6B 1QYGH 2QR0B 3MJ8A 1H0DA 4KQ4H 4ONOA 1A6AA 4QXWA 2GIYA 4OD2B 3X11B 3WDJA 1JHLH 1FH5H 3GMOA 4JN2A 1AHWA 2NW2A 2C26A 3LVEA 1KXTB 4OZFA 2R1XB 3VRJB 3AXLA 3LV3B 5FFLA 1IGIL 2DS4A 1VGEL 3H42L 1ODAA 4LLMB 3FFCE 5GS1A 4WUUE 1I3UA 2ZP0T 1TQBC 1E4KC 1RSFA 1WISA 3B5TA 5D5ME 4G6JH 1JHKL 1I1AA 4CMMB 5DEFA 3ZE0E 1J0KA 3SDCD 1WZLA 3AAZB 4JCMA 4OCWH 5FKPB 4C4KT 2FB4L 1XGUB 4OGYL 2E6JA 4JJHA 1QLFB 2VLJD 4WRLA 4JVWA 4J3VA 5K9QG 1Z2KA 1W0WA 1Q9LB 3RUGE 5EU4A 2JCCE 3J8F7 1VFUA 4HS6B 1MLCB 5E00A 5DT1H 4Y4FC 5GQBA 5KSBE 4YBQD 4UQ2A 4TVPD 5M7QA 4HX1B 1HQ4A 3V5KA 4FQ1H 3O6KH 2VC2H 4OCYL 4U6HA 3C6LA 4L4TD 4YFLF 3CH8A 5DQDH 1BM3H 5ETUB 1SY6A 4G6FD 1FL6B 3WFHA 2JJVA 2X05A 2OQJA 4ERSH 3S98A 3QPQC 1RD6A 3HN3A 3LY6A 1UKQA 5TPWL 1W0VA 3MROB 5T1LA 5EBMB 5KW9L 2GJ6B 3CDGB 1UVQA 3V4PH 3CFBA 3C5ZA 4Y2DD 5IM7B 1VFAA 4D9RE 4RZCB 5I1HH 4OF8A 3LZFH 1MFBH 3WDIA 1T2QH 3VWKC 1AQKH 3C9NA 1A7QH 3QUYC 2CDEA 2V5TA 3QDAA 5TQ0L 1QHOA 2PETA 4QRSA 4UT9H 4M5YL 4GG6A 4OZ4A 4BQ6A 3BIBX 3W0WD 3LMJH 4YH6A 1YEIH 2WANA 4L8CB 1JWSB 4X7TB 4CVWA 2EE2A 2PYEB 1D5BA 3BN3B 1DL7H 1WFTA 3FO1A 3MNZB 4IRJD 4P5TB 2E9IA 4DN4H 5BRZA 4H8WH 2EC9T 1DR9A 1AXTL 3QG7H 3B5HA 4J3OC 1GSMA 1NMCB 4ACPA 4H26A 4KUZL 4MAYD 4ISVB 3L3IB 1GOGA 2Z35A 3C8DA 4FQJL 4D9QD 5F7MC 2YXFA 2D7PA 3VI3F 4GUPA 3DX8B 1GGIH 5F9WB 5DURD 2F8VA 3SKNA 4LLVB 5TDNA 3MRKB 5EO0A 2A9NL 1K3ZA 4PGEB 5C0FB 4XVJL 2DI9A 3O2WL 1DN0B 4L4VA 3SKOA 4F7MA 1L9MA 2Q1EA 4JQVC 1MJ7H 5CS7A 3TT3L 1I9JL 3UTOA 2Q76B 3RDTA 4PP2A 3MMEB 4D9LL 4H88H 3VXOB 1I7UA 4POZD 2IALB 1D6EB 3UBXA 4AYFA 2BSSA 3NZ8B 4APQB 5B3JF 4ZTPH 2LABA 2DQCH 4XI5D 3LH2H 4OLXH 3C60D 4MLIA 4C56E 5AYQA 5C3TA 4F2MA 1JGUL 4JQXC 5DTFA 1IEHA 3T77B 1TENA 2AK4A 1XGTA 5KS9E 2AJZA 5T3XD 3SDDB 3BPLB 1CD8A 2NXZB 5E6ID 4YO0B 4Z0BH 2X4SB 1PW3A 3DO7B 4Y2DC 4UOJA 2E8YA 3VRLF 2EKSB 4XPHL 3O3AB 5C6TL 1UXWB 4RMVA 1BFTA 2AV1A 3CFCH 2QHLA 1AGFB 4P4RB 1FNEA 5LQBL 1RFDH 1BJ8A 4XVTL 5DMGC 3QULB 4L1DA 1MQKH 1N7MH 3MV9E 3QQ9C 5EB9A 4CJ0A 3KXFA 1XF5A 4OIIL 1A5FH 4X4ZA 1R5IA 5JHDE 1E4WH 1P5VA 3V5KB 4PJGE 1CFTB 1WIOA 1NKRA 3BYYA 1QQDA 1U8LB 4BQ8A 1U8MB 3ZKNC 1UKSA 1MUJA 2R0ZL 4JG1H 3T1FA 5D1ZC 4XBEH 4L9DA 1AHWB 5CJXA 3EW3B 5D1XB 3SKOB 3D69A 1N64H 4KDVA 3ESVF 1KBGL 3ARSA 4Q2ZA 2FD6H 2R2EB 3AUVA 4WIQA 5J89A 1R3LA 1IE5A 4H0HB 5JMRA 2PF6A 1KENH 1R3KA 5E08L 4IMKC 4WTXA 1LP9F 2J4WH 43C9B 3E6HB 4P5MA 5D7KD 4AH2A 1MPAL 3PP4L 5C09A 4LPWA 3P9MA 5C0BE 3BT2H 1JMZA 3FQTA 1AXIB 5I1EL 1FCCA 4X98B 4Q97A 4ZUVA 5LBSL 3UPCA 5HVHC 4N9OB 1IGML 3QWOA 4N8VB 5E4EC 5TF1H 4RFOH 3TM6A 1TDQA 1IQDB 1QBBA 1V3MA 4PJ8C 5FUOL 3H3PL 3ORJA 4QRPD 5E1HB 1Z0MA 3IDMA 1RUAL 1QG3A 4XNMA 1GVIA 3QPXH 4JFEE 3OBAA 3AREB 3F62A 3LV3A 2VIRA 4UQ3A 3O6FB 1PD6A 5IFAL 4IMKA 3RY6C 5SV3A 3OF6D 2XQBH 3O3BA 4LMQI 3MCLL 3UO1H 2M1KA 3S35L 3ZHDA 5BVPH 1RI8A 1U8HA 4DEPC 1JYWA 3HZVB 4NM8H 4KZDL 2VL5B 1N26A 4OCSH 4ZFZB 4ZODA 2V5SA 3MRGB 3TCLB 1G7QB 1MVUB 1MCKA 4YHLH 1KC5L 2Q20A 3EGSA 4MNQA 1BEYH 5F1OB 5D2NE 3RJQB 3GK8H 3QPQD 2FR4B 4WENB 2C3HA 1BD2E 3TA3A 5EOQH 2CDEB 3D3VE 2GUOA 4Y4FB 1CGYA 4XVTH 5ILTL 2PXYD 2DMKA 5CEZD 4TNVF 4LVOB 1HWHB 2PR4L 4UUJB 2GQHA 1UWXH 2PYEA 4JRXD 4HPOL 4PJ9D 4C4KO 1A64A 3LKSA 5D93C 3RP1A 1OTTD 5DD5L 2FDBP 3V52H 4JPVL 3UZEA 1BZ7B 1KN2L 4FQQB 4ZYKB 4GBXA 2IH3B 4OZHE 1IGMH 4I8DA 4YBLC 3ULVH 4DOHE 3BKCH 4GRWE 3ET9F 2YPLB 2OSLB 4GQPH 5EU5A 4KPHL 5TF1L 3GSVA 3QEQE 5E2WH 1TZGH 3C2AL 4GXUM 3T8XA 2VXSL 4FFWC 4Y5XA 4UU9B 2RFXA 3LH2L 3FOLB 3IS0X 5IBLC 1DSFH 1MCCA 2Z91B 4RDQF 5CWSB 1IFHL 1YY9D 5ESQA 3EHBD 1U95A 1MPAH 2FSEB 5JZ7D 4FTVB 4GXVH 1BGXH 3MR9B 4JY5L 5GRYA 1KJ2A 5I1JL 3AROA 1TZIA 2HTLC 2GT9B 2IPKA 3T3MF 2FD6L 1B0RB 3G9AB 3OJMB 3X3GL 1ZT7A 1HH9A 3VG0L 4KFZC 1D7FA 1FFPA 4HG4K 3LKRA 4QRUB 4F7EB 4U1LB 4ONFH 1CGTA 5E9DD 3V6OA 4JM4L 4P23C 3ZHKA 2ZUVA 5J13C 3V7AG 1KLGA 3I50L 4MJID 3T2NL 5I15L 2D7OA 4X6CE 1OCWH 3DMMC 2D7TL 3OJDB 5GZNC 4GAYA 4AENA 5KAQF 3RBGA 4HW6A 1BWWA 1KG0B 1OAQL 1FVEA 3SE3A 1DTUA 4FQJH 1NMBH 2ATPA 1NMAH 2P8LA 2AJXH 2XPGB 4HWNA 2CR6A 3MCLH 3X11A 2R69H 4OD3H 3U7AA 4EOWH 5JW4M 2FWOB 5HDQL 4IDJL 4UDUB 1NUNB 2FYYA 3IFPA 2RAMA 2ADJB 4Y19A 3OKLB 3H7LA 4NZUH 4JPIA 4NN5C 2VDRH 3HCVA 1F6FB 4OKVB 2EYSB 1MRCH 5D96C 3HNTH 1N6VA 5EBLA 5D6CA 4H1LG 2OMNA 1UH3A 2P8PA 3RWIB 1K8IB 5JDSB 2O93L 1G0YR 1BMGA 4YUEL 2AJ3B 3UBXI 3SE9L 1MLBA 3U0PB 3IXTA 3B9VA 3S36L 4ELMB 4I2XA 3BH8B 4LPTA 2C5DC 5I73C 5D2LA 3KPLB 1E0OB 2Q6WB 3DSFL 1IBGH 5EU5B 4MXVF 1T1WB 1A9EA 5IQ9A 1F97A 4GSDL 1X4XA 3UZQA 5DQ9B 5ANME 1CFSA 4LFHD 3K2UL 5EOCL 3GO1L 2NZ9D 4OFYD 1XCTB 5BCAA 1MUJB 4OCNC 4R8WL 1LO2L 1FO0A 4NCC2 1IL1A 3IKKA 1JPST 1NCTA 1UZ6E 2EYRB 3HNVL 4WHYH 1P9MA 2EKSA 3CLFL 3NPZB 5GSVB 4EIGB 2BVOB 4FQ1L 5HYSB 2R1WB 1FO0L 2VZSA 3P0VH 4R26H 4K07A 1BREA 5F71A 2MQ3A 3QUZA 3L3DB 3DOSA 1MVUA 3KPTA 1H3GA 3OHXB 5DD3H 1MWAA 1WCBA 4QRPE 3MV8D 4XMLH 3VFSB 1XF1A 4ZAKA 4U2ZA 4G3YL 3HS0B 3Q48A 3BVNB 1CGUA 2HJKA 1U8JA 1F4WH 3V4VH 3FZUD 4JR9L 3JWDL 4TNWK 1A6TB 4OQTA 3M17B 2VERN 1PYWB 4K71C 4J3SA 1FC1A 2VDLH 2AK4D 4HWBA 1KYOK 4ZO7A 5B3NA 1MCFA 4P9MH 1IC5L 3JV6A 3SKMB 4B0MM 1MCPH 2Q76A 2Q3AA 5TE4L 3O6MH 2IAMB 1M6OB 4XNYH 4DN4L 4KUZH 3VFOA 2J8UB 4YNYB 3T0EB 1T21A 1DVFB 1F3JA 1Q94B 3TN0B 3K1KC 2G5RA 3MXVL 3L95B 4LLDA 1PAMA 1S5HB 2FH6A 4Z7WB 2Q86A 4UNVA 2GAZB 1FVCB 4LHUG 2FYYB 1GOHA 2ZG1A 2YA0A 5F1NB 1N6QL 3DXAB 3UJTH 1QACA 5LAXA 3T65A 4Q0XL 1OTUC 4UV4L 1FNSH 2VN7A 4D8PB 1DQMH 1KJVB 1HHGB 1U8HB 5DJ6A 4AH2B 4PJ9B 1FO0H 1K6QL 4RX4A 5DJDA 4EDWH 5D5MB 4TTDC 3QO1A 3I3EA 3RWHB 1X7QB 5FKAB 1OSPL 2XI9A 4RGNE 3RZCA 5C0FA 1Q0YL 2X09A 4F7EA 3MV11 4MGXA 1CDHA 1EEYA 1SJVA 2E7LA 3WCYA 1T6WA 3NH7L 1BQHB 2I07A 1F58H 3BPLC 1KPRB 1UJ3B 4X9BA 2BDNH 3D2UB 4B50A 3QJHA 2OXHA 4L8SB 3H3KA 1MRFL 2VC2L 4OCYH 5DJZB 5GS2D 1U3YA 1I7UB 3VXUA 5KSBB 4LSQL 3LIZH 3M1BB 1L7TL 1QA9A 3DWTA 4XVJH 4UIKL 3V6ZA 2VXQL 3NA9H 3ZYOA 1F8TH 3AY4A 3ALPA 1JI2A 2AXHA 3ZKMD 2CIIB 4XRCA 1U8OB 4PS4L 9CGTA 5IB1B 2ZPKL 2F53E 5GRWA 4HMCA 4WW2A 2FEEI 1DBMH 4IDJH 3LQAC 4XP4L 3C6SA 3W82A 1X5FA 2CLRA 4HBQA 3TWCL 3HG1A 1XGRB 3QI9B 1OAZH 3F58H 3I6KB 5DRXA 4RNRB 3PHOA 4MD4B 4NOFA 2R23A 4PJEB 5SX4H 1EHLH 3RX5A 1J05A 1RHHA 4WO4D 2VZVA 1DL7L 5DMJB 5KSAC 5J1AA 1NMAL 1AC6A 1EX0A 4DTGH 1J8HD 2FECI 3VCLB 1JGEB 4RA3A 5C86A 2R4RH 6FABL 2F8OA 4WW1A 1Y6KR 1IGJB 5CGMA 3D3VA 4LAJH 3O9WB 5BVJA 5F1SA 1CWVA 5TQ2L 3MV7D 2Q8BH 1U58A 3QCVH 1CR9H 1HXYA 3DBXB 1MCSA 4MNQE 4HUVB 4DGIL 5E99H 4MQTB 3BAEL 3K74B 5F7YC 1XGYH 1CG9A 4A6YL 4O5LH 3PP3H 4YDIH 2FECL 1WV7T 4MA8L 1C5DA 2NY5C 3DGGB 3P0GB 5TPWH 2NMSA 5TE6L 4Y5XB 3LD8B 3V9FA 4CW1B 5DD0L 4U1SA 5IK3B 5SWZA 4LSRH 3UBXG 5BRZE 3MUZ1 3QDHA 4GMTL 1BBDL 4JFFB 4NNYA 5K9OB 2XXCB 1WIPA 3C2AH 1D9KD 4HWEL 2NPLX 1HZHL 4FFYH 1N2RB 4UAOB 4YXKL 5KVGL 5GHWH 3ZTNL 2JK5A 4LSSH 4LOUC 4PD4J 1GC1H 1ZLUK 2YPVH 2OR9H 4C57C 1YEHH 1RZ7L 3VXQA 1KN2H 3KPPA 3QI9C 4D94A 1KEMH 1EERB 1ZS8B 2C3VA 3QZWA 4LGRB 5DD5H 4OFDA 4M48H 5CINH 1KYOJ 1SVCP 3L95A 4HWBL 4J12A 4OGXH 3WNLA 3QRFM 4P46D 1X5IA 2B1HH 1BJ1J 1B4JL 3WHXA 4WFGE 1FZJA 1IM9B 1NGXA 3QB7C 1TPXC 5GS0L 1FGNL 2OP4H 5D7IA 4IRSA 1IAKB 1ZT4A 3ZKXC 3NA4A 3BKYH 3RY6A 4MXWL 5JHLL 1JIBA 3IDMB 4C56B 3P4NA 4P2CG 2FWOA 4K55A 3UCRA 3VJ6B 2LVEA 4KMTH 4PJDF 1JZ6A 1JWUA 3SGDI 2R1WA 3HMWH 4PJHF 1AGDB 2EIBA 3ZL4H 1KGCD 3ILQD 2YXMA 3IFOA 3VFUA 5E2TL 5KJRL 1H3PH 1INDH 5C0DA 5CUSL 2JJSA 3IJYB 4YC2B 4GAGH 1YC8A 4NP4H 1P4BH 4JFDA 4HJ0D 1ONQA 3CPLB 4KROC 1WUNT 2WQRA 4G6ML 4RFNB 1XGTB 3TGXA 4HIHB 5F88B 4O51A 3QPXL 5AYUL 1L0YA 1G7QA 3HA0A 3DECA 1EHNA 3X14A 4PJFF 3U0TA 2Z8SA 2IWGA 1HH9B 1J87A 3MBEB 4NQTA 3QIWC 3P0YH 4OB5L 5HDBE 3MRRA 4MVBC 1EHXA 1MHEB 3S34L 4U3HA 3LCYA 1Q94A 1F4XL 3JTTB 2G5BB 5FGRA 4RGMB 3TN0A 5JHDB 1GYAA 1O7VA 1EDQA 1FC2D 4LCWA 3FTGA 4LCCA 3EDKA 1I9IH 1C7SA 3VXUD 4X99B 5K9OA 3REVA 4Z95H 1FV1B 3QNYA 5DA4A 3C08H 4LCCC 1YQVL 2ERJC 3RGVA 1JZ8A 2ITCB 3V7AE 3GKWH 5HI5C 3VWJD 4YZFF 1FDLL 2I9LA 1Q72H 5DEZA 1P4IL 1IC1A 3KJ4B 3V2AR 2QSQA 4FABL 3CFDA 1YDPA 1QFHA 2F54D 5DFVD 1IGYA 3W0WA 4NQEB 1GGTA 3FO9A 4TSAL 4YHOL 5D6DC 5ISZA 2JJSC 3OKEA 1A4KB 2VAJA 4G8FA 3U6RA 4ZO9A 1D5XB 5EBLB 2R0ZH 2DL2A 4XC1L 5C0BB 5BVJB 2I26N 3L6FA 2XA8H 3QG6B 2I9TA 5EIIA 3B2UD 3ARDA 1JBJA 1JTTA 4HK3J 4CJ1A 2HMID 1J1OH 5GISL 1HINH 3ULUC 1MCJA 2EEDA 4ZDHA 3RVTC 1JWUB 3MRLA 4X9IA 3UJIL 3A6OA 2ORBL 4QRUA 4JY4B 1WITA 4MQ7B 1NC4B 3QDJB 5CJXC 5IROC 4IMLA 4LSTL 4NFCA 3V79C 5IFHL 1O0VA 5EUOF 3T0EC 4BSVA 4ODTL 4JFZH 3DV6B 2EYRA 2IG2H 2F9BT 4F7PB 1P4LA 1Q9OA 2CJUL 3KYKL 2X9XA 2AI0L 5FECA 2VL4A 2Z4QB 3VH8A 3RUGA 3UAJD 4Y89A 3TO2B 1EZVX 4L29A 1U8IA 5E24E 5JOFB 4NQCA 4F7TA 1L7IL 1T1ZB 3RBSA 1MCWM 3MBEA 2BK8A 1CD9B 1EXUB 3EDDA 3RA7H 4A6YA 1J05B 1RHHB 3SGJA 1YY8B 5SWSD 4QTHA 4TVPH 2J6EA 2VISB 3BVNA 2BY3A 4APQA 4XWGL 1M71B 3DRTB 1T1YA 4Y4KC 1YPZE 3D3VB 4JG0L 1FLRL 3RI5K 4YHML 1KCSL 1ZVYA 3ZYJA 2A73A 2YN5A 1PG7X 5CEZH 1S3KH 2NY6B 5CJOL 3BPOC 5B22A 3C8KA 3SDYH 3DIFB 5B39G 1DQML 1VADB 3O45B 2GITA 1A7PH 3RWCB 2G2RB 5DDHB 1OTSC 4XH2A 4WEMB 3NCFB 3OR7A 1YJDH 3UJTL 2GUOB 5IIEA 2VDOL 3SEPA 1RZIB 1IAOB 2NY7L 4K3DL 3QIWD 4HAGA 4FN0A 3F7PC 5GRXG 4AZ8A 2E9WA 4JQIL 1IGFL 3SDCB 3O11A 1FP5A 4JFDB 3OMZA 1I1AC 4XZUB 2GTWB 4KH2A 4E9LA 1WF5A 3LRSA 5CGYC 5DUPL 5DUPH 4D0CA 2W60A 3C5ZC 3IU3B 4OCLC 3MLUH 1G9NC 2AEQL 4HT1H 4JFED 4KK5C 3KJ4C 1Y6MR 1U3HA 4BQCA 3WO3B 1U6AL 4F2MB 2QKIB 1FFRA 5T1MA 4WO4C 2OYPA 3FB7B 3KHQA 3L5XH 8FABB 4KGLA 1KJ2B 2YUVA 1N0XH 3N0PB 4NKOB 3X12B 3RRQA 2L7UA 1JL8A 2DQFB 1YJDL 4JZOB 3HNVH 5HDOA 4JHZA 4HIJA 3LPGA 3ZT6A 3FFCA 4LLDB 4JFQB 2HFEA 3FQRB 4JFEB 2GKIA 15C8L 1NC4D 4YX2L 4CKVX 4KTDL 3VWJA 2XG5A 4FG6C 4U1JA 1NSNH 4Y7MA 5HTSA 5IVXE 2PKDA 3IGAA 3B9KD 4K7PY 4L9LC 3KNBA 1MCRA 3ZE2E 2ICWA 3N9GH 4PJHB 4AQ1B 2R2BB 3P11L 1OP5H 3OJ2C 5EOTA 1VADA 4F3FB 1TVBB 1XT5A 1CFQA 4PB9L 1DDHB 4BFEA 2WM0A 3LS5L 3VGHA 4PJIE 4TULL 4MNHA 4XCEB 2ARJB 3T08A 4NQDD 4HIXL 5C9KA 3O81A 4NBXB 2AI0H 5JXAH 1L6ZA 4ZFOB 2ADJA 3MLWL 5FO8A 5HPMB 4FQXD 4UDTA 2EYSA 1WBXA 3ZKXB 1P4BL 4KUCD 3BISA 2A6IA 2VRAA 5KVEL 5EA0H 5F7HA 3BO8A 4YWGL 3P4NB 1QSFE 1UEYA 4XXCA 3QFJE 1NCCH 3VFTB 2DLGA 2BHYA 5E94A 4C55A 5D7SH 2ED7A 3RGVB 4X7DC 5DVKA 1MFDH 2YPLE 2O5ZH 3BPCB 1RZJH 3BWAB 5FECB 2LU4A 3PL6A 1KCUH 1QR4A 3B6SA 5BRZD 3WFBH 4BK5A 5SWZE 4R7DB 4YR6B 4PJEF 4NQCB 4TN9A 4F7TB 2R9HC 3ARED 3RNQA 5IEKB 3SCMD 1VERA 2AABL 1LK2B 4X6DA 4XNXL 3BJ91 2EDOA 1FZKB 2B5IC 4DW2L 4LVEA 3C5JB 3VG0H 2B1HL 4NN5B 3TH3T 4L3EA 4PV9A 2OS7A 1RJYA 4YFLI 4NCDA 1WZKA 4GW5B 2F74B 2P42B 1XGUA 3BDXA 5AG8A 5CEZL 5FUZH 4IM8A 3IDJA 5D7JB 2IAMD 1YY9C 5AD0A 4JCLA 5FCSH 3TNNA 4DCQB 3DI3B 3OXRA 4M4RA 4JGUA 3TESA 3O2DL 2SEBA 5EORL 4D0DA 4Z7WE 2ID5A 4HZLB 2UZIH 5JR1L 4PJDB 2CSPA 4DKEH 1RMFL 2OM5A 4XMPL 4XVUC 3TJHC 1A02N 1EAPA 4I0CC 4X6BA 1TMCB 4JPKH 4WI9A 3CX2A 3SDCA 4LLUB 3NZHH 2NZIA 3I3DA 2DQEL 5KVFL 1XH3B 2X70B 1U8NB 3CCHA 1F90H 1ZOXA 4L8BB 2V5YA 3I02A 1AIFB 3SGKA 4DN3L 3FB6B 4YDIL 3RPKA 1QSEA 2X1WL 5CD3A 4ETYA 5DVNA 3EOTL 1NFDA 3ULVD 1FVCA 1OAKL 5E6IA 5CZVH 3D39A 1HHHA 1Y18A 5IFHH 1A3LL 4D9QE 4UILL 3L6FB 3VGEA 1A3RL 4FFVD 4QT5A 4HIEB 2CK0L 1UH4A 5FYJL 3K4DA 2DKMA 1S5IH 3NAAL 5E94B 2X4TB 4HJGB 4JB9L 2CLVA 4YZFE 3MGTB 4CADA 4YEFA 1A7BA 1ACZA 1MEXL 2R0WH 2H9GA 2J12B 4OD1L 3QHTC 1RK0A 3TYGH 2XA8L 3LQZA 4J4PD 4Y4KA 4LLQA 3LS4L 4I2XE 2AJUL 4OZFH 5E4EB 4P4KD 5ESQB 1E28B 4KK6D 5DK0A 4MB4A 4QKXB 4LQFL 4KVCL 2WW8A 1JPSH 1RZKH 5F8QC 2BC4B 4P2RB 1TFHA 3I75B 1Z6JT 1S7VA 3S5LB 4ELKA 5I1DB 5HDLA 5FYJU 3T0BA 4X80L 1M7DB 2I27N 2VLKD 5IVOA 2IPUK 5BV7L 2F53B 1FGVH 1NCBL 3NVQA 3MBEC 4UIMB 3CMOL 1ZV5A 1BVKA 2PTTA 3AS1A 3HZMA 1H0DB 2ZCHH 5J9PA 4Z76A 3MACH 3KR3H 3VFWB 1U8OA 1BX2A 4GKNB 2SEBB 4Y5VB 2H2PD 3QZWG 4L3AA 2EKJA 2AKRA 1UXSB 5TE6H 3RNKA 2LAAA 3ARDB 32C2A 3DX9A 4MA8H 3I6KA 4KY1L 5H8DA 1FFOA 4P46B 1DN2A 2M8XA 5F7WC 4GS7B 4QOKB 4XP5H 3VFTA 2YPLD 1A0QH 1LNUB 4G6KL 5C08E 3D85B 4BK4A 2Y9RT 3BXNA 3E1F1 4IOIB 5D1QD 1QKZH 1EUUA 4OZ4B 4RQQA 3EYFB 2RQ8A 4I48B 4RAUB 3A6BL 4QRPA 2NCMA 1MFAL 1EJOL 2P5EB 5CUSH 2V2TB 1OAUH 1MNUL 5D1ZD 5D6DA 3DXAE 4MA7H 1DE4B 2G75A 5E2TH 3EJYC 4WTWA 3MCKB 1FZOB 3H3BC 1QFOA 3CUPB 5J56B 4HS6A 1FSKC 3U0PA 2C1OB 1SHMA 3ZT7A 5J6HA 35C8L 4NQDE 3BW9B 5E70A 1ZWIA 2V7HB 5SWZD 1FNAA 3ARFC 4MD5A 5EU3B 2VDPH 1NGZB 1UT9A 2BSTA 4KKBC 5C0EB 4JO4H 4JRWA 5K59F 2Q7YB 1B2WL 4S2SB 4HZAA 1XF4B 4Y4KB 4FFZL 3ZDXF 1NC2B 5B38A 1GOFA 3RVUC 5GS0H 5EO1B 4JRXB 5BS0A 3J7HA 4R4BA 1GZPB 3DUUA 5HHOE 5IWLA 4M8QA 3OX8B 5DR5H 2JB6A 3HHRB 3O2VH 4FQCH 4PRPA 3MLSL 5T3XH 5EG6C 4R90H 5C07D 4WUUD 4CU7A 3REWA 1HHKB 1GGCH 5HHVH 4X6FA 3UC0L 5I75C 1FRGH 3GKZA 4PJ9A 3P9LB 2VITB 3STLA 1U8KA 4WWKC 1MRFH 2X40A 3PL6B 5JPMB 3QO0B 4FRWA 1ACYH 3GMPA 5GSRB 5E8DL 3IFNH 5AZ2H 3BUTA 4Q9QH 3ZDZF 4X6EA 5H94B 4QNPF 3WFEL 5SWSB 5HI5D 1F3RB 1NBQA 1E4XL 4KJWD 5HD8D 2CPCA 3KXFD 1T4KB 3L3HB 2F5BH 2Q7NA 1I9JH 4QOKA 3ABZA 5K9JL 4O5LL 2OR8A 4ZFOA 5C07B 3OKNB 2GTZB 4BZ2L 2CDGA 3MNVB 4UTAL 3O3UN 1QLRB 5IWLC 2XZCL 4XP6H 3EAKA 3MGOB 4JO1L 1G84A 3DXAA 2WLZA 1TXKA 5K9QI 2QSCL 5MENA 5AZEL 2VLLA 1A7NH 2VO5A 4PRBB 4NDMB 4WGWB 3GSQA 5D1XD 2R4RL 4HIHA 5F88A 3TVMB 4CRPA 1B0GB 5EU6D 5GGQH 3QIBD 1FCGA 4PP2B 1JRHH 3PGCA 3FFCB 1AH1A 1UEMA 1P7KA 3GSXA 1U8LA 2Y07H 1IC5H 3AU1A 4GFTB 1NEUA 1OB1B 2FEDC 3PNWB 5HGAB 1KTDB 1OWRM 3CSGA 1S7UB 4ODSH 5BRZB 1VA9A 3B9EA 4PS4H 4DUXA 5DXWA 3NACH 1BFVL 5HYSG 3RL2A 5JIPA 4PRAA 5IW6A 4XCCH 1IGFH 5DD3L 2AJVH 3DX8A 1A7RH 3WFCH 1X5KA 4Z5RB 1I3RB 3GSNL 4IS6A 1HXMA 1RZFL 4LLVA 5TDNB 4Z6AT 3BD5A 3IB4A 5K59E 4G9FD 5E2UL 1BQSA 2WMPA 5MHSD 3BP7B 5A2IH 3T4YA 2YRZA 2JJTC 4Y4FA 4YBLB 1VFOA 1QNZH 3LKPA 4O2FA 1VGKB 1B6UA 2HAZA 3T0ED 4PRNA 4WVRA 4WHTA 1CBVH 5JO5B 2N4IA 3PHOB 1ZSDA 2X4PA 1XF3A 2LTQC 5H2BB 5BW7C 3HC0A 4M61B 5FKPA 3SDCC 4XGZA 2GJ6E 2AGJH 1ZWIB 1JUFA 2I5YH 3QUYA 5DMIH 1CT8B 2NTFB 1ZT1B 1NDMB 4GQ9L 1FNFA 5J7CC 4LP5A 3V52L 1BF2A 4YDVB 2VZ1A 5BMFH 5I1AB 4HC1H 5J1SC 4IMLB 4G7VH 4P4KB 1TJGH 1PEZA 5HVFB 2V2WA 4JRXA 3MOBL 2OK0H 5FIEA 3OZ9L 3P30H 5I1CL 4M8QB 4CADB 5D7LD 4X4XA 5BV7C 1S7XA 3MRPB 4PGDA 1WWBX 5L88H 4LPCA 5JW5A 3RQ3A 3BX7C 1KIUA 3V0VB 4G8EB 1HKLL 4NKDA 4OCMC 4OCRH 4OV6F 1J1OL 3VDAA 1IVLA 1DLHA 3WLBA 4RDQG 2FJGB 5C09B 3FAWA 2VWEE 4P5TD 2AEPH 4XNQA 5KSUA 3CGTA 5JXED 1QEWA 2Z8VC 5IEHB 2V2TA 1PY9A 1BVZA 3V8OA 3I50H 1T0MB 2DLFH 3MCKA 2NX5E 4PJFA 4ZUUB 2F54E 1I3RA 2X70A 4HGWA 3Q6GL 5HGBA 5DJ0B 3HLAB 4AK1A 3UTQA 4P2QA 5IHBA 3HZKB 5DMKB 3ULSA 1UG9A 1Z3GH 2AVGA 5JW4N 4R8WH 4E5XA 4ORZC 2Q7YA 2RFXB 1JK8A 1QLRA 3I3BA 2B20A 1MCOL 2KDGA 4QT5B 1YQVH 5JORB 3RTQD 4ZFGH 3MRCB 3WKNA 43C9A 2KH2B 3QUML 4DFHA 3CDYA 3O4OC 4XPBH 5AWNL 2VABA 1QFUL 3NCEB 5HHPB 1KPUB 3OSKA 5GJSH 4RQQB 3MFGB 2J5LB 3K8MA 3P40A 1CE1L 1FL3B 3MBXL 2I9LB 3U36A 2BP3A 4HFWA 1ZLVH 2CGRL 1LILA 1QRNB 2DQTH 1KENL 2EIZA 4IIQA 1MFEH 1V7MH 3MV7B 1G6RB 4KVNL 1RJLB 2VZ3A 1S7UA 4IEFB 4LHUA 4DKDC 5EOQL 3U6RB 1WZ1L 5F72S 5C92A 3IAPA 2DM4A 1H3PL 5IVXB 1R0AH 2ZUQC 3NCJH 1YNLH 3O6LH 5EFIA 1OP3K 4BSJA 1HXMB 4KHTH 5D1QA 1IC4L 4NPYB 3FB8B 3D1MC 5J11B 2DIBA 1F00I 4PR5B 2ZSWA 5KN5A 1HEZA 1HHJB 2OMBA 5LCVL 4WO4A 2R8SH 1HXYB 5D70H 1YPZB 1ORQB 4PJIB 1IQWL 1FVDB 2RBLA 1IMHC 3H9SE 5FM5O 3VW3L 3MLVL 3PABA 1M7XA 3NTCH 1B4JH 3EOBB 4M02A 4MMZC 4ONGL 2XTJC 5L8KB 3WIIL 3T0EA 2V17L 3T3PE 4GAFB 5DF0A 1TJGL 2X41A 1PZ5B 4RMUA 5J3HC 4BFBD 3HLAA 1JGDA 4PJAB 2P5ED 4TSCH 1QSFB 1T1WA 1YYLL 2H3NB 3QO0A 3C5SA 2X4OB 1OQXA 4XX1G 1W72H 1UA6H 5D93B 1KN4L 2KBGA 1MCEA 1QO3B 3LKSB 3W39A 2KPNA 1NKOA 4J6RH 3ARRA 3WS6C 4HSQA 4EDXB 3BE1H 4JFDE 4HGKC 1BBDH 4NNXB 3DVNA 3RVXD 3VFVB 1DQLL 4U7MA 2BVOA 3MUHL 3OKNA 4ODVH 3P73B 1K3IA 3SE3C 3C8KB 3T8XB 1YEEL 3ULVC 3P77B 5MEQA 4F58L 1DQQA 3DI2B 1KIQA 3VFSA 4YHIA 5E1AB 5E6ZA 1U93A 4IIQB 1MHHA 2FX8L 4GG6E 4DEPB 5KSVA 3TT3H 1S9XB 3RVTD 5I1LB 3IF1A 5T1DH 4AEHH 4K2UH 3PGDB 1MRDH 2NY0B 3OXSA 3L7FB 4MJ5B 4P23A 3MJ7A 2HFFA 3UEZA 4Z7VA 1B9ZA 3GMNA 4TSBH 1ZXQA 5C70A 4MMXC 2J8UA 1J8HE 4YNYA 4P46A 3GSXB 4TNVK 3S37X 4M9OA 1T3FB 5CBAA 2GJZA 3X3FL 4KZDH 1LDPH 1MREL 2HRPH 3QUYB 1T04B 2W59A 4Y5XC 3ULSB 3HC3L 3MQIA 1NQBA 2QHRL 2D7MA 4GKSA 4NQXB 5B8CB 1CICC 3LN5B 5ID1B 1TJIH 2R0KH 4EI5C 2P8LB 2BOBB 3BKJH 1NGQH 4RRPG 1DUYB 3CLEL 3JTSA 1Q9KA 1I8KB 4RAHA 2NQCA 1NBYA 4E41D 1X5GA 5I1IL 2ZUXA 3IDXH 1CU4L 3TYFB 4U0QB 2FHBA 4RRPA 4UV7L 3WO4C 4ZNCD 1BVLA 3LIZL 5F1KC 5FM8A 2XACC 4D3CH 5KG9A 3FO0H 5E5MB 1T20A 3TT1L 3MUY1 4P2QE 2XG4A 3FAXA 4KXZH 2H1PL 3QFJD 1I8IB 1MY5A 1U8JB 3U0WH 4HUVA 3MRDB 1GJIA 3MPCA 4G43A 4NJ9L 4I2XB 3DETD 3QDGB 4YPJA 4FQIL 4HUWA 1PSKL 1PSKH 2Q8AL 3RL1A 2VB5A 4JLRA 7FABL 1LEIB 2HWZL 1S9WB 4I4WB 4K9EL 3SDDC 3VE0A 2A38A 2R29L 2HG5B 3CFEA 4WU7B 5B21A 1Z9MA 3HMXA 4MDIA 1CFQB 3RWFB 4WEBL 5A2JH 2B2XH 2H2PC 1K85A 3GSNH 3TVMD 1F4YL 1IL1B 4O00A 4RBPK 3WFDL 4Z8FL 1B4RA 3IF1B 4JFHD 5ISZE 4JZNA 3SKJH 2A9NH 1WAAA 1HHJA 3T04D 1ZVHA 4Q0XH 4KDTA 1NCNA 5B38G 1RQ5A 3PDGA 3SPVA 2AW2A 4NZTL 2WWKO 3QQNA 1FYTE 3MO1B 4FFWD 4R7NA 1CICD 2R0KL 3ARDC 4IOFD 4Y2DB 3C9NB 4NJAH 1N7ML 4ZOCA 4RA0C 4Y4HC 4L9LB 3M17A 2Z8WC 3LD8C 4S1RL 5C0ND 3HB3C 1Q9LA 2ICWB 2C4FT 3RKPA 5J12B 3WFZA 1DUYA 2EXYC 2VWEC 3GSOA 2P5WA 4AMKL 1A9BA 3UJJH 3VA6A 4HFUL 2FJFB 1E6OH 5ICZB 1RJYB 2H2SC 2XZCH 4ISVA 5ERWA 3QNZB 1OLLA 2CO6B 4EN3D 4U1IA 2Y36H 1OB1A 5HPMA 4LP4A 4NQDB 1GPOH 4ZSOE 5I1AA 3QUMB 1CK0L 5J11C 5C2BL 1WGOA 1BAFH 3OXRB 5E7FA 1MCLA 1HEZB 3CFKA 3ZKND 4YHYB 3GEWB 5GRZA 4IRSD 3MRDA 3GSNA 4XB8A 1G7IA 3IU4L 2XWJB 4IRJB 3KPSA 2ZSVB 1A14L 3U7WL 4F9LC 2XYCA 1J86A 3BE1L 2D03L 3LDBB 4GG8B 4E42B 1YEJH 4LGPB 4Z7VF 5HYJA 1KJ3L 2OBGA 5E8NB 4ZOEA 3ZLQC 4FP8H 2EEBA 1AGBA 4F80A 4TOYH 4OQTH 2BVPB 1G7PB 1CGVA 5EULV 3D39D 1KULA 3RU8H 3UTZB 1XZ0A 4P2RE 4XNQB 1HHHB 5DT1L 4Z7QF 4RWYH 3EDEA 3JV4A 4DJMA 3CU7A 1P7QD 5ICYA 4S11A 2ORBH 4OZGF 1Q9KB 1UYWH 5D1QB 3N1MC 4OD2A 4DK3A 3BDBA 5SWSE 4DAGL 2BHUA 1A1MA 2EC8A 4XAWL 3MRQB 4ZFFA 3KYOB 3QIBC 3CVIL 1X5LA 1LDPL 5IF0A 3T0EE 5L7XL 2OXGA 1ZVSB