3MLXL

Crystal structure of anti-hiv-1 v3 fab 3074 in complex with an mn v3 peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
211
Chain Sequence
b'SVLTQPPSVSAAPGQKVTISCSGSSSNIGNNMVSWYQQHPGTAPKLLIYENSKRPSGIPDRFSGSRSGTSATLGIIGLQTGDEAEYYCATWDGSLRTVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVRAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab light
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 211
sequence length 211
chains with identical sequence M
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlxL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlxL01
1MFEL 1CFQA 5E6IA 2UWEA 4CVWA 3CUPB 2WIMA 4D2NA 3GMOA 3OGCB 1ZVSA 3BPOC 4LARH 4JFOA 4DK6A 5KS9E 1J05B 2MNUA 4M7JH 5T3ZE 3MNVA 5DRNB 1BFOA 5DD3L 2SEBB 3V95A 1QBML 1HHIA 3QEGH 3QDGB 4R97C 4PB9L 2ZCLL 3DIFA 4L4TA 1YY9C 3ARFB 3D85A 1E4WL 4XMLL 1ORSB 5I19L 1PQZB 2HFEB 4RFOL 3SDYL 1B0GA 3QISA 1HHGA 1DSFL 1I8IA 3VXTB 2J8UE 4RMWA 1AGDB 5GSVB 3LRSA 3HZVA 1FO0L 4K23L 1G6RL 3BRGC 3H9SD 4JFPB 3O9WD 4MJ6B 4OZFH 4H8WL 5C07D 4X7CC 3IYLW 1AY1L 4NM8L 3UZQA 1VB9A 3FQNB 5KS9A 2EH8H 4RCAA 1K3ZA 4HJGA 4DGYL 1ND0A 2NYYC 4TTDD 3I2CL 4BUHA 43CAB 2XKSA 2J7LA 2PETA 3SE4A 1PYWA 1YMHB 2CO6B 2JCCE 1IL1A 3WYRA 5D71L 3MBEA 3BQUC 4FXKA 4FMKA 4ALAL 3ULVL 3ILQC 2MKLC 1U3HC 1Z6JT 3LEVH 5EUOA 5D7KD 3I6KB 5E2WL 2YN3A 1JGVL 4MD5B 1N4XL 3P3YA 4GFTB 3MMEA 2E3VA 1UCBL 1BLNA 1JPST 3E8UH 5EC2B 5ISZE 4YHZH 2FCBA 4PRNB 3GMMA 3HMXA 3H9YA 5JA9A 4J2XA 2WBJC 1GZPB 1N5AB 3BKJL 2H3NA 3EAKA 1IGCH 3MRNA 2P5WE 5GS3A 5J0BA 3WIFB 3AY4A 5J57B 3FL7A 3FB7B 5MHSE 1RZGA 1NUNB 3GKWL 1V5JA 4O51A 1WV7T 2YBRA 3W0WB 2V5RA 2OSLB 3DX6A 3L3DA 5GS1B 5B38G 1ED3A 4JRXD 3HG1D 2EDFA 2PO6B 3EYFA 3GO1H 3ARBA 2QQLL 4K9EL 1CLOL 3FO0L 5ISZA 4ORGB 4LVOC 2R56H 1UZ6F 4Y4KC 5GRYA 4XP6H 3STZA 3CMOH 2AJYL 4GBXD 2BDNL 2VKWA 2VLJE 1G7JB 3VXRB 4P59H 3QDAA 2P5WA 5GZOD 3MREB 4PJ5E 1C5CL 4ZQKB 5CSBA 1MOEA 3G5VB 1WAAE 1D7FA 5EZOL 5I73C 3SKMB 1HIML 2NXYC 1QSEB 3OKKA 4L9LA 4ODWA 2ICWB 3QWQB 3MA9L 5K59F 1YN7B 5TGBB 25C8H 1DZBA 2RIKA 1EEZA 2PR4H 3UC0L 4XXCC 5J1AA 3KPMA 4P4KD 1INDH 2DTML 4L4JA 4KZEH 2WWKT 1ONQA 1ZXQA 1HHHB 3ZE2F 5E1AA 1CD8A 1DDHB 1FL5B 1XIWB 4D0CA 4X0KB 2XV6B 1WFUA 4U05A 5DEFA 3Q5OA 5HDBF 3EO9L 1QOKA 3MJ9L 4PGDA 1A1NA 3GSXB 3H3PL 4JN1H 1WAAA 4K3DL 2RR3A 4U7KA 4QCIB 3WSQH 3GMQB 2GJ6E 3VFWA 4NRZA 3L7FB 1RJLA 2FL5A 1S8DA 3ETBF 1CDYA 4QRPB 5D2NB 5JXAH 1WVZA 1QYGH 1RUML 2I60H 1TENA 3UTTE 3MV8E 1C8PA 3HB3C 4UQ2B 3RY6A 4Z7UE 3U0WH 3CFBB 3QDME 1F6AB 4GW5B 3TBTA 2D31B 5CFHA 1DBML 3O3AB 5MI0C 1D9KB 5DC9B 5DQ9B 5IEHB 2X10A 4EUPG 3CDFA 4RQQA 2FLRT 3V0VA 1L6XA 4IRSD 1K8IB 2I25N 5EWIH 5IMOB 3W9DA 3VWKC 1CDUA 3GHBL 1G9MH 2BVOB 5DA0B 3P30L 4X4ME 1MQKL 1NH6A 4PUBH 2GJ6A 5TF1L 3CX5K 5KSAB 3IFPA 4JFQB 4PB0H 3CDGA 4P46A 4A6YA 4ELKB 5DQDL 3BO8A 2OP4L 4H88H 3UTSE 2YOCA 1JNHA 4TUOA 3EZ8A 1LO0L 3UTTA 3MV8A 1JNJA 1U8LA 5CEYB 5KZCB 3B83A 1NFDE 4Z7UA 2FWOB 5DJZB 3QDMA 2R0KL 4WEBH 5I2IA 3PIQA 5LWYL 1YEFH 3HZMA 2HTKC 2NY5C 3CVHL 1KPRA 2HJLA 1JHLH 2HKFH 4RFEB 2B1HL 3LPFA 5MERB 3TBSB 2F19L 1KEGL 4OM0L 4LVNB 1U9KA 1KT2B 3WNNA 3KPNB 4KVNH 1YNTA 3OGCA 2QSVA 4X4MA 3E6HB 4FQCH 2V17L 3FRUB 4BKLB 4XPBH 2HH0L 4OUOA 5HY9B 1MAJA 1J05A 5I30H 3UTSA 3QHZH 1MRDL 1Q9WA 1NFDA 2XKNA 3R4DA 1AKJD 4Y19D 2XZQL 4PIRF 3ARFA 1ZLSH 4PG9A 2ZUQC 4M9PA 1ORSA 4GQ9H 4Q0XL 2FB4L 3RDTA 5GSVA 2ADJB 3QG7L 5D7LB 1N5YH 3ZKND 3RHWK 3P4NB 1H8NA 4MJ6A 1MCPL 2BCKB 3MV7D 5TJWK 2DQIL 2O5ZH 3FQNA 2R2BB 2QSTA 2ED9A 5E9DB 1L0XA 3GK8L 3MLUL 5MP6H 2QHRH 4QOKE 4KU1A 1I8LA 1K8DB 1PBYA 4QWWD 4HULB 4RBPK 2IPUG 5B39B 1KB5L 4G6AD 2V2XA 1CXFA 1LNUB 1AC0A 1EO8H 4K94H 4U0RB 2J2ZA 2X70B 4U1JB 1P7KB 3HA0A 3IDUA 2VJXA 1M05B 5F9JB 2GI7A 1SYVA 3GBML 3I6KA 4YE4H 1OGTB 2BVTA 4NZJA 4NRXA 3GJFK 4YHYC 5J12C 5C0RL 4XTRC 1RU9H 1N0XH 5T3XE 5DLML 3NOIA 5EC2A 1P5VA 2MCPL 3WFHB 3EOBB 1R24B 5IGXH 2LTQC 5D93C 4QOKA 1GZPA 3O11B 1OSPL 3RZCB 3M8OL 4RMRA 3GSOB 3ZTJH 3C6LB 5D70L 5GS2D 1RJZB 3D3VB 3VFPB 1AGFB 1CDIA 1AP2B 1UWXK 4HUKB 2BVYA 2OSLA 3ZDYE 1S7RA 2RQ8A 5GS1A 3WFCL 1DL7H 2VN4A 4WTZA 2BJML 4DOHB 2ADGA 3T3PE 2APWA 4ORGA 3QCVH 1MVFA 5I66A 4YEFA 4HBQA 5EBMA 4HJJL 2YK1H 4NC1C 3VG9C 1G7JA 3PWVB 3FAWA 4G8EA 3VFVB 3DROB 3PWPB 1JRHI 3MREA 4ZQKA 1DEEB 2JJUA 5I1CL 2CK0L 3G5VA 1A9EB 4KROC 5ITBH 2Q6WA 1QPXA 2E6JA 1YA5A 5I75C 5CILH 4X6DE 4LPTA 5L0QC 2AJ3B 3O3EB 1YJDH 1YN7A 5TGBA 1JI2A 5DDHB 2EO9A 2DLFH 2NY2D 1GGCL 3CCHB 4R96A 4JO2H 3SGEH 3FOLB 3FT4A 3JWOL 2YPLD 1VEPA 1FL5A 1XIWA 5DVOA 4YQXL 1FFRA 5FB8B 4R9HA 1XGQA 2Z9TA 3GSXA 3QUYC 3TNNB 5DD0H 1DEDA 4JRYE 5F6IC 4Z7WF 4GRLD 4NCC1 3VWJC 3O6FB 4GH7B 1BD2B 2AABH 5E2VL 3RVVD 4QRPA 4J3SA 1I7ZA 3RU8H 1IZJA 2JB6A 3EJJX 4ZPVB 2EE3A 3BN9C 1F6AA 2IBBA 3DYPA 3ARTA 3O3AA 1EHLH 3D6GA 5DQ9A 4QNPE 2ZJSH 3P4MB 3WN5C 5CJQL 4JKKA 1AXSB 3MRLA 5IMOA 2DQHH 4JRYA 5L9DL 5CUSH 3CFJB 3A67L 4UDUA 4JG1H 4HWZA 5F7DB 1BM3H 4D8PA 3WLWD 4JFQA 5DTFB 5I18L 2AK1H 2CLZA 1AD0A 5FV1L 2H8PB 3DXAD 3PL6B 2CMRH 2FWOA 1MRCL 1ZAGA 2C26A 3LQAC 4OB5L 1F2XK 5BVPH 4JANB 1MCKA 1CXEA 1V3MA 3HAEA 5CHNB 5MERA 3BWAB 1CL7L 4HKJB 4MMZC 1JPSH 4WV1B 3S4SG 5JNYA 5INCA 3BZEB 3R06B 3BZDA 1KPUB 4XX1G 5C71A 3KPNA 3TIEB 2DKUA 2OTUA 2H6PB 4AEEA 4BKLA 4FOMA 5HY9A 1JRHH 1C12B 4U6HA 4JPWL 5D9SB 1EPFA 3VGDA 5T1LB 4NQDD 1ZTXH 1CTNA 1A2YA 2O5XH 5CS7A 1RJYA 3JTTB 4UT6H 1SM3L 4CDGC 1FYTD 4NQTA 4FABL 1MI5D 1HWGB 1OVZA 1KJ3H 4UZGA 2ADJA 2CUIA 2GIYA 4E5XB 4RAUA 5DC0A 3S36X 5HGHB 3P4NA 3GSUB 5JHDB 1OWRM 5JA8B 3DRTB 3VXME 2EDYA 2BCKA 3THMH 1MCOL 5DHVB 3F58H 4PJIF 2DQEL 5CMAB 4M62L 2R2BA 3CFDB 2YRZA 3D18B 5E9DA 5HGDB 4HXBH 2BC4B 4S0TD 3EO1B 5IVXB 3R8QA 4JFFB 4K55A 5IB4A 5ILTH 1GGTA 3SQOH 1LNUA 3KJ6H 2X70A 3MLYL 5GS2H 4U1JA 1P7KA 4JFDB 4LPVA 5FGRA 3PNWB 5F9JA 3BH9A 4YEEA 1OGTA 2N4IA 3VXMA 5F7YC 1H3GA 4MXWL 5L7XH 4WNQB 1A6WH 4Q9CA 3ZL4H 4OZHF 5HYSG 2BY3A 3OKMB 3AMKA 4O2FA 3WNKA 3T8XA 3HZYB 4HCRL 1G7PA 4U6XB 3EJYD 4JAMA 3B9KD 15C8H 1R24A 4POYA 5A2FA 2NY6B 2OBGA 3O11A 3WLBB 3CAFA 3NA9L 4NZTL 1TZGL 2LV4A 3RZCA 1NAMA 3C6LA 1JNLH 1RJZA 3OKDB 4OV5B 2OTPA 4F37K 5GRZA 1AGFA 4U49A 1A7QH 1J8HB 1NMCC 4NBXB 5DFVD 2NY1B 1BOGB 4MD0B 1C5BH 3MXVL 1ZSDB 2R0ZL 1R6VA 1A6UL 4H5SB 2WWKO 1JK8A 4DGIL 4RA0C 1QFUH 3VFNA 2HLAB 3D39D 3LD8C 1NDGA 1HOCB 1D6EA 1OD7A 4IJ3C 1RUQL 1DQDH 2MQCA 3QUMH 5ALCL 2VABB 5L2KD 4WFFD 4Y5VB 5IT2L 2Z4QA 4MNGE 3DROA 3FB6B 2ZPKH 3DV6A 3AS0A 4YHNA 4M43L 4UIMB 1TQCC 3MACH 5GRVK 4FFZL 4WFHE 3RTQD 3A6CH 2AJ3A 3O3EA 2NXYB 4BQBA 2YC1A 1HZHH 5F1KC 2B0SL 1FIGH 4Y2DC 5IWLC 1J87A 5EBLB 5IESL 1XGRA 1VPOH 3CCHA 5CGYC 1EAPB 3KPOB 3FOLA 3V9FA 2QADC 5JR1H 4HUVA 4OLYL 3HRZB 3SE8L 1PJ9A 3L9RB 1I1FB 4OQTH 2RCSL 5I1EL 3BPNC 4MNGA 3T0XA 4JFED 4LSVH 3O6KL 1FVEB 1Q72L 3TNNA 4HBCH 1UZ6E 1YEHH 1EUUA 4LNVA 4U1HB 3O6FA 4BZ1H 3JWNC 1R3IL 1P9MC 5HVWA 5IHZA 3M45A 1YYLH 4G7YH 5C08D 3T0BA 4EDWH 3GUTB 4BQ6A 2IAMD 3GFUA 1E4XI 2E7BA 5C2BH 1UVQA 2YA1A 3TPKA 4HAGA 5DHYB 3LMJL 4UT9L 4I48B 5E99H 4BSVB 5HGBB 4X4ZA 3GRWA 4ONGH 1LO3H 2AK4E 1LWRA 3SY0A 5MI0B 5JXEC 5F9OL 3GHEH 1AXSA 1T5WB 1J0KA 4Z7VB 3MCLL 4G43B 4MA8H 3FZUD 5DMYA 4PLKC 4LBEB 4PY7B 4FFYL 5K9JL 4JY6B 4PS4L 2A6KB 1J86A 3QIBB 5D1ZD 1U41A 2ZSWB 4O02H 4EVNB 1CDCA 2EC9U 5FO9B 1JWUA 2CIIA 3EW3B 5GRUH 4RGNB 1RUAH 4OZGE 3WKML 1VERA 3WIHH 4PP1D 3PDOB 4RZCB 4OM1H 4U2YA 5IFAL 4JANA 3QG6B 1IC7H 3OAUL 4LSQH 1H5BA 2LVEA 4HKJA 4KXZI 4WV1A 4XGZB 2P48B 2WM0A 3BZEA 3NPSB 3FFCB 1D5BB 3TIEA 2X4TB 3GNMH 2VLRE 2A83B 2FBJH 1NCDH 1CGSH 2ITCA 3UEZA 2D03L 2QBWA 1CGVA 1QR4A 1U92B 4Y1AB 4P2QD 5F88A 1C12A 5DMKB 1FNSH 4R90H 3VGFA 4LGRB 5T1LA 5KTEL 1CBVH 2OR9H 4KK8C 1P4BH 2VRAA 3AREC 2A0LC 5DEZA 5C0CD 2OX5A 3FOMB 1MCFA 4OZIB 1GZQA 5KSBB 4OI9A 3N85H 4E5XA 4CU8A 2PXYD 1IGML 3MUY1 5HGHA 4N0UE 2GTWB 3GSUA 1N7MH 3N1PC 3UJTH 1T89C 3SCMD 4WFGD 1F58L 3DRTA 1KENL 1OGAD 4P57B 1U95B 4UT7H 5CMAA 2H26B 2M2DA 5GS0L 5ANME 1UWEH 4PRAB 3D18A 2YD9A 3SKJH 3LRGA 4YHML 3NPZB 4EI6B 3EO1A 1OF2B 2HFFB 1GL4B 1XR8B 2EIEA 2MQ3A 1E4XH 3FO2A 5GJTL 1INEH 2ZCLH 1NGXB 3IXAB 3HC3L 5I19H 2HRPH 3SDYH 5KVEL 4JFDA 4N0UA 3NCYP 3BQUA 1BVKB 3QUXC 3PWUB 5JOEA 3QZWB 4UI2A 1U3HA 4XPGH 1FIEA 5DJCB 3OKMA 4YHYB 3DSFL 5ANMA 4S1QH 3GI8H 5J9PA 1FAIH 4I3RL 2Y6SD 5IB2A 2XRAL 4F2MA 5JHLL 5HVHC 1FZJB 3WLBA 4PRHD 2WBJA 2EC8A 4NO0D 3BXNB 1JGLH 5I9QB 1U8NA 1E27B 1ZWIB 7CGTA 3VD5A 4EUPH 3SDCC 4HKBB 1HN1A 1FGVH 1BOGA 5KANG 1MAMH 1ZSDA 5D71H 3S96A 1KJ2B 2BNUB 4OF5A 2HFGH 1GHFH 4H5SA 1V8HA 4YUEH 1C5DB 4YHKL 1X6NA 4KXZH 4C54A 4AZ8A 2HLAA 1HOCA 4K7FB 1FC1A 2BRQA 3QR2A 1P53A 4ERSL 4PJGE 3DGGA 2P4AB 3IFNL 5FA3B 4Y4KA 5HGGS 5EU4A 1T2XA 1UH4A 2R9HC 1KCSH 2Z8SA 1KPVB 3QAZB 1WBXB 3UTZB 3SDXB 3F12B 4UIMA 4U33A 3BJ91 5FYJD 5KG9B 1HEZB 4KROB 3CU1A 5I75B 4OF7A 2O26U 5EORH 2QHLA 3MLXH 1P6AB 1HXYA 1KIQA 2VISB 4ZFZA 2R4RH 4O2CB 2FX7L 4XXCA 1IAOB 1SHMA 1FBIL 5AYQA 3TN0C 1EK3A 3F5WB 4UDTB 2VNCA 3EFFB 3HRZA 5K9OB 1BMGA 2CDGB 1BFTA 3S37H 1AR2A 5CSGA 3NCYS 3ARUA 2PW1A 2HJFB 4FFWC 1F00I 2BXZA 3OAZH 2QQNL 4U1HA 3TO4B 2ZUUA 1U58A 3QUYB 3BUTA 4U6VH 1C5CH 1YYMH 4CU6A 2XNAB 5F6IB 4S1RL 4QGYA 1MHCB 5I1LB 3GUTA 2BOCA 3T65B 3MLSH 5E8NA 4WW2C 3RKDC 1YEEH 3L5XL 5DHYA 4KQ4H 2VR5A 5HGBA 1SEQL 1OD9A 3JBG7 5B4MC 2X7LA 4ODHL 1T5WA 1NMBL 2E8ZA 2F74A 4HT1L 4Z7VA 4G43A 3RWDA 1CFBA 5T1KD 3VWKA 4PY7A 5I0DA 3QO1B 5DJ8B 4JY6A 4XP5H 2A6KA 3NABL 4C4KT 5E6YA 3IDIA 3ZKMD 4LSSH 4POZC 3QIBA 3LHPL 5IF0A 1B4RA 5FO9A 1S78D 2I9TB 1CI5A 4N5EC 5ACLA 5C0AD 4QTIL 4TQEL 4Y89A 1X4ZA 2J8HA 5IB1B 1G9NL 3B9EA 3ARDC 1DBJL 3MUJA 3QIUB 4HIEB 4Z7OF 3BRFA 3PDOA 4RZCA 4LLMB 3D48R 5IK3A 5MEND 3DMMC 2EEBA 3F7RA 4WW1B 3V0WL 3VFUB 3FFCA 1SMAA 5F9WB 3CXDH 3WD5L 4JREC 1D5IH 4PGCB 5CZVL 3GM8A 3RWHA 1L6ZA 1U92A 2D2OA 4Y1AA 5DMKA 1MQ8A 2VZ3A 2YSSA 2VR4A 4GOSA 1RQ5A 4Y5XC 4HC1A 4C56D 3HPJA 4X7EC 2Y7QB 3JZ7A 4KRNA 5LXGH 4FMFA 1J8KA 1OPGH 2OP4H 4R2GB 4MA7L 5HHMB 2IFFH 1HILB 5D5MB 1LO0H 2I26N 4WGVB 5KVGH 4M6AA 4JM2C 4WWKD 3UPAA 2VLKE 1CU4H 1W0VB 5E8EB 4MS8C 2AV7A 3CVHH 3W5MA 1N59B 4MQXD 2FDBP 1BFVH 4L4VD 2F54B 2B7DT 3IFOB 4OM0H 1TITA 5SWZE 5HI3D 1PKOA 5FM5O 4H1LB 4Z0BH 4YDIH 2YXMA 1U95A 5DMGC 2X4UB 2H26A 3M17B 3QWRA 4PRAA 2UZYB 2C3HA 4KDVA 4MWFB 1CZ8H 2O61A 4EI6A 1OF2A 5CJ5A 2HFFA 1BAFH 2X9YA 1XR8A 4NO2A 4J3VA 3LV3A 2R39A 4CN1A 1YNLH 3WUWB 3KG5A 2R29H 3F7PC 1JYVA 3W11D 3B8YA 1NGXA 3VFTB 4OCXH 3IXAA 1DUYB 2H9GA 1KGCE 2OI9C 1YEGL 1UB5B 3K4ZA 1BVKA 3PWUA 4EJ1C 4Y7MA 1JMXA 5GZNC 2M1KA 4Y4HD 1Q8MA 5DJCA 4P9HL 4KRPD 4DUWA 1TZHB 3GMLB 4RGOH 3WDJA 5BV7B 5IBUB 4B41A 2DQUH 4OKVB 4BELD 4NRYB 1Y6MR 2AXJA 1XGTA 2WIIB 4NC1E 32C2B 2HTLC 3CPLB 1E27A 1BQHA 3N9GL 3KPQA 3MRHB 3SDXE 1HCVA 4YAQA 4XNMA 1QRNB 4AL8L 5IFHL 3MNZB 1YECL 3HS0B 2BNUA 5L6YH 4ZUTB 5FYJH 1UKTA 2GK0B 4W6XB 1BEYL 3O6MH 3K2UH 4K7FA 1ZHLB 4XVJH 3QDGD 3MNWB 4E42A 5CCKL 5JUEL 5BS0E 5CINH 3ORJA 3ME0A 1L7TL 4KVCL 3CU7A 1AXTL 2W9DL 3UTZA 3S3PA 3SDXA 4QHNB 3WMSA 3NN8B 5KG9A 1HEZA 1KXVC 1NEZA 1S7WB 4FFVC 1FORH 4HXAH 2YD2A 1Y0LA 5JORA 1YY8B 1BQLH 3QPQD 4FQ2H 4NJ9H 4I0PD 2C4FU 2HT3D 4ZDHA 3UZVB 4P99A 4XVSH 5LKNA 1UM6L 1GIGL 4O2CA 4NYLB 1XFPA 2A6IB 4Y2DB 3QQ3B 3NH7L 2X5PA 2WW8A 2CDEA 4UDTA 4XVUC 3EFFA 4NQED 5BS0A 5K9OA 4PJFE 4RIRB 4ODBD 2VB5A 5EU3B 1JGUH 2EDOA 5LJYH 3X11B 2EDWA 5TDNA 1X5GA 4FTVD 3BPNB 1FVCB 3AS3A 5KSVA 5J3HD 3T1FB 2MOVA 1S5HA 2VIRB 3LCYA 3QUYA 3H9HB 1XF1A 2ENSA 3NVQA 2XNAA 1MHCA 5DUPL 2W07A 1N6VA 4YNYB 1DFBH 4LHQB 2VAAB 4OLVH 4LCWD 4MAYB 1XF2B 4TVPE 1PW3A 4KH2A 4BQCA 4TOYL 1J5OH 1X9QA 4EI5C 2CUHA 3MLZL 5HI4C 4U3CA 3RVWD 4XMKH 1NC2B 1QNZH 2FIRT 1S7UB 3HNTL 2X41A 3C8DA 1EGJA 4MSWB 4WFEE 4XP4H 3CH1A 3OR6B 3ULUD 3EUUA 1FLTX 5AG9A 3T4AA 4XNQB 1JGEB 1KB9K 4MDJA 4NCC2 5EZIL 3WN5A 4G42B 2CJUH 3DO7B 3QO1A 5DJ8A 5CJ8A 2IG2L 4ZFGH 4KKBC 4BZ2L 2LU3A 3VXNB 5A40E 4U1IA 1AGEB 2NX5E 4ETQB 4XI5C 4FZ8H 2XOTA 2I9TA 4X99B 1U8IA 3MJ7B 3G6AB 1GAFL 3C5JB 3JUZA 3IDNB 4ESKA 4G8FB 2XYCA 3GJFB 4HIEA 3BMVA 2VXTL 4LLMA 5CZXC 3HLAB 4O2EB 4F7TB 2AJUH 3SGDI 1CR9L 3WFBH 1O7SA 2GUOA 5DI8A 3KHQA 4WW1A 4LLWB 4U6TA 1DCLA 3VFUA 1NPUA 2J3SA 1EERB 4M7ZC 4HG4J 4XPTL 2R0WH 1QSED 4H20L 4PGCA 4RA3A 2FBOJ 1KJMA 2E27L 2V5TA 3TYFB 4U2ZA 2P24B 4HF5L 1LILA 2NX5A 3GSWB 1FHGA 5IJVB 4QF1A 1G9MC 4OQ1A 1RIHH 2AV1B 4R0LB 3V4PH 1XGYH 2B2XH 2NY5L 3RJDA 3I50H 3TVMC 5C0FB 5FYLE 1YMMD 2VQ1A 1W0VA 4MJID 2LE9A 3D69B 5TDOB 1MCHA 1I3VA 1JE6A 5JW3H 4M1CD 4V2CB 5JO5B 1WBYB 1F4YL 1LEKB 3IFOA 2QEJA 3KPRD 1NDMA 4M48L 2OJEB 3O8XD 5ALBL 4NQCD 3J7HA 2PYFB 4M7LT 3WFEH 3HCVA 5IQ7H 3BOVA 2C3GA 3M17A 4LF3B 3KPSE 4MWFA 2BMKB 4L5FH 3RI5K 3T04D 1Q9OB 3O9WC 2PW2A 5KW9L 3WUWA 3W2DH 1CFTA 3AXLB 3ZO0A 4NKMA 1RSFA 4I4WB 4OTXL 3M1BB 4FABH 4P2OD 4KZDL 2AGJL 4P2RE 1LO2H 2DQJL 5KSAD 3PP4L 4K7PH 1EXUA 2IPKA 5DVKA 3EYQD 3MRMA 3QUXB 2AKRB 4OGXL 5HYQB 3FHAA 1J1OH 4JDTL 4KHTH 5CP7B 2OMNA 1S7XB 4PLOB 3MLRH 2R1YB 2VDRH 4XCFH 1JPTH 4PRIB 3KPSA 1TZHA 3GMLA 3OKOB 1ADQH 1GPOH 3K8MA 2WWMC 2X4RB 4OKVA 2DMBA 5DD6A 4NRYA 2KDGA 1FNAA 2J8OA 4CMHC 32C2A 4YDKL 3CPLA 1MWAH 3MRHA 5GGTL 1G1CA 2DAVA 2XA3A 4GRWB 1SJHA 3IDJB 4I9WD 3MNZA 1OP3H 3HS0A 3SGDH 1OLZA 3L5JA 4ZUTA 4R8WL 4H0GA 5HVFB 1WCQA 2A6DA 2GFBB 2GK0A 2Z92B 3FONA 5DR5H 5GS0D 4K94C 2P45B 4QHLA 5IB3A 4WI4A 4MXWH 1F42A 2VERN 4YO0B 3WUZA 5IHBA 4F33A 5KANI 1EV2E 2EO1A 4HIIA 3P9LB 5D7LD 3MRKA 4OD3L 1KFAH 3LDBC 3VI3F 1BP3B 3OHXB 2F8XC 1KJ2L 1S7WA 4GS7C 3DRQB 5DVLA 1YY8A 3TO2A 1WSST 2NR6C 1O7VA 4BSWB 1J1PL 3ZKQD 1UACH 3KLHD 5DUBA 5IP4A 3BKYH 1MFBH 4Z95L 2G5BA 5GZOC 4ETYA 4Y2DA 5IWLA 4PBXA 5LBSH 5EO1B 2NTSP 3CFKA 3HMWL 1F2QA 4OD2B 1T1YB 5EO0B 5EU3A 1CK0L 1RZ8B 1RUQH 3R1GL 4C4KO 4LIQH 3ULUH 1FVCA 1IQWH 2F53E 5DUMH 3H9HA 4Y8AA 4P4KC 4YXLL 5C8JB 4PJDF 1CXKA 4DZ8A 4YNYA 1P9MA 4GG8A 1TVDA 2J5LC 5F1NB 1Z0MA 2DLHA 4MQ7B 2Q76B 1RIUH 1QUNA 3D2UB 4GMSL 1NBQA 1SBBA 1YC8A 1X4XA 1NC2A 1S7UA 4N0FA 5F93C 3OR6A 4XNZC 1YJDC 3UBXG 1A7RH 1U42A 4OBSA 4WUUB 5LGJA 5C0IB 4C83B 4XNQA 4XBEL 1I1AB 1CE1L 1RZFH 1IJ9A 3UTPE 4G42A 4ENEC 2W59A 2DKSA 2QLVB 5A43C 4NQUA 3VXNA 1AGEA 1SJEA 1WZ1H 1XCTB 1R3LB 2B4CH 3DVIA 3QXVA 3DVNB 4X99A 5LAXB 1MFCH 1WICA 4GKZB 1CD1B 3PHQB 4IRSC 3KYMB 1EGJL 4G8FA 4Q9BA 3GJFA 5FYKU 1P84J 2A1WL 4F7TA 1MSPA 4B7IA 3ARDB 3J8F7 3EO0B 1HHKA 1G0YR 8CGTA 1F3JB 2FH6A 1WIUA 4JQXC 4LLWA 3DMMB 1IEHA 4RRPA 1A14H 2JTDA 3SDDB 5ERWB 1I85C 1CGTA 3S35L 1IC4L 4NP4H 2NY0D 3TYFA 4JREB 2P24A 2MHAB 4PRDA 4NO5A 3GSWA 3K1KC 3ULUF 1JNNH 5IJVA 2VLLB 3GBNL 4BZYA 3MODL 1X5IA 1T6WA 4TULH 3CK0L 4LLQB 4J3TA 1CFSB 2P5EB 4NQXB 3AREA 2VE6B 3WS3A 5FDWA 1RY7B 4U1MB 2OK0H 3WKMH 4XPHL 2JB5L 4KTDH 3C60D 1C08B 3NZHH 3D69A 4NC2B 1TVBB 2V2TB 4N5UA 1BD2D 5JO5A 1WBYA 2KQMA 1YQVL 1LEKA 4DVRH 1I9JL 4UILH 2BFVH 1KTDB 5I8OL 1T89A 2E7MA 2OJEA 4M6NH 5DFTA 2PKDA 1X7QB 3OB0H 2PYFA 2Q1EA 4G9FB 3O6LL 4LDLB 2XY1A 5T33L 1I9EA 1ITBB 2BMKA 1D5ZA 2EIBA 3ZKNC 2BVEA 3QXUA 5ESAB 2JJTC 3PGCB 1B2WH 5KTEH 4JPKL 4W70A 1EEUA 4X5XA 4F58L 2IALA 2CD0A 4X4XB 5E2JA 1IARB 4Z5RA 1JHKL 5C3TA 3U36B 4EBQL 2OI9B 3EYVA 3M07A 3OAZK 4TSAL 3QUXA 2AKRA 2L4OA 1DANT 4QWWC 4X7SL 5CEZE 1F58H 2VDPL 4G6AC 1F02I 4N8VG 3OKOA 3Q6FB 5GGQL 2X4RA 1G7HB 1NSNL 4S0SD 3RAJH 4XCEA 4XMPL 5E24E 2X1OA 4XP9L 4OZFB 2W0FB 4MNQB 3MOBL 3P40A 3MV9B 1VGKA 4K71C 1IAIL 5KAQG 4GW1B 1ACZA 3F62A 5EU6E 3RGVB 1YPZB 4ZS6D 3IDJA 3BESR 5INDB 2ZCKH 3SDCA 3PGDA 1A3LL 2IPUK 2FRGP 1PG7L 1CLZL 4F7EB 1HH6B 2YD1A 1IQDB 3DGCR 5CSZB 5J89A 2BSED 2V7NA 2Z92A 4QXGH 5BV7L 4CN4A 3FN0H 3O45B 5F7EL 1U6AH 2NY3D 1IGYB 2O93L 3Q6GL 4O4YH 2ZKHL 3DSFH 4W6WB 4M6OH 4Y88A 5IHUH 1Z5LB 4MCYB 4MB3A 3P9LA 5DJYA 2ATKA 4PRPB 4PD4K 4PJHE 1UEMA 5BRZD 1YC7A 5JHDD 3OHXA 3X17A 1GGIH 3DRQA 4NJAL 2DS4A 1UWGL 3VH8A 1D5XB 5TFSH 4Q9RL 4IRJC 3AU1B 4L3CB 5JZ7D 3KDMB 3VFOB 4ACPA 5LGHH 5ICYB 3WE6B 2YKLH 4DW2H 3U7YH 4UIKL 2X4QB 2Z91B 3ARWA 3BP6B 1MLCB 5EO1A 4OD2A 6FABL 1T1YA 1MNUH 3TN0A 4Q6IC 5EO0A 4JFXA 1TCRB 3WL9B 3T0DA 2VXVL 2C3XA 5CP3A 2B5IC 4YWGL 3GMRA 5ENWB 1E4JA 4LLDA 1RZ7L 4JKLA 2QQKH 1EUTA 2NY2C 2C4XA 2VMFA 5FF6B 1JWSA 2P8MB 4HQQH 5E00B 2XN9E 3OXSB 3QFJE 3QUZC 2I07B 1DBBH 3VDCA 1MJ7H 4HLZG 2XZCL 4WW2A 4MA1C 2Q76A 4NHUB 2R69L 5D7JB 3VFRB 1RJCA 1IKFL 2NY6D 3GZKA 3N0PB 4XP1L 3PQYD 4TSCH 1N6QL 4BFIA 4GRLC 3FCTB 5EZLB 1V3JA 4XCCH 3O2WL 3T2NL 4G8GB 4M7LH 4PJAB 3RVVC 3WO4C 5C0IA 4C83A 5FK9B 2N1KA 1J8HD 4LHUG 2NY1D 4PYHA 4WU5B 3L3HB 4WHCA 2EDHA 4JKMA 4F7MB 5GGRY 3UYPA 3IAGC 1N64L 1R3LA 1WWBX 2H2SC 3QFJA 5LAXA 1FDLL 1CD1A 4NNPL 5DZNA 5IMKB 1CDBA 1UXSB 3KYMA 1EFXB 4W68A 3VGBA 4RISH 4B7LA 4ELME 2P5EE 3TZVC 4NSKB 3ARDA 4ZOAA 5I15L 3OKNB 5F7NC 4XT1C 1SEQH 2DRUA 3T2PA 4P5TD 3DMMA 3MRDB 2R23B 5DRXB 4ZAKD 4LRNH 4MD4B 5GGSB 3V0AC 4M7ZB 4DCQB 2LFGA 1L0QA 4GLRI 4HG4K 1KCVH 5F3BB 1V7MH 3VXUB 2DI7A 3CJJA 3WNPA 4NN5C 1T1XB 2AEPL 1PVHA 4Y5XA 1WTGT 5T1DL 3RVXD 1RK0B 4BUGA 1RK1A 3X12A 4NM4L 3DUUA 1MHHB 2P5EA 3OKLB 4ELMA 2YRPA 1KELL 2VE6A 4XXDA 5HHXL 5F6HI 1DBJH 4G6JH 2EDEA 4JM2A 1OCWH 5IM7B 1C08A 5E5RB 2HG5A 2X1QA 1TVBA 1YN6B 4ZUUB 3C2AH 2V2TA 2PF6A 4IHOB 4Y5YC 3QDJE 5ECJE 4OUUB 1MHPH 2EIZB 1TJHL 2HVJA 1KTDA 5F8QC 3MLTB 1QSVA 5CZVH 1CDJA 1GGUA 1UG9A 2V2WB 4PGBA 4XWGH 4LNRA 4HIHA 3OB8A 4U6YB 4X6FB 4F15B 4TNWK 5ESAA 3V6FB 3PGCA 2QKIB 4OFYA 3GI9L 4DKEL 4QRRD 1R5IA 1W2KT 3U36A 3K8KA 5EOCL 1QBLH 5TE7H 5BJTB 3L1OL 2R0LL 1W8NA 4KJWD 1WWCA 4OSUL 2WBWB 2A9NL 4RGND 1AE6L 1OAZH 1G7HA 3K4DA 1MJJB 4MB5A 2BNQE 4FNLL 4OCWL 5ACMA 4YXHH 5ICXB 2W0FA 4ZODA 4MNQA 1P4IH 3RX7A 3MV9A 1XF5A 1IGJA 3MUHL 5FECB 1U93B 5HPOA 4YGAB 2EDXA 1MUJB 1Z2KA 3RGVA 1YPZA 3S97C 1IGFL 5INDA 4F7EA 5E2TH 5CIPA 3QHFH 4XWOD 3HNVL 5E56A 1LE9B 1BBDL 4GAJH 1IQDA 4DEPC 7FABH 3UYRH 1WCBB 2Z8RA 1JL8A 2FECI 3O45A 1U8OB 3Q5YA 4K07A 2VZVA 1IGYA 3MR9A 4IRZH 1QHOA 2D0GA 1VENA 4KQ3L 3S36H 2BNQA 1HQRB 4K3JL 1A6AB 5DFVC 2J4WH 4GLRH 4OF3A 2BSTB 1W0WA 3K1DA 4PLJC 1Z5LA 4JZJC 4MCYA 5EUKA 3KPTA 1T66D 3H7BA 4PRPA 4DZBA 2P8LB 4H8WC 4LAQL 2VZOA 2BHZA 2VLMD 2GT9B 4JRXB 4LDEB 3HG1B 1CG9A 5FYKD 5SWSE 2EXWD 5EPMA 3VFOA 2VXSH 3NACL 5H35A 5EA0H 2OZ4H 3MRBA 1QFHA 4ZTPH 2A73B 4GBXB 4K3EH 4FQXC 2X4QA 4XPFL 4Z78A 3BP6A 4U1GC 1A9BB 4DAGH 1MCBA 4G8IB 4HPOL 4M6ML 1R3HB 3ZKXB 1KJVA 3ULVC 3DARA 4LU5H 3RTQC 3WL9A 4G8GE 2I9LB 3HNSL 3WFDH 3UX9B 5D6DC 1IGIH 4EIGB 4CAGA 4L29B 4OCLC 4OV6F 2BNRB 3VXOA 5I16A 4KVCH 4P4KB 4IMLA 3C6SB 1F90H 2P8MA 1CLCA 4ZD3H 4DN4L 1HKLH 3OXSA 4PGEB 5TE4L 3TJHD 3VW3H 2I07A 1I8KB 5CD3A 3ZE1F 4NHUA 1TFHA 4UBDD 2BRRH 1HSAB 3RL2B 2LQRA 5KN5B 4EI5A 1VKXA 1B0WA 4KK5D 3H42L 2F5BH 5JDSB 4FZEL 4QYOA 2VTFA 5F7KC 3BMWA 4K8RL 4YZFF 2WUBH 4G8GA 4PJAA 1FLRL 3K0WA 3ARGC 3T0ED 1OARH 4LSPH 3SJVB 3H3KA 4WU5A 3L3HA 4HH9B 4ZNEE 3P4LA 1NMAL 4K9EC 4ZSOB 1C1EL 1IFHL 1MEXH 5FM5M 3DETD 1OAUH 2P42B 3DWTA 3PABB 5F96H 3UBXI 4TYUA 2ICEA 5IMKA 1UXSA 1EFXA 2IGFH 5E2UL 4IRSB 3G6JF 4NSKA 1B90A 3FZUC 4KI5D 4WDIB 2D9CA 5I74B 5DWUL 5GRJL 3L95B 5HHPB 3MRDA 4QXWA 2R23A 5DRXA 1GC1L 4MD4A 5GGSA 2YUXA 4ZNEA 5FHBL 3RWEB 1PD6A 4NN7B 4QT5A 4DCQA 1NLBL 5DRZB 3A6OA 4PP1C 4RFNB 5F3BA 1Z9SA 2XTLA 5HGAB 3VXUA 5A3ID 3D85D 1LO5B 1OP3K 4NNYB 1T1XA 4G9DB 4LEXH 4PJIB 3VXSE 1RK0A 1NJ9B 2ZP0T 4S1DC 3H9SE 3C5ZD 3KYOB 1DLFL 3VI4F 3S88L 4PJBE 4KHXL 4ZUVB 1ZLVH 5C07E 4ZUUA 3JWDH 4OBRA 4IHOA 2CK2A 2EIZA 3VFMB 2VUYA 2A74B 1PX4A 1DBKL 5F6HJ 4MQSB 4XNUH 4H20H 1AKJB 4Y19B 3UPRA 5FKAB 4ZUSB 2CRMA 4OZHB 5J13B 3L7EB 4V1DE 3HAEG 2J1KA 4U6YA 4X6FA 2PXYC 3P9MB 4I2XB 4KDTC 2QKIA 1ZLUK 3LZFL 3SCMC 2OQJB 4LSUH 4M9OA 1A4KB 3H9SA 5I1DA 3O9WA 1LO4L 5E94B 1A6PA 4P23D 1L7IL 3KNBB 4JO4L 4HS6B 5C07A 1N2RA 1IVLA 3KHOA 1NCAH 2YD8A 2BHUA 4IDJL 1Q0XL 3G04A 3HHRB 2ORBL 3PG2A 3BWUC 2FJFA 2LVCA 1SY6A 3Q1SH 4ZXBB 5IMLA 4JE4B 4UTAH 4OF0A 5L8LB 3QIUD 1FAKT 3C09C 4V1DA 4LARL 1H0DB 3OMZA 1A22B 1F8TH 4HGWB 3PUCA 4IBLT 1LEGB 2ERJB 5HD8D 1FNEB 4M7JL 5IVOA 3G5YB 4B50A 3EHBC 2VUOA 3ESUF 3QEGL 4NGHH 4JQIH 1MCNA 3QIWB 3WDHA 2Y6SC 5ISZD 2Z0BA 5BZDB 4R6UA 2V6HA 1WCBA 5FOBB 5FYKH 1XGPA 1MPAH 4URTB 3B9DA 2YWYA 5KSUB 3TA3B 1U8OA 5DS8B 1ZGLM 1VCAA 2P5WD 1XT5A 2Y07H 3E6FB 2DL9A 3ZZ1A 3LOWA 5CJXC 1AO7B 2BSTA 3QNYA 3ZDZF 1DQTA 1WF5A 4C59B 3QRGH 2EH8L 3FN9A 1FFPB 4LHUD 2J88L 5HHVH 2FEEI 4E9LA 4YPJA 4JRXA 3HG1A 1H3PH 4GAYB 4TSBH 1IMHC 1TLKA 3JV4B 5J8OA 1OAKH 2Q86A 5J6HA 1MLBA 5EOTB 4G6MH 3IGAA 3AAZB 1OSZB 2CR3A 2A73A 4KAQH 2VLJD 2NTFA 4X7TB 2AQ3A 4PJ9D 3LEVL 4DK3A 4PJ5D 2Q8AH 2BY2A 4G8IA 1R3HA 1AR1D 2I9LA 2FEDC 3C87A 3E8UL 3HUJF 4YHZL 2X05A 4L29A 1I75A 2B5IB 1T1ZB 2GCYB 4AEIH 5IQ9B 1TVHB 3HTLX 4L3EB 1U8JB 1J7VR 4P4KA 2NY2B 1IGCL 3QUMB 1BVLA 4NKDA 5DFWH 3OJVC 2HN7B 1I3GH 2YPLB 3OKYA 1LP9F 2ESVE 3W82A 1HSAA 3RL2A 4CNIB 3QCUH 1UM5H 5D4QA 5CWSA 3FQRA 2Z93B 3GO1L 4GRLB 4NWUH 2ZOKB 3L3IB 3QH3A 4YK4C 4P46D 3WO4B 4Y16B 2R56L 3QA3B 1I1YB 4HH9A 1H3UA 3UTTD 3STLA 4XP6L 3CMOL 4ZSOA 1OQXA 1ODAA 4P59L 3FT2A 5DJAB 3V5KB 3PABA 4MCZB 4RDQG 1QA9A 2G2RA 2BSSA 2ESVA 5I1IH 4KKLD 4IRSA 3V79C 5D1QD 2Q3ZA 4RAVA 25C8L 4JN2A 2A38A 2PR4L 3L95A 1INDL 3QNZA 4KZEL 3ARBC 1S78C 1IC5H 4JQXA 3UTSD 1E28A 3MGTB 1DVFC 3K81A 3QI9C 4MVBC 5DA4A 3JUYA 3RWEA 5DRZA 4LCIH 4ONFH 5HDLA 3JWOC 5T3ZH 5HGAA 5L2JB 2H1PH 4M7KH 4JN1L 3RNKA 1QFOA 1KLUB 5ID1A 4HZLB 1JZ8A 3WSQL 1IGTA 3P2TA 4JM4H 1CLYH 5JXAL 3TH4T 1QYGL 2I60L 1CDGA 4JPVH 3O2VH 3IDGA 3U0WL 4LSTH 3MV7E 5DJDB 5EC1B 5AUMB 2IANE 3NA4A 4Y5YB 1GYAA 2EE6A 5D2LF 4MAYD 4NQDB 2UWEF 4EQ3A 5EWIL 3IDYB 4WWKC 3SO3C 2CLRB 4ZUSA 3HMXH 1FYTB 1MI5B 4PUBL 5IG7B 1XGUB 1BGXH 2MSPA 3EYOA 4PB0L 4I2XA 3K74B 1VADA 5CEXA 4LL9A 3QQ4B 2HKHH 1YDPB 1M6OB 4H88L 1A4KA 1NGYB 5HI3C 1QSFE 2JJTA 3ZTNH 5AYUH 5E94A 3GGWB 5B38B 4HS6A 4UOW1 4WEBL 3MV7A 1ZS8A 1YEFL 2XPGA 3BISA 1JHLL 2HKFL 2IANA 3LIZH 2DI9A 4OFKA 3TT3H 5FO8A 5HHQA 4QOKD 2W92A 4JPIB 1U8PB 3O3BA 3W11C 5KAQF 4KVNL 4HLZH 4LVEA 4FQCL 2HLFC 5KS9F 1NFIA 4XPBL 1U91B 1LEGA 3ROOA 3A6BH 4MJ5B 4NQSB 5I30L 1FNEA 4YFDB 4TPRH 4HKZA 3G5YA 3QHZL 1H8SA 1UB6A 3BE1H 4Y4HC 2DB8A 2F58H 1MFDH 1ZLSL 2D4DA 4KRPC 5T3XD 2J8UF 4GQ9L 1D3CA 1BBJA 4LQFH 5FOBA 3LEYH 3B9KB 1U8HA 4OCMC 5EUOF 4IDLA 1N5YL 5DS8A 3V6ZB 5B8CB 3EDJA 1CCZA 3DVGB 2H2PD 4XBPB 2UVEA 1NAKH 1YQ2A 4IOFD 2JIXB 1RAMA 1VSCA 2O5ZL 2NW3B 4PJCB 1I9IH 1S7QB 1T4KA 4CMMB 3MO1B 1I4FB 1TTFA 1FFPA 4P48A 2YZ8A 4JZJB 5TE6H 1JF1A 5MP6L 3MJ6A 3EYUH 1W72H 2EEDA 2XICA 4I5BA 1NGQH 3G5ZA 4CADB 1K3IA 4G80A 4IRJA 5EOTA 1OSZA 1EO8L 4K94L 4KFZC 4PTUA 2GTZA 4X9IA 3U4BH 2HMIC 4YE4L 3V8CA 4ONOA 4PJXE 1LVEA 4U1GB 1V3KA 1RU9L 1N0XL 1TJGL 4Q6IA 3IDXH 2VDKH 4I0PC 4RWYH 3RTQB 3RNQB 2X2YA 2Y36H 3IS1X 1A6ZB 1T1ZA 2GCYA 1HYSD 5IGXL 3B9VA 2AXGA 3SPVA 4A6YH 2FSEA 3PP3K 1Z9OA 2E9IA 3GBLA 1GH7A 4LQ1A 5M95B 2C9AA 2YPLA 2JELH 5JW4R 3QUZA 2DI8A 1FZKB 1IEAA 4CNIA 1RVFH 3KS0H 5J3HC 1EEYB 1N0LA 1ZA3B 2CLVB 2XY2A 3KYKH 4RSVA 1DL7L 4PJXA 4PRBB 2Z93A 4HV8A 4GRLA 3O2DH 5DJ6A 5C08B 3QCVL 4PJ7E 3O4LE 2IAMB 3QA3A 2VDLH 3QXDB 2YK1L 1FGNH 3DXAE 1UGNA 4R3SB 4GG6B 4YHPB 1OAQH 3ZSTA 4OF8A 1PSKH 1PKQE 4HMCA 1WAAF 5EH1A 3ULUC 3OKEB 5ITBL 4EDXB 5DK0B 3UTOA 1FH5H 1AGBB 4X9FA 4AQOA 4D3CH 5CILL 5FHAH 1YJDL 3P9WB 5IBLD 2AERT 4QXUH 3IU4H 2DLFL 3AC0A 2PO6C 3GMNA 4H26B 3DVFA 4JO2L 3VDAA 4PJ7A 3O4LA 3BKML 2EE2A 5D1ZB 2FGWH 4R7DB 3DXAA 3EFDH 2K7PA 4RNRB 1J18A 3WEXA 4D9LH 3LS5H 5DD0L 1P4LB 5T5FH 4HZLA 2LABA 3ROLB 3NIGF 2AABL 3SBWC 5DYOB 3RP1A 3RU8L 1JBJA 1KC5H 5AZEL 4K8RD 3HFMH 4Z7UF 4Z76B 3C08H 5FEBA 2Z35B 1MIEH 1E4KC 5I15H 43C9A 3IS0X 4P2QB 3JV0A 1EHLL 4Y5YA 1FV1B 2ZJSL 5F7LB 2XTJB 5FUOH 1VEOA 4JKPH 2I5YH 2WSKA 4LLYB 4PLNC 2DQHL 3D2UD 1FYTA 4DGVH 2AJXH 1MCEA 5CUSL 4KC3B 1MI5A 3CFCH 4JG1L 1BM3L 1XGUA 2R2HB 2ZUVA 3NCFB 4WUUD 1NL0H 4PBVC 2AK1L 4M1CC 4DKAA 2PXYB 5DSCA 3QQ4A 1QR1A 1NGYA 1R3KB 1NFDF 5D2NC 5JPNB 3TF7C 2BVPB 3SCMB 4MA3B 2CMRL 1CDHA 1BF8A 5B38A 4OFDA 4WCYH 2QQQA 4EXKA 5BVPL 5C0ND 1Z3GH 3DURA 3FQTA 4JO3H 1D9KC 1D6VL 5T3XH 5MEOA 4NN6C 4UINH 2KUTA 1RFDH 3N1FC 4KKCD 1JPSL 3JSSA 3RPKA 1U8PA 1UEYA 4C58B 1KCUH 3CVHB 4JCMA 3DNKA 4IOIB 1ES0B 5D7IB 3KS0J 2EYTB 4Z7QE 3C09B 3BYTA 1U91A 1T0PB 2DM3A 2R1WA 1JRHL 5KSAC 5A1AA 4MJ5A 1E0OB 4NQSA 1HSBB 2PYEB 3IFLH 4FXGB 1ZTXL 3RVUD 2O5XL 4LLAA 4JDZA 3WHE0 3FMGH 4UT6L 1DE4B 3GI9H 3DX8B 1RZIA 3WHXA 4QHUA 3D39E 1WZMA 5C0GA 3UJJH 2GAZB 1KJ3L 2AXFB 1RMFH 5L2KE 1FNHA 4WFFE 1XCQB 3V6ZA 1J10A 4NO0B 4AMKH 3SE3C 1URLA 4AIZB 3DVGA 5F9DC 4XBPA 4UV7H 1MREH 1BHGA 3THML 3F58L 4PJCA 1RUKH 4CMMA 3ULVE 1G6RA 3MO1A 1I4FA 1JTOA 2VH5H 4X6CB 3K4AA 4JZJA 1KN2L 4HXBL 1QQDB 2VOTA 1S3KH 5DK2A 5ADPH 8FABB 5GS0C 2XQYG 3B3IA 1OTTD 3D39A 2NY7H 4JR9H 3DLQR 3FB5B 5ILTL 5BCAA 4CADA 3ESVF 3C8KB 3KJ6L 2CPCA 5L2KA 1Q94A 3U7AA 1U8QB 4J12A 3TGXA 3CVIH 5FCSH 4HS3A 1BQHG 4JFEE 1JZ7A 4FQXA 3DJ9A 5DRWB 3S6CA 2BSRB 2DLIA 1FNFA 4U1NA 4JLRB 5L7XL 1A6WL 3ZL4L 4PTTB 5CLWA 1EA9C 4NQVB 3B9AA 5C0JA 4K3JH 1CF8H 2WBKA 3OX8A 4JZOA 5C08E 3RTQA 3RNQA 4F57H 3QP3A 1A6ZA 3C9NB 5D6DA 15C8L 3PV6A 2VL4A 3KLAA 1SEBB 1U8MB 4LAQH 1JNLL 1CQKA 2ED8A 1S9YB 2OCFD 1J0JA 1IAKB 2FHFA 1SJXA 1A7QL 2E7HA 1OAYH 5HYJE 3Q3GB 1RZJH 4XAKD 4OJFH 5I1AA 3ZDYF 3IXTB 1H15B 1EEYA 4JFEA 3RUGE 3S4SB 5AD0B 3P0VH 2F5AH 3HAEH 1DP0A 1C7SA 4NZRH 4YDLB 4JFHE 1NEZG 1QFUL 1UQSB 3WCYA 3TYGH 4AIOA 4WY7H 1ZGLB 5C08A 1T22A 1T3FB 4YK4B 1DQDL 3QUML 3QXDA 3UP1A 1K6QH 4JHBA 4GG6A 4YHPA 4QY8B 2ZPKL 2BX5A 3OKEA 2AK4D 4M8QB 4EDXA 5DK0A 4X6DF 1AGBA 3OPZH 3FFDA 3B6SB 3MACL 4D9QE 2ARJB 3A6CL 4YGVB 1NANI 4YC2B 1HZHL 3FQXB 3GB7B 2RFXB 3GSRA 4LDOB 1FIGL 1LP9E 3TBVA 5T1KB 1ZT1A 1VPOL 2QSCL 5EOQH 5JLZA 4P49A 1MIMH 3BYYA 3R0MA 4FQQA 3QT2A 1BX2B 4XC1H 5JR1L 3CH8A 3O0RH 2ADFH 4OQTL 5H94B 3SKOA 2NY4D 5C0AB 3IJHB 4JZNA 4LSVL 5C0CE 2DJUA 4HBCL 4JVUA 1YEHL 1CD9B 1YY9D 1Y6KR 3I9GH 2Y4SA 3LN4A 4F8QA 3GMPB 3ROLA 4BZ1L 5MENB 1YYLL 4G7YL 4EDWL 2P47B 3FQUB 5DYOA 1JYNA 5C2BL 1GXEA 3FO1A 2VLRD 2NY0C 4PGZA 5KBNC 1I7RB 3U9PH 2Z35A 4WFGE 2AS5M 2BP3A 1DBAL 1Z9LA 5E99L 1ZHBA 2AJSH 1OGAE 2R1XA 4ONGL 4P2QA 1LO3L 4QNPF 5HYSB 4FQIH 1RULL 4UAOB 2EEAA 4FQJH 4GKNB 4C56B 4F3FA 1CXIA 2Y9RT 1FV1A 5AZ2H 2FZ3A 3QUKB 5C9KA 4MDIA 4IS6A 3GHEL 2FR4A 3TBWA 2NYYD 1Q9KB 4LLYA 5C0CA 3QFDA 4NOFA 4JVPA 5D7JD 3TT1H 2BVUA 4MA8L 4WWKB 5D7IE 2KZWA 4U1SA 1NAMH 3QJHA 3S34H 3WS6C 3OGOE 2PXYA 3L3GA 4O02L 1FL6B 1R3KA 2C1OA 5JPNA 3ILQD 4KDTA 4YHOH 1EIBA 2BVPA 3SCMA 1U3HD 3MGOB 5GRUL 1OGAA 1RUAL 1NUFA 3WIHL 4W4NA 4AJ0A 1M71A 1JGDA 5I8KH 4OM1L 3EJZD 4Q2ZA 4JDVA 3MRIB 3HE6D 1IC7L 1G9NC 1Y18B 2CRIA 4LSQL 1P1ZB 3ZHKA 4EOWH 2WBJD 1D5MB 4PRHE 5EO9B 4CN6A 3CVHA 3GNML 2FBJL 1DJSA 1BJ1H 4IOIA 1NCDL 1ES0A 1CVRA 2VWEC 1A7OH 1CGSL 5D7IA 5B3JE 4H25A 4JB9H 3ARYA 2P7TA 2NLJB 1FNSL 4R90L 4FA8A 2Z31D 4GKSB 1ZGLP 4FXGA 4Z9KB 1CBVL 1A7NH 2OR9L 2VZTA 5E8OB 3PL6C 3I6LE 1P4BL 1I3UA 1UKSA 2UZIH 3RBGA 4LCCB 1LO4H 1NANH 5IVZB 5HJ3B 3FT3B 5FM4A 2VYRE 3H6JA 4PBWD 3BZFB 4L4TE 3N85L 4OCSH 2XXCB 1T0NB 2AXFA 3OWEA 3Q2CA 4XNXH 2C3VB 2HAZA 4Y4KD 4PRHA 1T7XA 1BOYA 4NO0A 3DYMA 1N7ML 3UJTL 2Y23A 4AIZA 2HT4C 5KVMC 4R7NA 3S5LG 2Y5EA 2D4FA 5HHOB 3RIAF 4UT7L 1UWEL 5CJXA 4X6CA 3BI9X 1QQDA 3SKJL 3X13A 8FABA 2NY3C 5I8CB 1E4XL 4LASH 5L88H 1JN6B 1INEL 3C8KA 1KYOJ 5D8JH 2HRPL 1MWAB 4MYWB 1U8QA 3GRWH 1G1YA 4N0YH 4NZUH 2A9MH 1KB5A 4OAWB 5AG8A 3WIIH 3CDCA 4XPGL 2BSRA 3OR7A 4JLRA 4HUXB 5EUOE 4PTTA 4LCYB 1TJIH 5DQJB 5JZ7C 4S1QL 3GI8L 4F9PA 1FAIL 3C9NA 4I0PB 4P9HC 2NQCA 3LKNB 4KWUA 1SEBA 4CL7A 4NPYA 1U8MA 2J88H 3LKRB 2DYPD 3HB3D 1CICD 1JGLL 3TBYA 4HH8A 1IAKA 4NQEB 3Q3GA 1FGVL 3MBXH 5GHWH 4UB0H 5C0BB 3T3ME 1WBZA 3IXTA 1B4JH 1MAML 3B2VH 2HFGL 1GHFL 1LK3H 4FTVB 4YUEL 2H45A 2DMCA 4U3HA 3D25A 2XKUA 1UQSA 3IU3B 4E41B 2ADIA 3FB8B 4RDQF 1WUNT 2DM7A 4OZ4B 3DI2B 1T3FA 5GJSH 3S3JA 4LCWB 4MHHG 2VDQH 3T77B 2NY6C 1KCSL 2IADB 4I77H 4QY8A 2D7NA 1UADC 4M8QA 3B6SA 3MLVH 5FGCB 1QFWI 1BJ1J 2IH3A 4OGYL 2ARJA 2NY1C 2EZ0D 2XWBA 4YGVA 1LK2B 4BK5A 1IE5A 5I76B 5I0ZA 4X80H 4YDJB 4JVWA 4TUJB 3FQXA 2RFXA 5EORL 1X5ZA 4L1HA 4WJ5A 3E3QC 3MLXL 4X5WA 4XHJD 5T1KA 2ZUYA 3LH2H 3TV3H 2R4RL 4PV9B 4ZYKA 1YEDB 2ZSVA 4AT6A 1M7IB 1N8ZB 5JW4M 1NCBH 3HE7D 5H94A 3QI9A 1DVFA 3S37L 3IJHA 1VACA 4Y5VC 5EU7C 3RIFK 1JIBA 3VGAC 1JWMB 1JFQH 3QULB 4UV4H 2WINA 4U6VL 5MENA 1YYML 2DICA 4P5TC 3BEVA 3INUH 1H3TA 5DK3A 3FQUA 3MLSL 1S7VA 4O58H 1SVZA 4GUPA 4L4VE 1YEEL 1QEWB 1QLRB 1ZHNB 3QEHB 1II4E 2BNRD 4KQ4L 3P77B 5TQ0H 3HR5A 4QRUA 4LSDA 1X5HA 4C56A 1Z9MA 3RVXC 5HDOA 1LMKA 4XNYH 3RWJB 2D7QA 2Y25A 5EIVA 1Q9KA 1JZ5A 4HK0B 1BVZA 1SBSH 2Y5TB 4LCUA 4PYGA 4ODVH 4KPHH 1YMMB 2VLKD 4WWKA 5GXBB 4WI7A 4XP5L 5F3HB 4MJIB 4LSSL 4RRPG 3MUGB 4L8BB 2VL5A 2EYSB 5CD5D 3HI5H 2C1PA 4L4VA 4LFHG 3NBNA 1MCWW 4TUKH 5SWZD 3PHOA 3MGOA 4OZGF 3SJVD 3NIGE 3ZT6A 3VRIB 3KPRB 2DBLH 4W81A 5A2JH 2IQ9H 1UXWB 4JHAH 3O8XB 4NQCB 2BK8A 3FHQA 5IUSA 1NUGA 2OTWB 1A3RH 4NN6B 4L8CB 5EO9A 9CGTA 3CXDL 1JJUA 1D5IL 2FATH 4I18C 5HHNA 5JOFB 1KGCD 1REIA 1EJOH 2IQAA 4P2OB 2NLJA 1NC4B 3QIBC 4X6EA 4N90D 4GKSA 1F45A 1S7TB 3VJ6B 4N1HB 5LXGL 2APBA 1A6VH 1OOAA 5E8OA 1OPGL 1QFWH 2X1WL 2IFFL 4Y4HA 4YPGA 1IBGH 4RGNC 5IVZA 5KVGL 5HJ3A 3CSYB 3QDGE 5EIQA 4LLVA 2KL6A 1T1WB 1CU4L 1TCMA 5IIEB 1T0NA 3VCLB 3QRFM 1Q9LA 4U31A 1BFVL 2DDQL 3NPSC 3KYNA 5J1TC 3E0GA 3MXWH 1AIFA 3CFEB 2UUDK 3IB4A 5FGBC 3CUPA 4Z0BL 4YDIL 5DJXB 5T1MB 4XWOC 3WXVH 2N7BA 1CZ8L 4M3KB 1BAFL 2ID5A 4BSJA 1GOHA 5DRNA 5D7SL 5I8CA 1I3RB 2SEBA 1YNLL 3VFSB 3QDGA 2R29L 4CUCA 4OCXL 3F8UB 3LY6A 4MAUH 4DFIA 3QPXH 1PQZA 2HFEA 1MWAA 3BRDA 3VXTA 3SDAD 1AGDA 2C7UB 4HWEH 3SGEI 4JFPA 4HUXA 3CLFH 3MRPB 4GXVL 4X7FC 4KKAD 1YEIH 2EXWC 3VWJD 2VC2H 4RGOL 4I0PA 2DQUL 1NCUA 1WISA 3MPCA 3LKRA 4HCRA 3HR6A 43CAA 4B5EA 4ZXBD 2FD6H 1HCFX 4NQEA 1YMHA 3UO1H 2IPTH 2HJKB 1KEML 4FTVA 5L6YL 5FYJL 3V7AE 3W0WE 2WUCH 3O6ML 3K2UL 4MD5A 3VH8G 2VKXA 3FB8A 3VXQB 4XVJL 4NBZB 4OZ4A 4PJGF 3ZYZA 3QIWD 1TJGH 4LOUC 5CINL 4JFZL 4TVPD 4X83A 4UBDC 4M4PA 4PRNA 5F71A 1GOFA 2E7CA 4HC1H 4KK5C 3AM8C 2GJJA 2FIKB 5ICZB 1OHQA 4FQHB 3TA3D 1N5AA 5I9QC 3GSQB 4WFED 5D1XD 3VXRE 3P0GB 4FQ1H 4HPYH 3WIFA 1FORL 4HXAL 4TNVK 1BQLL 4AG4H 1LK2A 4FQ2L 3FB7A 1AO7D 4NJ9L 4YDJA 4TUJA 3W0WA 1QSEE 2EDBA 2FYYB 4XVSL 5GISH 5IMMB 2ARWA 2G5RA 3RFZC 3ZHLA 3DETC 1YEDA 2ZCHH 3FTGB 2JJWA 2PO6A 1M7IA 1N8ZA 3QEQB 4CGTA 2BY0A 3ALPA 2GITB 1JGUL 3BT2H 1MH5B 3QAZC 4KI5C 3VXRA 4WHTB 2AW2A 4U1LB 1HHJB 4M1DH 1S5IH 1DFBL 1UZ8B 4NKOB 2QJDA 3SKMA 3SBWA 4EN3B 4OLVL 1QEWA 1QLRA 1QSEA 1ZHNA 3QEHA 4XC3H 4OIIH 1IC1A 2ICWA 3BDBA 1J5OL 2MKWA 5D2NE 4QRPE 2NY0B 2XA8H 5A3IC 4L3ED 4XMKL 1QNZL 1MCJA 1E4KA 1J0ZA 4I13B 1FFNB 1OTSD 4XP4L 3K46A 2NXZD 4NUGL 1HHHA 3BKMH 1UA6L 2LU4A 4J7RA 1DDHA 3C5ZC 4X0KA 2CJUL 1YMMA 3UDWC 3TO4C 3EZJB 4ZFGL 1TXKA 3OV6A 2AQ1A 3C60B 3KXFB 3RVTD 4FZ8L 2VDMH 4QCIA 2EYSA 3F6LA 3GMQA 3BKCH 3L7FA 5JOPE 4I0CC 4Y16D 3KPRA 5D2NA 5I17B 5FGSA 5AZEH 4NQCA 1FE8H 5EULV 1KIRB 3U48A 2R4SH 4UQ2A 3BP4B 2AJUL 4HUMB 3CFBA 3KPSD 3WFBL 3WHE1 1GRWA 4HX1B 4ODTH 5E6ZA 4GW5A 4OLEA 2D31A 2OTWA 1D9KA 1AQKH 5IEHA 3AGVA 1WZLA 4XB7A 4JQVA 4YH6A 2R0WL 3LB6D 1K8IA 4P23C 4LMQE 1RV6X 3KPLB 2BVOA 4P2OA 4L8SC 1AGCB 4P2RD 1N3NB 4G7VH 5KSAA 4L8DB 1CGYA 3DHJA 4ZO7A 1RIHL 5DMIH 3V4PL 4ELKA 1XGYL 2B2XL 3V6OA 2ENYA 2ZG3A 2NW2B 4ZOEA 5CEYA 3I50L 1CE6B 5FYJU 3QIUC 5DJZA 3CSYA 1T20B 1P7HL 5IIEA 2W65B 3VCLA 1KIPB 1IAIM 4J8RB 4RFEA 5HD8C 1DN0B 4YHIB 1T5XB 1D6VH 1TMCB 3TBSA 5JW3L 2EDJA 3U30B 5F9WC 5D7LE 1KT2A 3SE3A 2GSGB 5T1MA 4U0QB 1GOGA 5IHLB 3WFEL 2W9EH 5IQ7L 3E6HA 2DQFB 1VFAB 3FRUA 4NO3B 1IT9L 5LGKA 3D9AH 4L5FL 1KNOB 5E9DE 3CD4A 4QHMB 4R2GC 3BVNB 1LD9B 3I3DA 3W2DL 2NY3B 3B4NA 4G3YH 1N6UA 2Q7YB 4KV5E 4N0CD 2QADD 5EU5B 1AJ7H 1DQQB 3PJSB 1LO2L 3BEWB 1KYOK 3BP5B 4K7PL 5DURD 5D7LA 5BW7C 2C7UA 3ARXA 5BRZB 1FZOB 1J1OL 3MRPA 4KHTL 3RWFB 3MLRL 1CXHA 2VDRL 4XCFL 1JPTL 1OAXH 3DV4B 3QXAB 4DQOH 1ADQL 2MMXA 1GPOL 3TPUB 1DLHB 1HXMB 4CW1B 4PFEA 1PY9A 2NNAB 2VDOH 1ZV5A 4PJ9C 1KN2H 1FVDB 3BGMB 3UTQB 3SDXF 1PX3A 5C6TH 4TVPH 1MWAL 2O5YH 4Y8DC 1K8DA 4F7CB 1M7DB 2AEIT 5B39A 1AR1C 1YNKH 2HJKA 3D3VE 2A77H 4GSDH 3LQAH 4WI6A 2EIDA 5JXED 4G6KH 3VD9A 2F53D 3S7GA 4I8DA 1M05A 3BP7B 5FA4B 3G6JB 5DR5L 3VXQA 1JV5B 2GQHA 4DOHE 5BV7C 4MGXA 1CT8B 3IRZA 3MA7B 3WFHA 3EOBA 2FIKA 5AAWA 2J6EH 4FQHA 2V5MA 1KFAL 4WU7B 3GSQA 5JIPA 1ZMYA 3GSOA 3PQYB 2FNBA 3PWPE 3BHBB 1JUFB 3D3VA 3VFPA 3H9ZA 2JIXD 1SMOA 1HKFA 1AP2A 3QCTH 1K4CB 1UACL 3D0LB 4MHHI 4M5YH 3BKYL 4LFHD 2FYYA 1MFBL 3LKOB 2Q8BL 3FO9B 5BOPA 2X1PA 5LBSL 4PJFF 3DPBA 1X5LA 3NCEB 2GITA 1SJVA 4KKLC 1MH5A 5LCVH 5BVJB 5D1QC 1KBGH 5F7WC 3RZWA 1MY5A 4LIQL 2DQTH 3ULUL 1IQWL 3PWVA 1KCRL 5DUML 2VZ1A 4HJ0D 3VFVA 3PWPA 3VGAB 1R5VB 2WQ8A 1DEEA 4G5ZH 1F13A 4JJHA 3W9EB 5FYLH 5E8DL 1A9EA 1KXTB 3QWOB 5BQ7B 4P5TB 3MX0A 1UZ8A 2X4NB 4MB4A 4ZAKB 1BD2E 2P8PB 4XAWH 2K1MA 1RIUL 5DDHA 3X14B 2F8OA 4X7DC 1FFNA 3NCJH 2QSCH 3OTTA 1A7RL 3LKSB 3MOAH 5F89B 2VAJA 1ZLWH 5FB8A 1RZFL 1QHPA 2B8OT 4HKXB 3EOAB 3BUYB 2ZNWA 1WZ1L 2YEZB 2B4CL 3P11H 3WS6A 4MX7B 1BD2A 1MFCL 1FG2B 4MAYC 3HKFA 2DD8H 2UY7A 4HIJB 3PWJB 1TQBC 3SOBL 5TPWH 4NWTH 4ZPVA 5CBAB 1NGZB 1DBAH 1ZT4B 1KN4H 1A0QH 2ZG2A 4PJEB 1HH9B 6CGTA 1UKQA 1WFOA 3T1WA 1RULH 1A14L 2E9JA 4KDWA 3P4MA 4OT1H 2HFTA 4HK3N 3QJFB 4M93B 5BO1H 4NP4L 2GEEA 4RMUA 4I18B 4QRRB 4DN3H 3CFJA 5CKAA 5C1MB 1AGCA 1JNNL 5F7DA 5C09B 3DYOA 4L8DA 2E6PA 5DTFA 3C8HA 3BPCB 4R26H 4TULL 2H8PA 5CEZD 4Q74A 3PL6A 4OCRH 2OK0L 4DUXA 2W65A 4KTDL 3NZHL 4J8RA 3MRFB 2AJZB 1DN0A 4NT6B 5CHNA 3BWAA 1Q1JH 2YRLA 3U46B 4DVRL 4UILL 1RUPH 3R06A 2BFVL 1KPUA 1ZHKB 2GSGA 1F3DH 4M6NL 5EU6D 5JHDE 2X4PB 2H6PA 1IZKA 5IOPB 5SX5H 3B5GA 2V9TA 3HUJB 1KNOA 3HC4H 1EEQA 1S7SB 4R0LC 5D9SA 2X4OB 2XQBH 4QHMA 1B2WL 2XTJD 2H2PC 3JTTA 5IVXE 4IOFC 1B3JA 4JFFE 4BFEA 1WK0A 3TN0D 3LKQB 3CSBA 4XPAL 3MV01 3UBXB 4WGWB 4HDIB 5EU5A 1DQQA 3BEWA 1MCQA 2DQDH 3TC9A 3BIKB 4JFDE 1XEDA 4QGTA 1FZOA 4FFWD 5BRZA 5JHDA 1T83C 1F11B 1AI1H 1T7WA 3DV4A 3QXAA 5DHVA 4WEMB 3U6RB 3TPUA 3I02B 2YMXH 1HXMA 3RAJL 3CFDA 1HI6B 2NNAA 2EYRB 5HGDA 1C16B 2BC4A 4FQLL 4M03A 5IVXA 4JFFA 4F7CA 1TDQA 1MFAH 1FC2D 1FSKB 2ITDB 4KRLB 2X1XR 4R4BB 2VDNH 3U4EB 1JF5A 5B4MD 2ZCKL 1YEKH 4CJ1A 1H3XA 3EKCA 1J8HE 1ZEAH 3PNWA 4JG0H 3TCLB 4QXGL 2PYED 3R8BB 4ZFOB 3NCBB 1TZIB 3FN0L 2VO5A 4QXTB 1I7UB 1JV5A 1U6AL 3E3QE 3ARZA 4OGAC 4WNQA 5FCUL 3DBXB 2E9WA 2XN9D 1VDGA 4O4YL 3BZ4B 4HS8H 2CXGA 3QFJD 3MA7A 3HZYA 4CVZB 4U6XA 4M6OL 5F9AC 5IHUL 1G7IB 1FNGB 2CO7B 5JW5B 4ZOBA 3MFGB 3EOYG 4D9RE 4WU7A 5EU7E 3CX5J 3PQYA 1GGIL 3OKDA 4OV5A 1A7PH 3TJEH 2RBLA 5TFSL 3VGHA 4PR5B 1TNMA 4Q9QH 1J8HA 5LGHL 3UJIH 4MXVE 3T0EB 4MD0A 3D0LA 2WP3T 2YKLL 4DW2L 5TDPB 3LKOA 3U7YL 3FO9A 1RZJC 1BWWA 1EO5A 3BGFB 1MNUL 3B2UC 3BIAX 2VABA 2A6JB 5D2LB 5IBLC 2UWEB 4Y5VA 4YJZL 2QQKL 1R5VA 3FB6A 4JM2D 3W9EA 3IJYB 4PG2C 2YPVH 3CLEH 3QNXB 4P5TA 3D0VB 1F3DJ 4HQQL 1SYSB 4ZAKA 3L5HA 4OGYH 1DBBL 4WI9A 1MJ7L 3HI6H 5KVDH 4BH8B 1DQLH 4JHWH 1EHAA 3X14A 1IEBB 3VD4A 2VSDA 2CUMA 5ADOH 4TSCL 5EBLA 3D85B 2BOBB 4HGMA 3UROR 4XCCL 1EAPA 4N8VB 4UTBH 1S9VB 3KPOA 2P49B 4OI8A 1KSRA 2IBGA 4PJEE 1I8IB 4M7LL 4OLZH 3PV7A 3BDYH 3L9RA 1I1FA 3LRSB 3HZVB 4K8RC 3NCMA 3C5ZB 1FVEA 3EOAA 3WXWH 3T2QA 4Z7VE 3K7UA 3PF2A 1R0AH 5FKPB 3QDJD 1NLDH 4MX7A 5KS9B 4HIJA 4HJGB 4RGMC 3BW9B 4RISL 1NCCH 4I48A 4BSVA 1NBYB 1PYWB 1XF3B 1ZT4A 4RGNE 5FUCC 4PJEA 5CEZH 3O41B 4YFLI 3RA7H 2J8UB 2AJVH 2G75B 1UJTA 1LGVA 4LRNL 1I1AC 3QJFA 1DQMH 4TTGA 5SV4A 2HTLD 3FFCE 4I18A 4QRRA 1BWMA 4P23B 1GC1C 1KIUA 1KCVL 3SEPA 1DQJB 1V7ML 4LBEA 5H37G 1A3QA 2XXMB 3PDDA 4XVTL 3VD7A 4L8SB 3BPCA 4Y1AE 3VFGH 2ZSWA 4EVNA 4XBGB 2DLTA 4EKXA 1WJ3A 2H3NB 2FO1A 3MRNB 4G6JL 3D1MC 2JCCB 1OCWL 1DR9A 4OZIE 3MRFA 5KSBE 3C2AL 4NT6A 3QG6A 4Z18A 3S3SA 4O51B 3U46A 1MHPL 2YBRB 3SDDC 4XGZA 1W8OA 1ZHKA 3DX6B 1D5BA 2X4TA 5F8RC 2A83A 3MRGB 1ED3B 4ZOCA 5C6WH 5FGBA 3L5IA 5EB9A 5C3LD 3EYFB 4IM8A 4KTEH 5ISZB 4XWGL 4AM0B 3HUJA 3LVEA 3REVB 4J6RH 3OAYH 5IR1B 1CFVH 2P5WB 3DX9B 3FOMA 4KRMB 4GRWF 4OZIA 5KSBA 4HDIA 3NIFE 4AEFA 1QBLL 3OKKB 4L9LB 4ODWB 1OY3B 4OLXL 5TE7L 3BIKA 4LHUB 4IIQC 4YXKH 2GTWA 2DDQH 1OTTC 1AFVH 2V7HB 4HFUL 5J1AB 3KPMB 1F11A 5SWSD 1F97A 4P57A 4D0BB 1GGBH 1OAZL 1NFKA 2APXA 1V05A 2DIBA 4YXHL 5E1AB 4D0CB 2H32H 1P4IL 5A2LH 4LEOB 2VLJB 5DEFB 3DTXB 4PJ9B 4PJ5B 2KBGA 1A1NB 5D7SH 3N1QC 4NDMB 2ITDA 4PY8I 4R4BA 4U1KB 3RBSA 3LRHA 1EZVY 1MF2H 1VFUA 1UH3A 2APFA 3QHFL 5E2TL 4GAJL 4NRZB 7FABL 1RJLB 2FL5B 3UYRL 1S8DB 1W72B 5GGTA 5K33A 3ARSA 3QZWA 1I7UA 5JPMB 5I1JH 4IRZL 3DBXA 5DMJB 3BZ4A 3S36L 4GXVH 2J4WL 1PZUB 1FNGA 1P7QD 4EIZC 4HFWB 4PJHF 3V0VB 1FZJA 2YD6A 3AM8A 3NAAH 4D0DB 3BXNA 4Z8FH 1VA9A 5FAAA 3BD3A 4KI5E 3RWIB 3QDHA 3RGVC 1ZWIA 3G6DH 2P46B 1EHXA 3ZDXF 5HHOD 4PR5A 4HKBA 1Q0YL 1F3RB 2VXSL 4P46B 4A6YB 4WW2F 5EA0L 4YX2H 2OZ4L 3BO8B 4ZTPL 2B1AH 2KKQA 4JY5H 2FX8H 1JNHB 1KEMH 4TUOB 5TDPA 2DM4A 1KJ2A 3UTTB 1R5WB 2EE9A 3MV8B 1C5DA 4K3EL 4KK6C 4Z7UB 3W39B 3KVQA 3U4AA 5I2IB 4DAGL 1KPRB 2HJLB 4LU5L 3ECBB 3WFDL 4JFZH 1IGIL 4J1UB 5D2LA 3WDIA 5D1QB 5FA3A 1DUZB 4M5ZH 3P0YH 1KPVA 3RRQA 3TVMD 4R4FH 1YNTB 1WBXA 3IJYA 1VHPA 5I71C 1RD6A 3NFSH 3F12A 1F90L 3QNXA 4ZD3L 3D0VA 2VXUH 2Y06H 1HKLL 1SYSA 3VW3L 1RURH 3WBDA 3UTSB 5F7MC 5DHXB 2NY4C 4MNHB 4BH8A 2BRRL 4DKFH 1Q9WB 1NFDB 1IEBA 2XKNB 5T5NG 5F1IB 1OTUC 2F5BL 1FCCA 2BOBA 2VISA 4ONHB 4JHZA 4PG9B 4YFLF 4N8VA 1IAOA 1S9VA 4M1GH 3NFNB 2WUBL 3VXSD 3KJ4C 3F5WA 3RDTB 1ZOXA 5C0BD 4AENB 2CDGA 1OARL 4LSPL 1JCKA 3C5ZA 4F37F 2HJFA 1EBPA 2FJHB 4YDVB 3UDWA 1MEXL 1JPFB 3TO4A 5FKPA 1OAUL 4E41D 5F96L 4EQ2A 5I1LA 4HWBH 3T65A 1MJUH 3RWGB 1EO7A 4ELMF 4UUJB 2UV3A 2IGFL 5CIPH 4I3GA 1P6FA 3BW9A 2ZUSA 4KJQC 5D7JC 3PGFH 4ORZC 1TQBB 4JM2F 1NBYA 1XF3A 1QFWM 4V1DD 1QSZA 4Y0GA 4HIXH 2V2XB 3O41A 4OCYH 2J8UA 1GJIA 1UJ3B 2FECL 2G75A 2WWMD 3ZKSD 4NUGH 2V9RA 2AEQH 4GXUM 1UA6H 2JE8A 5C2UB 3IVKB 1SYVB 4P23A 4NRXB 1T7ZA 1UYWH 1DQJA 3LS4H 4ODXB 3RY4A 3EJZC 3IJSB 4MMXC 3HE6C 4LEXL 2DWDB 4L8SA 4WTWA 4XBGA 1MJ8H 4HK3J 4QOKB 4YHLH 3ET9F 5IB1A 5HDQH 1W0YT 5HHME 1PFCA 1TETH 4O9HH 3B43A 3QIUA 3QXTA 5D5ME 1B88A 3OXRB 2JCCA 3JWDL 4ZMAT 2Z31C 2YUZA 3I6GB 2DN7A 1S7RB 3MRGA 2F54E 4XNUL 4XZUB 4GAGH 2ADGB 4N8CH 3PE9A 4AM0A 3AS1A 5I66B 4KK9C 2NR6D 2MFNA 5EBMB 2Y7QA 1A47A 3REVA 1A1OB 3F6IA 5IV2B 5IR1A 4LSUL 4G8EB 1HILA 3DX9A 1YPZF 5D5MA 1F6FB 2Q6WB 2RB8A 5MEPB 3EYSH 4JY4B 3ILPB 3FQWB 1NCAL 5E8EA 1N59A 4LHUA 2F54A 5BW7A 1E6OH 5E4IA 4GMTH 5C70A 2V7HA 3Q1SL 3L3JB 2VXQH 4Y4FD 4H1LA 4D0BA 4UTAL 4KJPD 4R96B 1K5NB 2X4UA 3FT4B 3U0PB 2FGZA 1F8TL 1T7VA 3U7WH 3I3EA 4OLUH 4F15C 1F4XH 1IT9H 2X40A 2VLJA 4LEOA 4N68A 3DTXA 4PJ9A 1RHHB 4PJ5A 1XGQB 4NDMA 5DD1H 5D72L 1QBAA 4NGHL 5D96B 2WP3O 1OB1B 4JQIL 4U1KA 3VFTA 5I1GH 3FRPG 1DUYA 1ZLWK 3TIDB 2F8VA 4X6DB 3VRLE 1VFBB 1W72A 1NC4D 1QRNE 1UB5A 4P0DA 1I7ZB 5FYKL 4ENED 1MPAL 3LN9A 5JQ6H 4TTDC 1ZE3C 1CICC 4PY8J 2JB6B 5JPMA 2Y07L 4KUZH 1KF9B 2XZAH 2W91A 2XWJB 2ESVD 4HFWA 3V4UH 4EXPX 3QRGL 2GY7B 2D7MA 3OF6D 3BH8B 2J12B 3MRLB 4D0DA 2WIIA 5HHVL 4JRYB 3STBA 3RWIA 1H3PL 4UDUB 4TSBL 4HWZB 4P2CG 4D8PB 4KTYA 4ZFOL 1X3DA 1OAKL 1QRNA 4G6ML 2CLZB 1AD0B 1DANU 1R5WA 4KAQL 3F7QA 3W39A 1F4WL 2Q8AL 5BMFH 1ZHLA 4PJAF 2GKIA 2IWGA 3MNWA 1T03L 3ECBA 2G60H 3GSNH 2EZ0C 3HAEB 1WZKA 4J1UA 5JNYB 5D1QA 5FM8A 5INCB 1DUZA 3ZT7A 4XHJC 3O2DA 4AEIL 1RZKH 2OTUB 4QHNA 4KKNA 3NN8A 3NGBC 1FPTH 3HE7C 4U6HB 4WVRA 1I3GL 4MNHA 1NBVH 4JGJA 3NCCB 1A2YB 3QCUL 4GBXC 1K85A 1FRGH 1RJYB 5F1IA 1UM5L 4V2BA 1NBZB 2Q8BH 4ONHA 1QKZH 5SX5K 4NYLA 1YEJH 2A6IA 3QQ3A 1BREA 1WITA 3NFNA 3ZKXC 1SY6H 4DTGH 4NWUL 4UOJA 4RIRA 4AENA 4RAUB 3X11A 3ZYOA 1T2QH 4AEHH 2FJHA 1JF6A 4YDVA 2EKSB 2WAHA 3T1FA 1A7BA 1KCRH 1JPFA 2VIRA 3N06B 1VEMA 2AAVA 2K9UA 1J1XH 4JFYB 3UZEA 5E8DH 4J4PD 2IAND 3RWGA 4YLQT 4UUJA 4ZS7H 2VAAA 4LGSB 4MAYA 5I1IL 1XF2A 3O4OB 4I1NB 4RGMB 3IKCB 4M3JA 5IB4B 3T4YB 1UJ3A 4MSWA 3H7LA 3QQ9D 5CD5C 1IC5L 4S1SH 4ZTOH 1QSFD 3BH9B 3K80A 3IVKA 1JGEA 3VXMB 4LCIL 2Z8VC 4ONFL 2B20A 3DO7A 5T3ZL 3NMEA 4ODXA 4BM7A 3WNOA 2H1PL 3IJSA 4O2FB 4WI8A 4M7KL 3T8XB 1G7PB 2DWDA 2FEEL 4ETQA 1PG7W 3QEQD 4P9MH 4JAMB 4JM4L 2XZZA 5GSRB 3MJ7A 3G6AA 3C5JA 1CLYL 2WNGA 4JO1H 3IDNA 1NAMB 4PJBF 3SOBH 3OXRA 4JPVL 3HLAA 2KQNA 3O2VL 4O2EA 4ODSH 5I74C 4LSTL 3CXHJ 1UFUA 5SX4I 3I6GA 1LDPH 4EN3D 4NN7C 1U3ZA 2Q87A 3QSKB 1QVOB 1JK8B 5KVFL 1G0DA 4XZUA 1A64A 2UYLB 3VFNB 5C0DB 4RFNC 4U7MA 3HMXL 1NDGB 5BOZG 4WO4D 1D6EB 5GGVY 4Z7NE 4IRJD 2CH8A 3DI3B 5AWNH 1BGXL 1A1OA 1T2JA 5IV2A 1KUMA 4M00A 2AV1A 4R0LA 2HKHL 2Z4QB 3GIVB 3ZTNL 4OD1H 5AYUL 3WKNA 3DV6B 3MZTA 5C0FA 1MRFH 4YHNB 2WQRA 4FRWA 5MEPA 4JY4A 1I9RH 3ILPA 3FQWA 3KXFD 3UAJD 5TDOA 3X3GH 3LIZL 5FO7B 2YC1B 3TT3L 2AI0H 4FP8H 2WLYA 4IIQB 3L3JA 1XGRB 2HVKB 5EFIB 4PV8B 1T83A 1K5NA 4TRPH 4Z77B 3U0PA 5J13C 2EXYD 4LF3A 4HUVB 4PRIE 4KMTH 3QUZD 2R15A 3SDAC 3A6BL 4TPRL 1J0HA 4MNGB 1RHHA 3ZE0E 1Q9OA 3BE1L 1BPVA 2GHWB 2YWZA 2F58L 3B5TA 3AXLA 1OB1A 1MFDL 4KKAC 3DX7B 4OLWH 5I1HH 3TIDA 4X6DA 4X9GA 5IHZB 4I4WA 2DJ4A 5K93A 3M1BA 4LQFL 4XPAH 1VFBA 4GRWE 2GJZB 1UVQB 1RIVL 3LEYL 4X9BA 5E1HB 1GCFA 5HYQA 4ZXBC 5IW6B 1WWWX 5CP7A 3AFLA 1S7XA 1NAKL 2R1YA 4PRIA 2XWJA 3SY0B 2H2SD 1I9IL 4TN9A 2IJ0C 4P3CH 3SHSA 4G6FB 2ERJC 1FCGA 3BH8A 4PPTA 5TE6L 1UCTA 4FQLH 4UOW0 3TZVD 3EIFA 4NKIH 3EYUL 4APQD 1W72L 1VFOA 2LU7A 4P3WA 3SE9H 3QIWC 1NGQL 3O4LD 1PZ5B 1NKOA 3V52L 2FLBT 3CFIC 1JWUB 2XG4A 2CIIB 2YUVA 3BSZH 3U4BL 5H37H 2GFBA 3TA3C 5SX4H 3JVGC 5D1XC 2AK4B 4ISVB 5FCUH 4YO0A 1NCTA 3HPLB 3IDXL 2VDKL 2YN5A 1H5BB 4RWYL 3SQBA 2Y36L 1OWWA 1G7MB 4A6YL 2ITCB 3CC5B</