3MLYL

Crystal structure of anti-hiv-1 v3 fab 3074 in complex with a ur29 v3 peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNMVSWYQQHPGTAPKLLIYENSKRPSGIPDRFSGSRSGTSATLGIIGLQTGDEAEYYCATWDGSLRTVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVRAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab light
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
molecule tags Immune system
total genus 45
structure length 214
sequence length 214
chains with identical sequence M
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlyL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlyL01
3PHOA 3HA0A 4MWFB 4P5TA 4U1NB 5GS1A 2HFEA 1YQ2A 3GJEB 4NN7C 3EO1B 1BD2A 1TJGH 3Q3GA 1CR9L 3ARGD 4L3EB 3DRQB 1OD9A 5HGDA 4TSAH 1ZT7B 5IM7A 3BH8A 1JNHA 1HHGB 3HS0B 4OKDA 1ZGLA 3VD5A 1MSPA 4GW4A 1RUAL 3SDDB 4YGVA 3A6BL 1ACYH 3Q5YA 4U1SB 1GGBH 4WJ5B 2FO4A 1T66C 3BPOB 4H25B 2QADC 3H42L 4XGZB 1HK6A 5IQ9A 2YBRA 1U9KA 3RWGA 5DDHB 1ZT4B 3U30B 3CVHA 3WHE1 1J12A 1Q0XH 5HYFA 3G6AB 4EI6A 3WUWB 3MRNA 4S11A 1BJ1J 1ZOXA 1KJ2A 4HLJA 1IFHH 4XVTH 1AY1H 1SBSH 2YD4A 4NO0B 4NNYB 4L1DA 1Z9MA 4GRWB 3WNLA 4DVRL 2HT4C 3BH9B 1YMHA 3V6BR 3KLHD 3VXME 1KXQE 5CBEB 4D8PA 5C7XH 1P7QD 5FF6A 2FD6H 4QHKJ 4RGND 5DYOA 5HD8D 1IGJA 1D9KA 5EZLA 3BKYH 3EDJA 4FNLH 4DVBA 5SWSB 5I66A 3QUXB 4QRSA 4NSKA 1JVKA 2VLLA 1NCBH 3BWAA 2D31A 4PJ7E 4J8RB 5D70L 3MV8D 5KSBF 5D7LA 3X13A 5JTWA 1MPAL 4DGYH 1J0KA 1KELL 1EEYB 3H9SD 2BNRA 3NCFB 1QPXA 4NDMA 3WUWG 3K1DA 3C6SA 1I1YB 1H15A 3BRDA 1G7LA 2FH8A 4LCWD 1NGXA 5BXFB 3I85A 2NY3B 3QQNA 5FGBA 1FFOA 3VGAC 4KI5F 4HXBL 5D71L 4CNIA 5FYJD 4RNRA 5E2UH 1LE5A 1BP3B 3FQXB 5AZ2H 3T65A 1T0MB 3BQUA 15C8H 3EYVA 5HTSA 3I2CH 2RBLA 1P5UA 3Q0HA 3D25A 3DYMA 3ULVF 2BK8A 2X2YA 1OTTC 3D2UD 4PD4K 4OI8A 3HI1B 1BBDH 1QKZL 4HDIB 2E6JA 3IS0X 3T0VA 4Y16D 1I7UB 4UDTB 5E08L 4MZ3A 3DHJA 4H5SB 1T7XA 2AJVL 4P2OB 4RGOH 4JY4B 2BY3A 1F11B 1KPVA 3MLZH 1OWWA 4JLRB 1GC1H 3TIDA 3BO8A 32C2A 5AD0A 3DECA 4P9ML 4BSVA 1A6WL 3O8XC 2Y23A 5FFLA 1HSAA 5IVXA 3CFJA 4P4RA 3CSPA 4NO3A 2IAMD 2EIEA 1EGJL 1UWGL 3RIAF 4O2EB 4WEBH 1ZGLP 2FX8H 5ILTL 3GSWA 4XMKH 3DYPA 5DUBB 4A6YB 2AGJH 3THMH 5J7CC 2KQMA 1LO5B 2HAZA 1JF5A 2ZNWA 1A6AA 3S34H 2V2TA 4NHUB 2JIXD 4LCIL 4ZQKA 4EBQL 5B3NA 4LSVH 5IB1A 2X9YA 5BV7B 2AEPL 2EYRB 1BBJA 1F3DJ 2NY2B 5D96C 2Z0BA 2ENSA 1LK3L 1D7FA 1WT5C 3KJ4C 1K6QL 4OF8A 3WIHL 4DZBB 2NW2B 4D2NA 2F19L 2CDFA 3QQ4B 4K07A 2DQTH 2VDNH 4PJAE 5D93B 1MLBB 1G7MA 1D3CA 1YYML 2HRPL 4G6KH 5K9JL 2QEJA 3WFCH 3TN0C 3QCTL 2NTFB 5C86A 4DFHA 3JV4B 3WFHA 4QTHB 3TM6A 1KN2H 4WHTB 5F72S 2OL3H 5TH2B 1TFHA 1R3HB 2G2RA 4MA3A 2R29H 1FG9C 2A6KA 1UXSA 5EULV 3WSQL 4YR6A 8FABA 5T1LD 1NDMA 2VKXA 2QADD 4NC1C 5GGVH 2NY4D 1K4DB 2GJZB 2VDLL 4K8RL 1AR1D 1NFIA 4X5XA 3QDAA 2ICES 3BOVA 5D1ZC 1NGPH 3B9KB 4Z76A 3QUZC 1PQZA 5EPMA 4F9PC 5FK9B 3FQRB 1YJDH 3GJFH 3MV9A 1VB9A 2EYSB 4WEUD 5DJDA 5IBUB 5E8OB 5L2KA 1MJJA 3QDMB 1EVUA 3RHWK 4ZFGH 3DI2B 2HT4D 5HGGS 1P9MC 5EN2A 3FB5B 1IRAY 1GPOH 3VRIB 3GM8A 2X4TA 2HVKB 3FN0H 1LP9A 4FMFA 3OKEB 1GGCL 1TDQA 2B4CC 4JY6A 2KKQA 4NQCD 5CJ8A 2YMXH 4MJ5A 4XBEH 4HWBL 2H26A 2HP4A 4APQC 3ARVA 3R4DA 3UTSA 1NBVL 3ARPA 1JGUH 4JO2L 1MAML 3MOQA 4R0LB 4MLIA 3IF1A 4TULH 2FECI 1MCHA 3MLUL 1GC1C 3MLXH 3PWPD 4GMTH 3GM0A 4LFHG 3D48R 3ZKQD 5IBUG 4HPOH 5FO8B 4RGNE 5CGTA 5IW6A 1FAIH 4F15C 5D2NA 3H7LA 1UKQA 2EDQA 3MV8E 5CJBA 4YDIL 3S35X 3WO3B 2A83B 2COQA 1I9EA 1IC4L 3H9SE 3O2DA 3I3EA 3G6DH 4JG1H 5ADOL 2HJFB 4LCWE 2UWEA 3QHTC 5T5NG 2VOTA 1EX0A 1BVLA 1FGVH 4NNPL 4ZSOA 3BDXA 4GKSB 1SQ2N 5FYJE 4JDTL 1UENA 2PYFA 1HH9A 4Q6IC 2E8ZA 4X6CA 4ACPA 3T0EA 3BESR 2I07B 4OM1L 5E94A 2F5BH 4FQLH 1GOHA 5BS0A 1X3DA 1CFSB 3HI5L 1F58L 1HYSD 3PGCA 2BSSA 4WY7L 3REVA 4RFEB 3MYZA 3ULUC 3BEWB 3GHEL 4CMMB 4MWFA 3RZWA 3KPLB 3EO1A 4JGUA 4HKXB 1QHPA 1IL1B 1ORSB 4RAHA 1YUHA 4I4WB 2GKIA 5IEKA 4ZOCA 1DQTA 3FQUA 1ZT7A 1QHOA 4IRJB 4LSDA 4PJFA 1BZQK 5DHVA 2HH0L 2ORBH 3V6OA 3VD9A 4HS8H 3ZTJG 1ETZB 3RAJH 5C9JB 2B1AL 3DUUB 3RVTC 3RDTD 2WUBH 4IRZL 2XZCH 3OR6A 3DTXB 5D9SA 1KB9K 4H25A 1T22B 3BUYA 4FRWA 1J1OL 1YJDC 1YEIL 2VN4A 1MFNA 3Q6GL 1OAUH 1J5OH 4NN5C 2FR4B 4ESKA 3MUGA 1DBKH 1T2JA 5KVGH 5DD1L 1G7QA 3DMMB 4WFHD 5K9OA 3QDJD 2JE8A 2DQJH 4V1DA 3NFSL 1QP1A 4Z7VB 5E8PB 4D0BA 2X89D 1K4CA 3FO9A 5CBEA 3TJEL 4Z0BH 3ZMRA 5DJZA 2FYYA 5C0CA 4L8CB 1UACH 4UT9L 2Q8AL 2P44B 3G5ZB 3G5XA 4NO2A 2P24B 4Z7UA 1EO8H 5HI4C 2R8SL 2PR4L 1IAOA 1FBIH 5E5MA 4I2XE 5K9QI 2YK1H 4DZ8A 4XVSL 4XPBL 5D1ZD 3S98A 1WEJH 4PJAF 5BZWB 4TOYL 4PLNC 3F62A 1F8TL 3QUZD 4JFPB 5BXFA 3UEZA 2PETA 4TSBH 4PGDA 4X6DE 3OAYH 4LU5L 2PNDA 1CXLA 1S9KC 1Q9WA 2GSGB 5KZCB 4HS3A 2OXGA 5CP3A 4FFYH 3PL6C 1T6WA 1JZ5A 1AXSB 2AXGA 4HDIA 4D3CH 5ACZB 1HHHA 4RAUA 5INDB 4M62H 4UAOB 4RSVA 1B0WA 3NZHL 5DFVC 4MAYD 3VXQA 4NRXA 4H5SA 1QLRB 2ZJSH 4JM4H 3X14B 4NQCE 1PG7H 2VQ1A 3RWIB 3X3FH 5KSAB 5F9JB 2IALB 3DGGA 3SDXB 3V4UH 5CEYB 2CUIA 1XMWA 4OLZH 1T3FA 3TNMB 3LHPL 3DVNB 5IW1B 3SDYL 1DEEB 2C5DC 2R39A 3BMWA 3PWPE 5EO0B 1XGRB 3HI6H 5C0BD 1U3HB 4YHOL 5F9WC 5GHWH 3N9GL 2GJ6D 1I9JH 5IKCA 3MBEA 1B6UA 3GGWB 4GRLC 3VI4E 4X9HA 4IJ3C 3LEVH 1WZLA 3OTTA 4N8PA 4YXKL 5C0EA 3FMGH 3KPPA 2CMRL 3CLFL 1JGLH 2V6HA 2I5YL 1CGUA 1HHIB 2K7PA 4Y4KD 1U8QA 5E7BA 5EBMB 4OD2B 5TE7L 1G0DA 1NUNB 2WBJC 4PV9A 3HE6C 4S1RH 5DEZA 1A14L 2EDTA 2O5XL 4LQFH 3RNKB 5J4MA 5J11B 1KEGH 4XC3H 3NCYS 1IAMA 1HQ4A 5DJ8A 5DHYB 2XQYK 2OYPA 1DVFC 2VDPH 4AMKL 4NWTL 3FFCA 5EBLB 4AH2A 3HRZB 4FQ1L 4YXHL 4I0CC 5I75C 5D7IE 3MRDB 5LWYH 1KN4H 3B83A 4OGXL 3S37X 3BGMA 1L7TL 1BAFH 1SEQH 4JRXD 3BDYL 3QUKA 4LLDB 3P11L 5EUKB 1ZLSH 4QRTB 1QEWA 1WITA 5EH1A 4JANB 4GG8B 3T8XB 2BVUA 1QSEB 5IK3A 3FB7B 4E5XB 1PVHA 4OFYD 3TO4D 4NBXB 1PKQE 4I0PD 3U6RA 1WISA 1WV7T 4DGIH 2ADGA 3NCBB 3MFFB 2QR0B 2IANA 2NY6D 3WNPA 3QHFH 3QHZL 4R2GB 4RFOL 4R7NB 3QUYC 5E70A 1AC0A 1C5BH 4IBLT 1Q9LA 1MJ8H 4QXGH 4LHQB 1DN2A 3VWKA 2PW1B 3QFJB 4X8JB 3CDGB 2Q76A 4HGKC 1YPZE 5FUZH 1X5HA 5GRUL 5CD5D 5JIIA 4JY5H 4P5KA 2YWZA 3BZDA 4OLUH 4QXUL 4HBQA 4QRRA 5DK3A 1KIRA 4WFHE 4B0MM 3QDJE 3G6JF 1MCPH 1RVFH 5JDJA 2BNQB 5ITBL 5DRZA 1K2DA 3VWJB 2PF6A 2ZKHH 4HIEB 1C1EH 4JPKH 3TBYB 4J4PD 1IILE 5CSBA 1A1OB 5DD6A 2NY0D 4CVUA 1JRHL 1S7XB 4F7MB 1JYVA 3AU1B 4FQPA 5EG6C 2BSRB 1PJ9A 4NC1E 4ZTPL 3PWNB 1CXIA 3BGFB 4YK4C 3QDGD 4QXTA 5BOZG 5CKGA 2OQJA 4LKCA 2EH7H 5L9DH 2AKRB 1LNUA 1D5XB 5MHSD 4TRPH 5I1KH 1FJ1B 4KTDL 5BVPH 2R69H 5KW9H 5GGTA 1H8OA 3EUUA 1UJ3A 3QG7H 4L4TB 4R3SA 4O02L 2AQ2A 5DFVD 1YEDA 4LRIA 4J1UA 4KZEL 5D7SL 1QVOA 3O41B 4X6DF 3SGJA 4UTBH 5FB8B 4JRYB 1CFSA 4O2FA 2WINB 4U49A 2FJFB 3SOBL 2AAVA 2LU4A 3UTTB 1JMZA 4MSWA 3AXLA 1IC7L 3VXRD 1XIWC 3OGCB 2IH1A 5J8OA 3TPUA 4NKMB 4QT5A 2RR3A 3D1MC 1NC4B 1UM5H 4CU7A 3X17A 1WIUA 3V0WH 3DNKA 4Z7NE 5GRJH 4M9PA 1MCCA 1DCLA 2FLRT 4FQQA 3O3EB 4AY0A 5J0BA 1ZHNB 5DEFB 1G9NC 4ERSH 5DVKA 2UY7A 5A40E 4PRPB 4PBWD 3PP4L 5C0BE 1N59A 1T22A 1RURH 3EO0A 1XR8A 5TDOA 4PJDF 2DLGA 2UV3A 3HE6D 1T83A 3E2HC 3MMEA 3QIBA 4N1CA 4XRCB 1CFTA 4XPHL 1G7PB 3T3PF 1LEKB 5JO5B 4OF7A 3FJTA 5MENB 3KYMB 5T3ZH 5H35A 4TNVK 1NBYB 2XN9D 3LS4H 3UXFA 2CGRH 3VI4F 5I17B 4I18A 4MA7L 2DIJA 4LOUC 3UMTA 5DXWA 2IQ9L 5DSCB 2FRGP 5FO9A 3PGFL 3OKMB 1VADA 4HIJB 4JVPA 4ZO6A 4W70A 1UM4H 2YZ8A 4HZLA 1WBYA 2UZYB 5JOFA 2WV3A 2QQQA 3G5ZA 3BKML 2DYPD 2WM0A 1RZIA 4H88H 4OZFH 4ZNCD 2GW5A 3T2PA 2Y36L 1EHAA 1A7PH 3WFEL 1FIGH 1X4YA 1NFDA 1DBJH 3QCUH 1URLA 3AS3A 2ERJB 3WIFA 1A7RL 3QIUD 4UB0L 2VXTL 4JFPA 4F7TB 4X7TB 4JRXE 1D5IH 3FQNA 5DO2D 4LSPL 4JZJC 1ZXQA 4LSQH 4H0IA 3WXWL 2BVOB 1C16B 5D7IF 5E6IA 3ZDXE 4OTXL 1CIUA 3P0GB 2X7LA 4M48H 3B9EA 1BFOB 1AIFB 1M7XA 4QRPD 4OLXH 4ELMA 3LQZB 2I9LA 4NYLB 4GLRH 4WUKH 4NQEB 5D1XD 4YNYB 4P48A 3W0WD 1ZLUH 5DK2B 4DAGH 3S96B 3HCVB 4YHZH 5HPMB 1FO0A 1OLLA 4YC2C 5JZ7C 1A5FL 4LPTA 4ZUTA 1H5BB 1I3UA 3ZKMD 3BZEA 4FQXA 4Y1AD 3ILPA 5SWQB 5EU6D 2DQIL 5KS9A 5FM4A 4OQ1A 4DN3L 1MHHB 3QQ3A 4WDIB 1GZPB 1R3KA 1ZEAL 1CLYL 5KSBB 1DANT 1S7WB 3FT4A 1UH4A 5I73C 3GNMH 2DWDB 4LLQB 3U4EB 1XFPA 2G75B 3MLTA 1YPZF 3BJLA 1CD1B 1KPRA 1P84J 3VXTA 4OV5B 5HHQB 3CX5K 1AFVL 5DLMH 3TV3H 1NGZB 1TVBA 1MELA 3UJJL 1JGVL 1XGRA 2JCCE 1N6QH 2E7LA 1IEBB 1AE6H 4PJ8C 5FGCB 2DLFH 4JO4L 1HSBA 3V52H 1DP0A 4YDLC 4PRIB 3GGWA 2VAAB 2C26A 4OKVB 5FM8A 2KUTA 4JM2D 1LO2H 3N1QC 5I1AB 5IG7B 1FORH 4X4MA 5F7MC 1U8HB 1MFDL 5IVZA 2W59A 5IEHB 1F3JA 5JXEC 2CR6A 3H7BA 4G8GA 1ZHKA 3X3GL 3QDGE 3LMJH 1MRDL 2AQ1A 3VMNA 1MLCB 4KC3B 1FE8H 3RZCB 2EIBA 3RNKA 4YHLL 4ZODA 1F4WH 5MHSE 4LLVB 4Q58C 5KG9B 3MFGB 4MA1C 1FFRA 4LEOB 4ALAL 3MA9L 2F8VA 4X7CC 3E3QE 4QCIA 1HCFX 3VXNB 4DOHE 2Q3ZA 5EORH 3TZVA 2Z35A 1KYOK 2YA2A 4NKQB 4XNYL 4PJCE 1QRNB 4JKPL 3HG1A 4KUZH 1I1AC 1WC7A 4NC2B 4MX7B 3RL2B 4W81A 4I48B 4FP8H 3SDAA 3C6LA 2JJVA 5D6CB 3HTLX 3CC5A 2ZOKB 3VCLB 3VXRE 4EN3B 5BRZB 5IHUL 4JFZL 4GXUN 1LQSR 2H2SD 1BQLH 1G7JA 4TVPL 4FABH 1HEZB 4WWID 2ICWI 1V7NL 1KTKE 3W9EB 3QXTA 2MHAB 1TZHA 5EIIA 5IR1A 4OD1H 1A1MB 3PQYD 3ARYA 5JDSA 2QR0A 3B2UD 4QRQA 5IHBA 1RPQA 1X4ZA 1D5BA 2C1OB 4WWKC 3HZYA 4IRSB 5CJXC 4ENEC 4Z7NF 4P46A 1XF1A 2B0SH 4DWHA 4PLKD 4GAGL 5T33H 3QFJA 2J88L 3CDGA 4P59H 1P1ZA 5TGBB 2RB8A 4K71B 2EDDA 2A73A 3P4OA 3DARA 3DX8A 1B2WH 1EMTL 2AABL 5CINH 1MCOH 1WQVT 3MRBB 3P9WB 1NMBH 4LGPB 5DQDL 1HOCA 4KUCD 4PJGA 5DFTA 1T5WB 2XN9E 3LKNB 4Y5VA 3DXAB 3ZYOA 3SE3A 1IEAA 3QG6B 4UV4H 4PGJA 4S1DC 3OAZK 5C08E 1OGAA 3RU8H 1FSKC 4N9GB 2G5BB 5FUOH 2WQ8A 1QFWI 3VFMA 4EI5A 1CFNB 1P84K 5DS8B 3RL1A 3C60B 3AU1A 1ZMYA 2IWGA 1NEZA 3HZMB 2QSCL 4H26A 4LDOB 2ID5A 3FB8B 4FQHA 3CVHH 4LCCA 3T4YB 2RCSL 3HZKB 4LSUL 1MCKA 1FG2B 3QWOB 3B6SB 5K9KB 3GSUB 4NHCH 1KJ2H 2AKRA 3GIZH 1X5LA 2DJ4A 3WKML 1X5FA 1PEZA 4HIHB 1P4BL 4M93C 3WLWC 3QRGH 4WUUA 4NFBA 1KACB 1YECL 2X40A 5DTFB 5FOBB 2FGWH 3KPRA 3FAXA 2ESVD 4QRPE 1H3XA 4KROB 5IVNA 1JV5B 4ODXB 3ZDXF 2VDKH 1A6VL 4M5ZH 5C07D 1Y18B 1R0AL 1C12B 3JBG7 1CD8A 3RWCB 1DSFH 1UZ6F 2XZAL 4JFOA 4P4KD 1UCBH 1LVEA 4L9LA 5JPNA 1U8JB 1KIPA 1XF5A 3DV4A 4EUPB 1BIIA 3FFDB 4Y1AE 4KVNH 2CUMA 5EU6E 4GBXD 4E42B 3AM8A 5C0IA 3QJHB 1KUMA 1QSFA 4EDWH 4CDGC 3ARFD 3BFOA 1S9XA 5CEZH 5AEAA 3S35L 2LVCA 4KXZI 2YD9A 3QT2A 3KPTA 1BX2B 1INDL 1Y6MR 3MOBH 4PGCA 1MWAA 4PJ8D 4Y8AA 4D9RD 3SPVA 2YPKA 4HJ0C 2YKLL 3KLAB 5FDWB 2EDLA 3CSYB 1ZHNA 5HDQH 1NANH 3MJ7A 4QRUB 4X80L 2APTA 5D7KD 2WANA 3GMLA 2VZUA 4U1GB 2IBBA 4MNGE 5KTEL 5GS3A 1NGYA 1YEEH 1DTUA 1F4YH 1UYWH 3WFBH 2I26N 4OCYH 2X41A 4EUPG 2VL5B 5FKPA 2VLKD 5T3ZD 1INQA 1WJ3A 3WN5A 2C4FU 2YEZB 1EIBA 1RUPL 5L7XL 4TNVF 4S1SH 3O6KL 4Z7WE 4H1LH 4KJWD 5FCUL 3LSOA 3TF7C 3W9DB 4MJID 4NJAL 1UM6H 3OJMB 1PDKA 4QKXB 3WDIA 1CQKA 4HG4K 5DRWB 1I1RA 5B3JF 5HI3C 2D0HA 5EIQA 3OV6A 4HV8B 2DQUH 4BKLB 2H2PC 1ADQL 1CFQA 5F7EL 2Q8BL 2ZUSA 2BVYA 4MQXC 1TXKA 3HR5B 3KPNA 3LIZL 1RZ8A 1MQKL 3O4LD 3U0TB 3DX6A 1N5YL 5FA4A 3NPSB 5A1AA 3EYFB 2B2XL 4JHBA 1NBZB 4MS8C 5LAXB 3CPLA 2P8LB 4JFQB 5DVNA 4L8SB 1QFUL 3VXUD 1KNOB 4PJCF 1QBMH 2R4RL 2X4UA 3KYAA 4RWYL 4JZOB 5ALCL 1H8NA 2GI7A 1G6RL 2PO6B 5LKNA 4R4BA 2BVOA 4HF5L 4FQIH 1UXWA 5HHOA 4K94H 1DQDH 1ACZA 2IPTL 3P30H 1AIFA 3EYSL 3IFLL 3S5LA 1MFBH 3TT1H 1DBML 5DA4A 3GUTB 3NCCB 2AJXH 2J1KA 3PQYE 4BUHA 3HCVA 5DJYB 4N1EA 3AAZA 5HDBE 3NA9H 1T1YA 5E6YA 4KGLA 3G5VB 3BPNC 2LE9A 5IF0A 1ZLVH 1MHEB 5HHVL 3L3DA 4OUOA 2R56H 2EE3A 5HHNA 1B9ZA 2FJGA 4S1DD 4P57B 4YZFE 4MQTB 1RMFL 1CICC 5EZOL 4ZAKC 5H2BB 2YZ1A 1ZVHA 3NFPA 3MNZB 4LLQA 2XKUA 4PJAB 2HLAB 3U4EA 3RWJA 3ESVF 1I8MA 1CD1A 1YQVL 3LVEA 1CL7L 3IB4A 5FGBC 1PYWB 4PRNB 5DMKB 2XT1B 3QH3A 4Y4FD 5I1LB 5SWZA 4UQ2B 5CBAB 1ZGLM 2MNUA 1FFNB 3C08L 4UINH 3SY0B 2JJUA 4HX1B 3T77A 1KJ3H 1LD9A 3KPOB 3NTCH 3ARGB 1RFDL 3CH8A 3FO1A 4NRZA 3KG5A 4ORGA 3UROR 4BQ9A 2VC2H 4R96A 4S1QH 4Y8DC 4O2CA 2ENYA 4KKAD 3L9RA 3ZT6A 4M9OA 4G8EB 5D6DA 5KVDH 2PYED 5LXGL 3PHQB 4JPWH 5CJ5A 2V5MA 3P4MA 4Z7OE 4E9LA 4NT6B 1CZ8L 1FV1B 5A3IC 5DWUH 3ETBF 1GXEA 2Y4SA 3AS0A 1TJGL 2IPKB 4NKOB 4LEOA 2NXYD 5HVFB 2C3VA 4TSAL 3GMQA 5E6ZA 2ESVE 4X9FA 5E56A 5C0FB 3VGBA 1N3NA 3MRQB 5EFIA 3EZJB 4TNWF 2V9QA 5C07E 1MUJA 2AJ3B 5I71C 4C58B 3OKKA 4HJ0D 2W91A 1ACYL 2HVJA 1GGBL 5E1AA 3VCLA 3T4AA 3IJYB 2FCBA 2YA0A 1G84A 3L5HA 1AGEA 3WE6A 4WI5A 1UJTA 3WMSA 2RJMA 4KJQD 4NZTH 1P7QB 5BZDB 1JI2A 2XTJC 1KJMA 4D9RE 1Q0XL 2MHAA 1X4XA 1DFBH 1I3VA 3GSOA 3N50A 3NOIA 1GOFA 2XG5A 3TYFA 4K94C 3MV8B 2B5IC 2DL2A 3KDMA 3O6LH 4XVTL 4GS7C 3I02B 1AY1L 1SBSL 4XCFH 3H9SB 4ZOBA 3SGKC 5D7KE 3EYQD 1YEHH 4P5TD 1T0NA 1JJUA 3RI5K 2ATPB 4LCWB 1BD2D 1TITA 3DBXB 2B20A 5C7XL 4AIXA 1KCUH 2FD6L 4KDWA 2FEDC 3P3YA 1OSZB 2VLKE 5CWSA 4HUVA 3BKYL 4FNLL 5T3ZE 2I24N 1YEGH 5HVWA 5HI3D 2CDEA 4JZNB 4N5EC 2W9DH 1NCBL 5ETUB 1UB6B 4L8BA 4XPTH 4YHPA 3HC0B 4LHUB 1AQDB 3BX7C 4IHOB 3RUGA 4PUBH 4KRLB 1X6NA 2BJMH 4LVEA 1FVDB 4DGYL 4MJIE 3DXAA 1Q9OA 4YHNB 4JM2F 4ZOEA 3MGTB 3MRJB 1ONQB 4MJ2A 3CZJA 3JTTA 1MEXH 4HPYH 4Z7WF 2V5SA 3ZSTA 5IB2A 4R26H 3D2UB 2X4QA 4N9GA 3O11B 2FX7H 1T5XA 2LTQC 3L3OA 3OB0K 1AGDA 4Y16B 4OF3A 3TFKD 4IMLA 4NQUA 5E2UL 3O4LE 2OSLA 2EXYC 3WNMA 5AZ2L 3STLA 15C8L 3I2CL 4NIKB 1TETH 2XWBB 4LHUG 4U1JB 4U6HB 4ZNEA 4PJ5A 3K46A 3ZO0A 1MCQA 3VXUE 3QEUA 3L7FB 2ITDB 5K9KA 3GSUA 1AI1L 3MNWA 1BBDL 2A74B 2DQFA 2VZVA 3QBTB 2NTSP 3LV3A 3V5KB 1D9KD 4Y7MA 2NYYC 2QTEA 2IAMB 4UU9B 3TBTB 2W38A 2GSIA 3G6JB 4ZS7H 4RGOL 5T1MB 3DWTA 3F12B 2W0LA 1JTPA 5D7LD 4FG6C 3MLZL 1CICD 2BNRD 2X4RA 1GC1L 3OKDB 4NM8H 2P8MA 3RWCA 3MO1A 5I8CB 1I8IA 5LCVH 4P2QE 5CEZD 5IT2L 2JIXB 4BJLA 1E6JH 3TIEB 2XOTA 2NY5H 5I1JH 3LB6C 2Z91B 4LCUA 5HDBF 2VO5A 5EIVA 1VFUA 4WEBL 3KPSA 4BH8A 1DR9A 3MROA 2FX8L 3BQUD 4KKBC 4XMKL 2VITA 3QB7C 4HD9A 1CE6B 4U2ZA 1IGTB 2AGJL 5FDWA 3THML 4DUWA 1WBZB 4C56A 4YZFF 4L3AA 1U8NA 5CD3B 5C1MB 1OP5H 1CDHA 1KLUA 3S34L 1FL3A 1X5IA 5DUPH 3BMVA 1A4KA 3JUYA 3ELAT 1IBGH 3QISA 1Q0YH 4ZFFB 5IMMB 1I7TA 5CP3H 5DK0B 4LARH 2DOCA 5DI8A 4PG9B 2J8UE 1K8IA 2CQVA 4ZO9A 3D87B 1CGXA 3KLSA 4X6DB 1XGTA 2DQTL 2VDNL 3A0OA 1TNMA 4PR5A 2NY4B 1U93A 1KG0B 3L3IA 4JFEA 3W9DA 3TEUA 2PYEE 2HMIC 4G6KL 3D18B 2DI9A 3UPRA 3QNZA 3WFCL 1G6RB 5J6GA 4POZC 4WHYH 5HJ3B 1JK8A 5JNYB 5TFSH 3RNQB 2CRYA 1KN2L 2YD2A 4NQDA 4P0DA 1OP3H 2OL3L 2CD0A 1AGBA 1YMME 2R29L 4JJ5B 2VABA 3T1WA 1MF2H 3LCYA 1U8IA 1XGYH 1G1YA 3X11B 5GGVL 3TJHD 1BEYH 3SDDC 3P2TA 1E4XI 4LEXH 4RX4A 1BQSA 1NGPL 3EYFA 5ANME 3BPOC 3PWJB 4NQCB 1NBZA 4TPRH 4JVUA 4BUGA 2P8LA 2P8PB 4A6YH 3LKOA 2JJSC 1YJDL 1JPFA 4Q0XH 4Y5YB 3U30C 4PJDB 2NY1B 2QLVB 1B4JH 3RP1A 5MERA 3PUCA 4PREA 1DQMH 4ZFGL 3LH2H 3PWPB 1HI6B 1WBXB 2DD8H 4GG6E 4PJEE 1GPOL 5F7UA 4HS6A 4Z5RB 4N0YH 1MFCH 4RMSA 3FN0L 3GUTA 3LN4A 2CKBB 3MR9A 2FEDD 4LLWB 1F4XH 1CT8A 2YMXL 3P40A 4XBEL 4RBPK 4LVHB 3L3HB 1HN1A 4HKBA 3AB0B 2QKIB 1JGUL 3M17B 2DM7A 2AXJA 4TULL 3SO3B 3QUXC 3LN5A 3MLXL 4GMTL 1BD2E 4HKZA 1FVEB 2GT9A 2R0LH 2BVTA 4HPOL 5ITFB 1JCKA 2DKSA 2DAVA 3TWCH 5A2JH 4P57A 1OGTB 1FAIL 4I77L 2X70B 2QV2A 1YN6A 2NY5C 3PABA 2HLAA 5CSZA 4F9LC 5CGMA 1GZQB 4JN2B 2QQKH 4IIQB 1L6ZA 2NY3C 4OFIA 3RGVA 3G6DL 1T20A 5L2KD 5D7IB 2E9WA 5I1LA 4LPWA 1IQWH 1FNEA 2A9MH 3HZVB 3SY0A 1S9WB 3T2NH 3NAAH 4HX1A 5DVMA 4ZUUA 5JIKA 2AV1B 4M7LH 1FGVL 3VG0H 3KPOA 3RY6A 5BJTB 5SX4I 3C5ZA 3QEHB 1CIDA 5ESQB 1CGTA 4OCMC 4PJBA 1FZOB 4HWZB 4MCZB 1BMGA 1PKQB 1TTFA 2F5BL 3UTSD 2BC4A 4FQLL 4AZ8A 3PHQA 1TQCB 3LDBB 4OLYH 4D9QD 1JWMA 1WTGT 5TE6H 1KB5A 1I7RA 3CZFA 3RDTB 3BP5B 3RIFK 4P2OC 3ZKSD 2JB5H 4NKOA 3OJ2C 2EECA 3SO5A 5FDYA 1ZS8B 2OTUB 3B2VH 1OW0C 3EDKA 1YPZB 3NIGE 4WV1A 1HHKB 1Y0LB 3LB6D 5D7LE 3MRQA 5IWLA 3SCMA 3VFPA 1LO0H 1RZKH 4HS8L 2BNRE 4YIQA 3RAJL 3QDJB 3EZ8A 2AJ3A 2YC1B 1SYSB 4L3CA 5GRWA 1MRFH 2WUBL 4HUWA 5JIHA 4EIZC 1KENH 5CEZE 1CQYA 2XZCL 3T0WA 5KAQF 5DRNA 4HK0A 2VJXA 4F37K 3MREB 2EKJA 2FEEI 1HINH 1J5OL 1OAUL 3I6KB 4LGRB 3GB7B 3I50H 1ES0B 1R5IB 5AAWA 1DBKL 1S5IL 3SGDI 5IMLB 1GHFH 5KVGL 5FA3A 3T0ED 2O5YH 2ZP0T 5GGTH 3TYGH 3CU7A 4GRMA 2H45A 3ES6B 5BS0D 4JCLA 5BV7C 3ALWA 3H6JA 2NY2C 3HMXA 4Q7DA 3ZTJH 1C5CH 2DQJL 4JFHD 3C9NB 4BK4A 4D0CA 2ZCHH 5CP7B 1L7IH 1MVFA 5D93C 2VE6B 4Z0BL 3IKCA 4GKNA 4L3ED 4WGWB 1IGIH 4ZPTB 2X4PB 1WWCA 1W72A 4YDKH 5FV1L 3PV7A 1QUNA 1UACL 3I84A 4NKIH 1RQ5A 4D9LH 4NRYB 1K8DA 4HH9B 1EO8L 1OB1B 3HC0A 3LKSA 2J8UF 2VZOA 4FHBD 3C2SA 1U58A 3IDJB 1J9CT 1FBIL 1WK0A 2EKSB 4QHUB 2YK1L 2R2BA 3V0VB 3N85H 3MGTA 1WEJL 2VRAA 2BZDA 1GIGH 2LU3A 5IVXE 1GGTA 3SJVA 2NNAB 3O11A 5DVOA 5EU3B 2OR9H 4TSBL 3B9KC 1PW3A 1VA9A 2R0KH 3SGEI 4WO4B 1ZWIA 1MCWW 5IB3B 2OP4H 1AQKH 1QBLH 4MAYB 3W81A 5JORB 5IIEA 4PV8B 1XGPB 3MLPA 3IDGB 2NLJA 3M45A 5DMJB 3HRPA 4PIRF 4V1DD 4FFYL 4XCNA 3VE0A 1S7SA 1ZVSB 3PWLA 2RQ8A 1AXTH 1DUYB 1P7HL 4D3CL 3K4AA 2X05A 2PW2A 3G5YB 4M62L 4NWUH 3ROLB 2IBZX 5C0CD 5C0BB 1LE9B 4U4BA 1GGIH 3G6JA 4ELKB 2GJ6B 2ZJSL 4JM4L 1RU9H 4CN6A 1XF4B 4R0LC 5AWNH 1PG7L 2IPUK 3X3FL 5GGVY 2WZPD 1RIHH 3V4UL 5I2IB 4GG6F 4HUMB 1QG3A 3K2UH 4OLZL 4Z95H 2YPLA 4DN4H 5F7NC 3MPCA 5F3BA 4Y4KB 4WNQB 2R2EA 2F8OA 1BJMA 3EJYC 1RZKC 5J13B 2YD1A 3HI6L 3LPGA 5I15H 4P2RB 4PYHA 5GHWL 1A1NA 2Z91A 2AW2A 3P9LA 3EDEA 2ZNXA 1I9JL 1MCFA 4UIKH 4D0DB 1BZ7B 2V7NB 3LEVL 3HFMH 1XF2B 4UV7H 3FMGL 4WRLA 4B41A 1JGLL 4ZFOL 4XCEB 2Q6WB 4PJHA 5L2KE 4BA8A 4S1RL 2MPAH 1WTLA 4LQFL 1KEGL 4JRXB 5F7DA 4XC3L 1A7OH 3GBNH 3S4SA 4U3XA 5BW7A 5IGXH 3N1MC 2I9TB 1LP9E 1DLFH 2VDPL 4RZCA 4N0CC 4R90H 2BP3A 3TO4B 1BZ9A 4N0RA 3UTSE 4HJJH 2KQNA 4ZPVB 3D18A 4HIXH 4I0PB 2QHRH 4YAQB 5LWYL 1KN4L 2NY6B 2BMKA 1SY6A 1BAFL 4IRJC 2LQRA 1SEQL 5HYSA 4LBEA 2NCMA 4YO0B 1ZLSL 3JWDH 3BXNB 4JAMB 4PRAA 4MD0B 3FQTA 3RVWC 3MBED 1GRWA 5D2NE 5KVEH 5FKAB 5IHLB 4YJZL 4TUKH 4CJ0A 1HZHH 3B5TA 3GJFK 1CXEA 2IBGA 4K2UH 3MGOA 3MLSH 3QXVA 4DGIL 1QR1A 2P7TB 4OCRH 3VFGH 2HTKD 1NUDA 2W65A 3NIGF 3MACH 4X98B 1ERNA 3BDBA 3QHFL 5MEPA 4KTYA 5EBWA 2UWEE 3KPQA 3VDCA 1T83C 5GS2H 4PJDA 5ID0B 5IFHH 1C5BL 5GGUB 1MJ8L 1R3IH 4ISVB 4QXGL 3T0DA 3V5DA 3DMMC 4ZSOE 4XVUD 3FT3B 3DPBA 2EDOA 5FUZL 5J3HC 5TQ2H 3IU3A 4Z5RA 4XNQB 4JY5L 5E2VH 4X6CE 1T6VN 2O61B 2NY0B 3FFCD 2Z4QA 4OLUL 5HHMD 3T0EE 3L3HA 5BS0E 1RHHB 2Y7QA 5JHDA 2J8OA 2ILLA 2QKIA 3SKJH 1XGQA 1MCPL 1RVFL 1H9VA 2EXWD 4JFHE 3R0NA 2AP2A 5DGRA 1MI5A 3MJ8B 1EJOH 1OTUC 3QDGB 4JB9H 4N0FB 2O93L 1FVEA 1S7UB 2ZKHL 2ZPKH 4L3EE 1C1EL 4JPKL 2UYLB 4M7ZB 2ICWA 1OGTA 4G80A 2YS4A 3GKZA 3WKNA 2FWOB 3PIQB 1MCSA 2EICA 2VIRB 3V6OE 1AD9B 1OT1A 1GZQA 3MRGA 3GMRA 1BFVH 1CK0H 1DJSA 2E3VA 2GFBA 2IAND 3D85A 1QO3A 5IB4B 4OSUH 3TVMA 5L8LB 4Z0XB 5F9OL 4LFHD 5BOPA 4DUVA 3PP3H 4X6FB 4Z78B 2EH7L 5L9DL 3FOLA 3VWKD 2A6JA 4TRPL 5I1KL 3VXRB 5BVPL 2R69L 1I7ZA 3GMNB 5HHPA 5KW9L 3CFDA 3PNWA 3AMKA 2OZ4H 4QOKB 5IVXF 3QG7L 3KWWB 2A1WH 4L29A 3FO0H 1UG9A 3C5JA 2JKXA 4UTBL 2HLFC 3HC4H 4V1DE 2ZUYA 4UAOC 1TVHB 3KS0J 5D1QB 2CLRA 3CFCH 3SKOB 5K59F 3BP5A 2DQGH 1HXYB 4YBHA 3EOYG 4F8TA 1ZS8A 1HHJA 3CCHB 4BK5A 5C8JA 1SM3H 3MUY1 1EGJA 1NGQH 3CFBB 1Y0LA 1UM5L 3JWDC 5EO9B 2Z92A 4LIQH 3V0WL 3WEXA 4GW1B 5T3XH 4XBGA 5GRJL 3UDWA 1B90A 1SJVA 1M4KA 4GMSH 4NCDA 1EEUA 1QYGH 2EO1A 3CD4A 3NZ8A 1U3HC 4ERSL 3L1OH 2XN9B 3UBXI 2BRQA 2I27N 1HQRB 1RURL 2NXZD 4L9DA 5J9PB 4HMCA 3T1FB 1WIOA 1ED3B 3TBSA 3U79A 1LEIB 3WIHA 1JF6A 3FOMA 1XZ0A 1MCLA 1N8ZA 2DYPB 3ZL4H 2HJLB 2JJTA 5T3ZL 4N0CD 5J11C 3U9UA 2EDHA 2VMFA 2CGRL 4KHXH 4MD4A 3DETC 5SX5H 2CR3A 4EOWH 2DKUA 2IADA 3JXAA 3VJ6A 5I8EA 3GSRB 3QIUB 3MA7A 4OLWH 3K80A 2IFGA 2BVPA 4IRJD 1UM4L 5MEOB 3DO7B 2W60B 5B4MD 3IGAB 5A2LH 4H88L 4MCYB 4QRPB 3C2AH 4JDZB 1KT2B 3IDJA 3KPMA 5DMGD 3QULA 5D2LA 1A7PL 3RA7H 4QHUA 1FIGL 1JL8A 1DBJL 5D1XB 1LP9F 3QCUL 2IF7A 3W0WB 2QQLH 3K0WA 4G6FB 4LF3B 4MJ6B 4JEGB 2JK5A 1D5IL 1KCVH 1ZANH 3A67H 4LSQL 4MXVE 4M8QB 3HE7A 5EU6B 3QIBD 5F9DC 1X7QB 4M48L 5E5RB 3NIDE 4D94A 1A9EA 4OLXL 4R2GC 4WUKL 5E5UB 3U2SA 4B5EA 1J8HA 4DAGL 3C09B 1WZ1H 4HWBA 4YHZL 4N9OB 5IMKB 1U8MA 1DUYA 1MIEH 4WTZG 4W4OC 3H3PH 4MNGB 3FRUB 3G5YA 3ROLA 4YEFA 1SYVA 4QF1A 4X4XA 2ZSWB 4XX1E 1OTUD 5ICZB 4X4YB 2AS5M 2UWEF 3ZKNC 3P4NB 2BY1A 4GO6B 3VG9C 2J6EH 5HHME 2WK2A 4ZFOB 4X6BB 3GNML 4JM2B 3VWJC 5SV4A 2XWTA 2BVQA 1WCBB 4Z7WB 3QEQA 4X6CF 1JPTH 2E27H 3KR3H 3NCMA 4OT1H 4G9FA 3SE9H 5DLML 3TV3L 2R23B 3RWEB 1E4KC 1FYTB 4BFIA 3UTPD 2HG5A 3L95A 3RVXC 1N6QL 3VFVA 4K7FA 4MXQD 4P2RA 5E6ID 3VFRB 1AE6L 2AXFB 4U1MB 2DLFL 4G6AC 3QZWA 3V52L 2D0GA 1XCTA 4JFXA 3ET9F 3BGFC 4F33A 2P5EA 1LO2L 3EFFA 2GITB 2L4OA 3J8F7 5KZCD 1FORL 4P5MA 1XF2A 3R0MA 1FNSH 2IANE 2EIZB 4TVSa 5EZJB 4PJFF 3UAJC 4XNUH 3BHBB 3LMJL 3MLYH 2HT2D 4M7LT 4FQXD 1J1PH 2XY2A 5F88B 1FE8L 1U8OA 1F4WL 4CBPA 5E2JA 1RJLA 3QNXA 1FRGH 4X4ZA 3VGEA 5E8NB 4U2YA 1BLNB 2WUCH 1OQXA 3V2AR 1JBJA 5EORL 5F1KC 4LCYB 3D0LB 2DJSA 4F80A 3H3BC 3RVUC 3HPJA 5I74B 3Q48A 4KUZL 1R3JB 1AH1A 2F74A 1LILA 5F1OB 1OSPH 4G43B 3AM8C 4FP8L 3GKWH 3CXHK 1V7MH 2GIYA 3CFKA 3DX7A 1HILA 4JAMA 3N1PC 1UVQA 1WFUA 3EOAB 3VFNB 1U6AH 2VXSH 3LKPB 2GTZB 1BQLL 4FABL 3L3KA 2AJZA 3HB3C 3BKJH 4RISH 1PD6A 2MQCA 5IHZB 1S7QA 4OD1L 4AT6B 4G8GD 5HI5D 1NAMB 4ZUVB 2P7TA 3MRKA 1R3LB 1HKLH 2A6DB 4WI2A 4Z7UF 4RQQB 3ULVH 1DL7H 2B0SL 3IDMB 3KXFA 3O45A 1XCQA 5T33L 3DETD 3ARBA 5L2JB 4U1IB 4P59L 4MGXA 3TZVD 1T04A 1XGUA 1S9VB 1U42A 2EZ0D 2O61A 2MQ0A 5CINL 1B2WL 1MCOL 4QHNA 3HG1D 1NMBL 1JYWA 4J12A 4XCYB 5CGYC 3HAEA 2D4DA 3C6LD 4UV4L 5CMAB 3SE4C 2X4NB 3RU8L 3T0AA 1YNLH 2F8XC 2V7HB 5FUOL 4KKCC 3V6ZA 1ZLWH 2K7QA 5GRXG 5E9DA 2VIRA 2ERJC 1TTGA 4Q9CA 1U95A 3GSNA 1PFCA 2V5TA 1OTSC 3TNNA 1NEUA 3FZUD 5GPRA 3CVHL 3NGBB 1CDYA 4HQQH 4Z0XA 5C07B 3DI3B 4P46D 1WFNA 3FB6A 2A6IB 3T3ME 4NHCL 4P4KB 1KJ2L 3GIZL 4IMKC 4C83A 1CG9B 3QFJD 4KDVA 3CFEB 3MTRA 3GBLA 1GOGA 5CILH 3QRGL 4JKMA 4XHQA 2VLRB 4GBXB 4IOIA 1NUGA 5HXMA 4R4NC 1ZA3A 4QOKA 4F2MB 4LPUA 2FGWL 3ARFB 3LKQB 3CDCA 5DHXB 4MXVF 5HHXH 1H5BC 1EBAA 5DJAB 1CGYA 5GRVK 2VDKL 3OF6A 4M5ZL 2K9UA 1KJVA 3DX9B 3NIDF 2Z31A 3JVGC 4GAYA 3EKCA 1DSFL 4N8VA 1XF3A 3LD8B 5D1QA 3WHXB 3MUZ1 4R8WH 4UBDC 4Z7VE 1UCBL 1OGAD 1ZT1A 4K23H 4JQVC 2CIIB 1NDGA 2DQHH 4KVNL 4LMQE 3ALXA 3H8NA 3F7RA 4UILH 4EI5D 5T3XD 4EDWL 3D3VA 1NC2B 5CEZL 1FNAA 3RVXD 2AEIT 4AIOA 1TENA 1ZA6B 2Q86B 5IJKC 3CFBA 4PJXA 5EO9A 5IVOA 5C92A 2ZUVA 3MOBL 2HT3C 2VR5A 1G7HB 4XAKD 1NFDE 2BERA 2VB5A 4ZFZA 3N0PB 4KI5C 5HDQL 5CHNB 1N7MH 4RRPA 3MLWH 2DLIA 1CXFA 1PEWA 4NBZB 3W11C 5E2WH 5L6YH 1YEEL 3QWQB 12E8H 1CDBA 1UYWL 3UTPE 3WFBL 4UT7H 4OCYL 4YE4H 1HQRA 4WUUD 2X1WL 3WXVH 3ULVC 3QIWA 3O9WA 3U0PB 4PLJC 3GBMH 3KPRD 4DW2H 4ELME 1KCSH 4RIRA 4XNMA 1SJHA 3MRIB 4S1SL 3O4LB 5GGRA 3ZYIA 3DUSB 2FNBA 4YUEH 3RZCC 4ZXBA 1EV2E 4NPYA 1JGDA 1UM6L 3UTTD 4EDXA 2VDRH 4K7PH 3CIQA 1J0JA 3VXUB 3BN9C 4MNHA 5FXCH 4YDJB 4DKEH 1IAII 1QSFD 2P43B 2DQUL 3F7VA 3IFOB 5EA0H 4EUPH 2NR6C 1LDPH 4XPAH 1NC4D 2W60A 1EERB 3IJSB 5BQ7B 5DJ6A 4MAUH 4WHCA 4JDZA 1MQ8A 4EN3C 3EJZC 4G8IA 4BFBD 1QBML 3EBAA 4PRPD 3TGXA 1DQLH 2IMMA 5TF1H 2FGZA 4WENB 3ZLQC 1JHTA 3RTQA 4FQIL 1IM3B 5B38B 3JV6A 3U36B 1X7QA 4K94L 1DQDL 1XEDA 2BRRH 3P30L 3AREA 3TT1L 1ZLUK 1MFBL 1I9RH 4JPIB 4FQJH 4IRSC 4X4ME 2AJXL 3KHQA 4YFEA 2M8XA 1NBQA 1MCDA 4G8GE 4U6TA 1DDHB 5CJQH 3OJDB 1N26A 1JZ3A 5IMKA 4FZEH 5I1GH 5KAQG 2RFXA 3NA9L 1PAMA 1J87A 5B21A 3GFUA 1R24A 4OJFH 2L7UA 4QHLA 2GCYA 4K71C 3MJ9H 2X4SA 3HHRB 2R56L 4Y4FB 2ZSWA 4Z6AT 3VFTA 4X4YA 5E4IA 2J8UB 2E7MA 4MD5B 3B3IA 2WIIB 5GGSY 5B38G 2ICEB 1FZJB 4XXCA 4Y4HB 1JI1A 3HG1E 3LPFA 2Z8WC 4XTRC 1OL0A 5J12B 5A43C 2KPNA 2PYEB 3V4VH 1HWHB 1RK1B 3WFZA 1FYTA 2FDBP 3C60C 3MRLA 3WS3B 1WUNT 1FFPB 4UINL 5C0GB 3DGCR 2FATH 5HHOD 1QSEE 5DEGA 5TDPB 3ULSB 1NGWB 3UYRH 4M3KB 1KJ3L 2NXYB 3NTCL 5JUEL 1NCUA 2QQNH 1H0DA 2VC2L 3L6FA 4FXGA 4S1QL 4NQED 5BMFH 3ARDB 3CK0H 3PWVB 4R4ND 4B50A 5KVDL 3PWUA 5ANMB 3MCKB 4JPWL 2VXQH 1P2CB 3TCXA 5GGSB 2VDOH 3BIKA 1FL6A 2BVEA 3FHQA 1VKXB 5DWUL 1KC5H 3QFJE 4UBDD 3H2WA 4KROC 4O51A 35C8H 4YWGH 4ZS6D 4UIMA 43C9A 3T3MF 3D5OF 2WWMC 4M7JH 4GG6B 1F5WA 3S88H 5EO1A 5DRXA 43CAA 4LCYA 5I6XB 1YY8B 1GL4B 5I1DB 1EXUA 2Q20A 4PJGE 4QYOB 3IVKB 2BNQE 3RKDC 1I8LC 4G43A 3EW3B 4RWHA 1SEBA 5J1AB 1OGAE 5SWZD 3VH8G 1I3RA 3PHOB 1TTUA 4P5TB 5GS1B 2HFEB 3W11D 4LIQE 4LAQH 5T3XE 3KYKH 3I6LE 4FXKA 4NZTL 5AG9A 5KOMC 4UNUA 2BOBA 5IM7B 4AEEA 4LP5A 5F21B 4WI7A 1DFBL 3BH8B 4U1GC 1JNHB 4PGBA 4XAKE 3VXMA 1NAMA 5F44A 4LLUA 1AC6A 4HC1H 5LGJA 3O6LL 3QXUA 3TBVA 4XCFL 4GW4B 4NO5A 4G8FA 4YGVB 5E8DH 1YEHL 4PRHB 3IDMA 1NFDF 4PJ7A 4AQ1B 2FZ3A 1KCUL 1IAKA 4KK6C 2YBRB 4U1IA 5I0DA 5IQ9B 3A6CH 3OXSA 3PDOB 3KPRE 4HCRA 1YEGL 1IKNC 1FH5H 3RX7A 2W9DL 3C8KA 2AJSH 3CVHB 1KCRH 4XPTL 4E0RA 5CLWA 2K3TA 1NCDH 5ENWA 4PUBL 4EI6B 4HGMA 4M7KH 3MRNB 3CSGA 2BJML 4ELMF 3UTTE 2BNUA 3KNBA 4DQOH 4HPYL 1MEXL 4R26L 1U3JA 1YMHB 2FX7L 4HXAH 4BH7A 5FF6B 4D8PB 2P45B 4LASH 5DYOB 1IGJB 1D9KB 5FYLD 5EZLB 1EEZA 5KS9F 4L8SC 4QRSB 4NSKB 3T2QA 4L1HA 2Y1VA 2D31B 4J3XA 3S3PA 1WWBX 2PO6C 2C7UA 5D7LB 3X13B 1JF1A 1HXMB 5KSUA 4ODHH 2BNRB 4NDMB 4Y2DB 3C6SB 4PRPE 4QEGA 3BYYA 4F3FA 5ECJE 1H15B 4JO1H 1MCJA 1G7LB 4WI6A 1NGXB 1XR9A 1K5NB 5C71A 1FFOB 4WTWA 1IT9H 4ZS7L 4CNIB 4CVZA 1EEQA 4RNRB 4OFPA 3T2OA 1LE5B 4NZRH 5KOVC 3T65B 1OVZA 3BQUB 3QUMA 3GIVB 2ARJQ 3DXAD 3D25B 4NM8L 5FYJH 5EU4A 1A0QH 5LCVL 5GIRA 4LDEB 2XNAA 1FZKA 1E6JL 2R1XB 2NY5L 5I1JL 2RGSA 1EHLH 4BZ1H 1ZA6A 3UJTH 2A0LC 5CJOH 4XC1H 1KPVB 1U92A 1AKJA 1DQQB 4PJ5D 4XMPH 3TIDB 3S8WA 3BO8B 5H8DA 32C2B 5CIPA 4U05A 5DUPL 5AD0B 4BSVB 1IBGL 1Q0YL 1VGKA 3ARGC 3DHMA 2BFVH 5I16A 4LARL 1HSAB 5IVXB 4M6OH 3CFJB 4YFDB 4P4RB 5HHOE 3V5HB 4PJ9A 4NO3B 4X8XA 3DRTB 4LMQI 1CGWA 1SMAA 1UZ8A 3BD5A 3GSWB 4YPGA 3MRIA 5DF0A 4NQEE 2UZIH 2WWMD 1EAPB 3VFWB 4X5WA 2X42A 1A6AB 2V2TB 5DQ9A 3MZTA 5TFSL 4LNVA 4ZQKB 2EDNA 3NVQA 3RKDD 4P23A 3TP4A 5IB1B 4JKLA 1BBJB 1EUUA 2ADIB 1L9MA 1MF2L 1XGYL 4AEFA 3KPSD 2AI0H 1BEYL 2CDFB 1Z6JT 4LEXL 5DA0B 3B4NA 2AXHA 4C56D 2WBKA 2FLBT 3FKUS 4TPRL 3S3SA 3GRWA 3I6GA 3K2MC 4A6YL 4BQ6A 3KLHC 3WFHB 2O26U 4Q0XL 4I5BA 4PJGF 1B4JL 4KAQH 1DBAH 1DQML 1T21B 4GAFB 3LH2L 2G2RB 1IM3A 1BOGA 4MA3B 2A6KB 1UXSB 4FFVD 2DD8L 1LEGB 8FABB 3SBWC 2YUXA 4N0YL 4JPIA 4YHYB 4X5XB 1S3KH 1F4XL 4JFED 4Z76B 2FB4H 1OM3H 4U1HA 1RULH 5JMRA 4NQDD 3MV9B 3BYTA 2BY2A 2H6PA 1VHPA 2Q7YA 5ELIA 1JHKH 1MJJB 5EC1B 5E99H 2R0LL 3EGSA 3TWCL 3UP1A 1SY6H 3JWOH 5MI0B 4U7SA 5EN2B 2PUQT 2XRAH 5F96H 2X4TB 4RX4D 4R7DA 1MHPH 2NW3A 4JY6B 4MJ5B 2QQKL 1VACA 2H26B 2P4AB 1MREH 1PLGH 4Y16C 5FYKD 3ZE1E 3IF1B 4YHMH 4PTTA 1IQWL 4DKDC 1FFPA 4XP5H 2A9ML 3L3JA 3T2NL 3MRCB 2EO9A 1HH6A 3BJ91 3NAAL 4FQCH 4M7LL 3ULSA 4AEIH 3VG0L 4UTAH 5IW6B 5FYLE 5E24E 3BIBX 5D2NB 3ARDA 4PP2A 1A8JH 1N6UA 3NCJH 3H0TA 2X6MA 1FP5A 1YNTA 5F1IA 4NBYB 2CKBH 4OLYL 3DROB 5TE6L 1Q72H 5HVHB 5FO7A 5JLZA 1UA6H 3CLEH 2IAMC 2UWEB 4ONOA 4K3GA 2JB5L 2HN7B 2A9NH 4OF5A 1M1SA 1M6OA 3EHBC 3PV6A 3BWUC 4FMKA 4ZSOB 3B2VL 4KRNA 4M3JA 3SHSA 4YHIA 1W2KT 4K3HA 1O7SA 2PYFB 5I1DA 2OJEA 5F7HA 1Z9SA 2D7OA 4X6CB 5HGBA 1LO0L 3T0EB 1RZKL 5FUCE 3V8CA 5E94B 3DXAE 5BS0B 3RGVD 3PGCB 2IH3A 4NQVA 2XI9A 3REVB 4KK8C 4N8CH 1L0QA 1MRFL 4U6XA 1KENL 1Q9KA 3DVIA 1MCEA 5CLTA 4OCLC 3NIFF 4KKNA 1DQJA 1HINL 2DQDH 3FQWA 1YUHB 3I50L 3TT3H 3C5ZD 5IEKB 3FQUB 2DB8A 3TBWA 1T03H 1GHFL 4HUKB 2O5YL 2J8HA 5GGTL 4PJFB 1VFBB 3TYGL 4DTGH 5DHVB 5I0ZA 4AENA 4PJ5E 4LPVA 5EOTA 1RJCA 3CGTA 3L5WA 3P0VH 1C5CL 2DBJA 4NUGH 2LAGB 2ZCHL 4EXKA 2XG4A 1L7IL 4PRHA 5BW7C 3OR6B 5D9SB 5FGRA 2NY4C 1U8KA 1AR1C 1CCZA 3BUYB 2VLJB 4I2XA 1IGIL 3PDOA 4YDKL 5E8EA 4R4FH 4NKIL 1QFWH 3MUGB 5D7JB 5EOQH 4D9LL 2M1KA 3SCMD 3VFOA 1RZJH 1G7QB 1ZKAA 3JWOC 1RIUH 5K9OB 4RMQA 1T0PB 3N85L 3UBXA 4V1DB 2CLVA 3UZEA 4AM0A 1GIGL 1X5JA 2OR9L 4D0BB 1K4CB 3FO9B 3B5HA 5LVEA 2R0KL 2EDWA 3KPSE 5DJZB 3TH2T 3VXSB 4PRBA 2FYYB 5C0CB 3ECBA 2OP4L 1AQKL 1QBLL 4EBQH 4IOFD 1OPGH 3G5XB 4NO2B 2EYTA 4Z7UB 2OMNA 4Y5YC 4G5ZH 4C56E 2DQEH 2AJYH 2NY1C 5GS0D 1HXMA 3U1SH 1IAOB 5E5MB 1K6QH 2CUHA 4DZ8B 4Y2DA 5FECA 1AXTL 3BI9X 2EDJA 4NWUL 1K5NA 1WIPA 3NN8A 2GHWB 5HYJB 4LVHC 1KV3A 4PGDB 3AB0C 1GGIL 1QFOA 1NQBA 4BYHA 4LHUD 4L4VB 1RU9L 3QYCA 5AWNL 4KXZH 4FQ2H 3SO3C 1RIHL 1NPUA 1Q9WB 3GIVA 5DC4B 4HS3B 4BELD 3K2UL 1WICA 4Z95L 4FA8A 4DN4L 3VXPA 4PGEA 4J3TA 4ETQA 1CLZH 2C4FT 3SJVD 3MJGX 1RJZA 1S7TA 2WLYA 5CSGA 2AXGB 3BSZH 1JWSA 2GYSA 2BCKA 2R1XA 2UVEA 1NKOA 3UPAA 5I15L 1HHHB 4RAUB 4MMXC 2FSEA 4IIQC 1VFMA 3VXQB 4NRXB 4UIKL 1X5YA 5C6PB 4XP4H 1OP5K 1HYSC 2QSTA 2Y06H 3HFML 3U7YH 3FN9A 1KXVC 3QO1A 3IDYB 2VQ1B 4MHHG 1DQQA 3AY4A 3DGGB 4UV7L 4YGAB 4PRDA 1T3FB 3EO9H 5FYKE 3WIIH 4W6WB 5MEQA 2MPAL 4YXLH 4HWBH 3IKKA 1P69B 1YY9C 3MBXH 2EDFA 3V5HA 1A7OL 3GBNL 2PTVA 3DRTA 2ZG2A 3ZE1F 1UKSA 1JZ4A 5IGXL 1TQCC 2R0ZH 3LDBC 1DLFL 5E1HB 5AZEH 5IKCB 3MBEB 4IS6A 3MRHA 4R90L 3EHBD 1RIVH 3RDTC 1FL5A 1EAPA 4OCSH 1T80A 3ZSSA 5C0EB 2YPLD 4HJJL 3VFWA 4HIXL 1OP3K 3KPPB 2HTLD 3O8XA 4WHYG 2QHRL 3QDHA 1U8QB 1RZJC 4ZG1A 4CAGA 1F4AA 4PV9B 3JWDL 3K4ZA 2ADIA 3ROOA 4KK8D 2UY6A 3CH1A 4YFLF 3UDWC 1HQ4B 5DJ8B 3BPCA 2DI8A 4YBLB 5KVEL 1QZ1A 1BOYA 1GAFH 3VRJA 4TUKL 2AJUH 3BZ4A 1HZHL 4ODUA 4HUXA 1TZIA 3EFDH 3FFCB 2SEBA 2VTFA 4K2UL 5HHMB 4AH2B 3HUJA 4OCRL 4YH6A 3VFGL 5ALBH 1EVTC 4M1CD 3MACL 3S97C 3OPZH 5GJTH 3RUGF 1EJ6A 1QA9A 3BGMB 5IFHL 3UTQB 5DC9B 2F58H 1T21A 1R3IL 5I76B 3UYOD 3QUKB 5A2IH 7FABH 3MC0A 1LEGA 3QXAA 3FCTA 1QEWB 1FLRH 3WYRA 5TQ2L 3UC0H 1TLKA 1VESA 2E7CA 5IK3B 5E2VL 5CUSH 2VERN 4XX1G 1J0HA 3TN0A 5KVMC 2LU7A 3SQOH 3D9AH 3U6RB 1MCBA 3SKJL 2X1PA 2ADGB 1D6VH 2IANB 4JJHA 5ICYA 1RD6A 5FHAH 4LPXA 1EJOL 4EVNA 2HJKA 4JB9L 4ONHB 3F6IA 4K3EH 5EC1A 1Q9LB 4XB8A 3VWKB 4AIZA 3UTZA 4XBPA 5GISH 2Q76B 4A2LA 4KJPD 4MVBD 2X1OA 1QFWM 3QUZA 4P5KB 4UQ3B 3ZZ1A 4F9PA 4QRRB 2IG2H 1KIRB 1BFVL 1CK0L 4CADA 1BQHA 5IQ7H 4OSUL 2GK0A 3IS1X 4WO4C 2NY1D 5DRZB 1K2DB 4MAYC 3RJQB 4QTIL 1X5GA 3MRCA 2N4IA 3Q2CA 1LO3H 1TCRA 3REWA 5DD6B 2OZ4L 2FJHA 4EQ3A 4P3DA 3B9VA 1GVIA 3W82A 4APQA 2A1WL 5JW3H 5JHDD 4FTVA 2D3VA 3BVNA 3OAUH 4XVJH 3HC4L 4PBVC 3DROA 1MI5D 2E8YA 3CFCL 2VUYA 4QXTB 2DQGL 1V3LA 1YEJH 5GZOD 1A2YB 2OQJB 4LKCB 2HN7A 3HAEH 4G6MH 1LNUB 4PJIF 4OFKA 2WP3T 4I13B 3P73A 5IROC 4M5YH 2NXZB 1UJ3B 1SM3L 4S10A 1NGQL 4R3SB 4LIQL 1YEDB 4Y4KC 2D7NA 5T3XL 3D85D 4P99A 3O6FB 2BXZA 4J1UB 5J13C 1QVOB 4GMSL 1QYGL 4O2FB 3TVMD 1M71A 1VEMA 1MH5A 1AO7B 3GSNH 3L1OL 1B6DA 3SJVE 2OM5A 4MSWB 3KVQA 3AXLB 4HH8A 3U4BH 4YFLI 5E2TH 2IH1B 2BSTA 3TPUB 5EUOA 4QT5B 3LEYH 2VZ3A 1WFOA 1YY9D 1OF2A 3ARWA 3DJ9A 1VFBA 2O5ZH 1GH7A 1EK3A 5CAYB 3ARUA 3BT2L 3U46A 4HUUB 3ZL4L 4LLMA 3LRSA 2FBOJ 4FQQB 3NCYP 3ILQD 3WNNA 4KHXL 3QXDA 4EOWL 1T1ZA 4XZUA 5DQJB 3IDXH 5IFJA 4P49A 2CK0H 3E6HA 4OLWL 1N59B 1OAYH 2VLJA 4HFWA 3TO2A 3EO0B 3TO4C 2OL3A 1XR8B 4QHMB 5TDOB 3G6JE 4Z77A 4HT1H 4I0PC 5GZNC 4Q9QH 3MMEB 3QIBB 1RV6X 5D7JA 1CFTB 4I8DA 2FX9H 2NY6C 3C2AL 5F6HI 1BVZA 3RA7L 2YPLE 3VGHA 3QEGH 5H35B 3TCLA 2QQLL 3NA4A 4I18B 1QBBA 4XP6H 4JHWH 5DZNA 3GJFA 4UI2A 2P46B 5CD5C 1KCVL 3QQ9D 4M43H 5FO9B 1ZANL 5DJ0A 1BQUA 3A67L 1MCIA 1JPGA 3F65A 4OGAC 3VXSA 1VADB 3NMEA 5ESVA 4GKZA 4HZLB 1WBYB 2Y5EA 1CDJA 5JOFB 4XP1H 1RZIB 4Z18A 4LVNB 5HSFA 1YDPA 1WZ1L 1NFDB 4PJHE 2ADJA 5M7QA 4NZUH 3WIFB 4J4PC 1MIEL 3H3PL 2NY0C 3FQNB 3RPIA 3H9HA 2A2QT 1CF8H 2AK4B 4MNQA 5HYJA 4XXDA 1RUKH 3OG4B 5E6IB 2DJUA 5ADPH 2X7LB 5IFAH 4OZHA 5FM5M 4L4VA 2J6EL 4ELMB 4WI8A 2I9LB 2ED8A 2MJWA 3RX5A 3MRPA 2FH6A 4JVWA 4S2SA 1JPTL 2E27L 3KR3L 4M7ZC 1FO0B 4OT1L 3VGDA 4PJBF 4KMQA 5FIEA 3SE9L 1IGYA 4PY7A 4ZUTB 3IU4H 2MTPA 4KDTC 3BZEB 1IM9A 5ICXA 3E3QC 2APBA 4FQXB 5F9AC 3ILPB 3GI8H 1JNLH 4WO4D 3HE7D 2APFA 5KS9B 3OX8A 1G0YR 5C0JA 1CDIA 1WZMA 3PDGA 3QQ3B 3BE1H 3RVVD 1R3KB 2ZOLA 4XMLH 3FT4B 3KLDA 2KBGA 3QXWA 2H41A 1N5AA 5D5MF 4XNXH 3VXOA 1FNSL 5H37G 1J8HD 3PL6A 5INCA 3MLTB 3KS0H 4JQXC 1TNNA 1KPRB 4R97B 2XPGB 4XNUL 3VXTB 4TUOA 3MLYL 4PJDE 2DKMA 1J1PL 1TVBB 1CI5A 3UJIH 2R1YB 1KCKA 2VKWA 3T3PE 4ZYKA 4M6NH 5ERWA 3GMPB 3ISWA 1UH3A 1FRGL 5DD0H 2KDGA 4MDJA 3WFDH 1NLBH 1HSBB 2X10A 2WUCL 2WP3O 1C5DA 1VEPA 5D1QC 3VFSA 1ZSDA 2P5WA 5JHDE 1F6AA 1UC6A 3QEQD 1E4XH 5IVZB 1UQSA 1F3JB 1OSPL 3H7BB 4G8GB 1ZHKB 4G9FD 1KIQA 4RMRA 1OQOA 3GKWL 3LOWA 1Q94A 1M05A 1V7ML 1VFAB 1EFXA 1M7DA 2DIBA 1DLHA 4P2RD 3CDYA 2EIDA 3BP4A 4KRPB 3K3QA 1J0ZA 2VXSL 1U6AL 4GRLA 4R6UA 1OLZA 2ZCKH 3OXRB 4TYUA 3HKFA 2R1WA 4QCIB 3BKJL 4RISL 3TZVB 2Z35B 2GUOA 1FIEA 2Y25A 3HG1B 1HKLL 1AD0A 1WC7B 2WBJA 3HE6A 3ULVL 3IAQA 5FGSA 3DIFA 3SDAB 3C6LB 1DL7L 3UTQA 3WO4B 4KZEH 3CC5B 5I76A 2FECL 1DVFA 2CLZB 1G7JB 1U3YA 1EZVY 4CN4A 5C08A 4YBQD 1TZHB 1YEKH 5EIIB 5GZND 5IR1B 2F53A 3QIUC 5JDSB 3KYOA 3PGDB 3QRFM 4QRQB 1D5BB 4HK3J 5DO2C 1CTOA 4EKXA 3RHWF 4KZDH 3EDFA 3HZYB 1FNHA 3NPZB 4ONHA 4P46B 1YNLL 1AP2B 4HHAA 1JMXA 5I1IH 1S7RA 1NUFA 5A2FA 3IJHA 3O2VH 1JZ6A 1W0VA 5SV3A 1BF2A 3U7WH 3BP7B 1P1ZB 5D1XC 4UQ3A 1RUMH 1KF9B 2A73B 3P4OB 4OGAD 1N64H 3DX8B 1A3LH 5SX4H 1PX4A 2FL5B 4FN0A 5L88H 1CLOH 1HDMA 1HOCB 2F15A 4O4YH 3AS2A 5HGAA 1ND0A 3ZKMC 4HQQL 4PJGB 2HWZH 3QUYA 1HWGB 3VG9B 2Y5TA 4Y5VB 3K8LA 2JB6A 1IEAB 1NAMH 1U2CA 3KXFD 2RAMA 3MRMA 3AROA 1OGAB 2XA8H 1QQDA 5AAMA 3ARBD 3GMMA 5CILL 2HFFA 4GJTB 3I3DA 3VFMB 4EI5B 4GT7A 2YSSA 3C09C 3RL1B 1NSNH 5HHXL 1NEZB 5L0QB 4HCRH 4H26B 1QLFA 1FNFA 4FQHB 4KHTH 1DBBH 4LCCB 3BP6A 3HC3H 5EOCJ 2IEPA 4R8WL 5TPWH 3IETA 4K23L 5D8JH 3MV11 3HNTH 1A2YA 1IMHC 2DQHL 4ZUSB 1S5HB 2ZUWA 1FNLA 4PJHF 1YA5A 4JM2C 4LNRA 1H8SA 4WUUB 5E9DD 2VQTA 2D9CA 3HPLB 2MSPA 3KGRA 3KPRB 5C3TA 4OQTH 3SGDH 5D2LE 3O6FA 3MSPA 4UDUA 4NGHH 1N7ML 1NEZG 3MLWL 1AO7A 4UMGA 1J1XH 3TESA 4JFOB 5E2WL 5L6YL 5IOPA 5B39B 4L9LB 5JPNB 12E8L 1KIPB 1XAUA 1XF5B 1BIIB 3DV4B 4IDJH 4UT7L 3CVIH 4YE4L 5C09A 5HBBA 3WXVL 4U7KA 4OB5H 4QOKD 2AK1H 3GBML 5C0IB 1QSFB 4DW2L 1S9XB 3AC0A 1CE1H 3WS6C 1F90H 4QHKI 5ID1A 1RUQH 1KCSL 4PGCB 4C4KT 1MWAB 3L3GA 3OF6D 3SPVB 2EC9U 2YPKB 4HUUA 4YUEL 1J8HE 2Z31D 5D1QD 3SKNA 3MJ7B 2VDRL 3O81A 4U1KA 4K7PL 1XIWA 3DURA 3QUMH 3GMLB 5DQJA 4OZIA 2H2SC 1NGYB 3WNKA 5J89A 1RZGA 4DKEL 1H3WM 3D3VD 3EJJX 4OCWH 5EA0L 4QHMA 5I74C 5FKPB 1LDPL 2GJ6E 4XPAL 4PG2A 3SGEH 1INQB 3WN5B 5E4EB 2WWKT 3B2UC 1W0YT 4MAUL 3GSXA 2CDGA 4BM7A 3QEQE 4MDIA 3LSOB 2C3GA 4G9FE 1KTDA 4PLKC 1DQLL 5TF1L 5M95B 3AGVA 4G42A 4X99A 1CDGA 4P2RE 3O3BA 4QGYA 1JIBA 3O9WD 2E9BA 3IRPX 4H8WH 5DJXA 1JZ2A 1KFAH 1CFQB 2BRRL 3NABH 3B5GA 3KPNB 1I9RL 1RZ8B 4KMLB 4FQJL 3TPKA 3CDFA 1V5JA 3DX6B 5FA4B 3D39A 1UB5A 4ZXBD 1HIMH 2CKNA 1P4IH 3BD4A 1A7NH 3CPLB 4RGMB 5CJQL 2ZCLH 4FZEL 5I1GL 4I3GA 1IQDA 2X4UB 1UWEH 2J5LB 5DMIH 4OJFL 3MJ9L 4KPHH 5JA8B 1T4KA 1F45A 2AK4A 3DVGA 4R4BB 1KEMH 1UXWB 3WNOA 1IGMH 5HHOB 3S5LB 9CGTA 1UZ6E 2NX5B 1QSVA 1OAKH 4EQ2A 1A47A 3U83A 3IDIA 5KVFH 4S0TD 4G6FD 2DS4A 3V4VL 4K55A 3AAZB 2BOCA 4JZJA 3E6FA 3GRWH 1T1YB 4OBSA 5DJCA 4A2MA 3RTQD 5IF0B 1JHLH 2OX5A 3L3DB 2FATL 4M6MH 5HHNB 2FJGB 3ARED 3C8HA 3UYRL 3NGBC 3OQ3B 2QQNL 2XIDA 2P49B 5BMFL 3NFPB 3CK0L 1OY3B 5B8CB 3S5LG 3MYJA 4P4KC 4J2XA 3RWJB 4HWNA 1I8MB 3CMOH 3HMWH 2XPGA 5HY9A 2VXQL 4OZ4A 4GBXC 2VDOL 1AHWB 2IFFH 4FFWC 1PY4A 5DFWH 1D5ZB 3DSNA 3KXFE 3ARFC 2R1YA 3QH3B 4MQ7A 1KC5L 5SWZB 1RK0A 3GMPA 35C8L 2XWJA 4KK5D 4YWGL 5JQ6H 3T77B 1CFBA 4M7JL 5I1EH 1LD9B 3S88L 3LD8C 4NRZB 3FO1B 4ORGB 5E03A 4R96B 4O2CB 4CW1A 3L9RB 2D7QA 4OZGA 2CO7B 4OFVA 5B3JE 3INUH 3P4MB 1FYTD 1VFAA 4PTUA 3P0YH 3WBDA 5F7LB 3OB0H 3WJLC 2YD5A 3FTGB 4N0UB 4LAQL 5C0DA 3KYKL 4U1LB 3OXRA 5E9DE 4KJWC 2C3VB 3B8SA 3GMQB 4TSCH 4BQBA 5GSRA 5JXEA 4WW2F 4K3DH 1N3NB 2FHCA 5EFIB 5JIPA 4HC1L 4C4KO 1MUJB 2EDEA 5CZXD 1AGCA 3CSBA 3OKKB 1ODAA 5E8DL 5D2LF 2HVJB 2YWYA 2VXUH 5E1AB 2V2WA 4BSWA 3T4AB 1RZ7H 1AGEB 3EOTH 4K9EH 3WE6B 2CLZA 4QOKE 2W0FA 3A6CL 1WSST 1FH5L 4ODSH 4NNXA 1N2RA 2AJSL 1INEH 1KCRL 3CJJA 1I1AA 1KJMB 2EDBA 4M1DH 3ZTNH 3GSOB 1NCDL 4M7KL 2VWEC 2WWKO 3TYFB 4OZFA 3PGDA 1FAKT 2W0PA 1WF5A 2YUWA 3KDMB 4KY1H 4DQOL 3V6FB 3MV7A 3RIAK 1G7IA 2G9HA 1ZLWK 1OAZH 1AP2A 1I3GH 1T0NB 3V95A 4HXAL 3D3VE 2R2HB 3OHXB 3MCLH 4LRNH 4KKLC 3BP7A 4XCCH 5CWSB 4HUVB 4PJXE 2VH5H 1SJEA 4LSTH 1JWUA 2CDEB 1RJYB 4G9DB 5C0AA 4J3UA 1FCGA 4L8BB 4ODVH 4ZO7A 3VXMD 4YHPB 2FL5A 4WWKA 3VGGA 3RUGB 3OBAA 5CJXA 4ODHL 2X4OB 1PG7X 1Q9OB 5T1DH 3ARRA 3S9DB 3I3BA 2APXA 4JQIH 2XKSA 4JO1L 3IFPB 3JTTB 4PP1D 2J3SA 5IB2B 4K7PY 4HSQA 1F2XK 2X4QB 4P9HH 4WU5A 3FN3A 1T5XB 5FM5O 3PHSA 1S78D 3L3OB 4QY8A 1AGDB 3LQAH 1IT9L 4P2QA 4IMLB 4L8DA 4XPFH 4OLVH 2OSLB 2YUVA 4NZRL 2YN5A 3STLB 5KBNC 5CEXA 3LQMA 5FYJL 1Y6NR 3I75A 4Y4FC 4NOFA 4HIIA 4PJ5B 1A0QL 5IJVB 2DDQH 3QEUB 1S8DA 4ZUSA 1A6UH 1S5HA 2OTWA 5IMOA 3MNWB 2VDQH 4Y4HC 2DQFB 1OAQH 3LV3B 1EHLL 4KKAC 2E6QA 3X12A 4BZ1L 1F97A 5J12C 4ZD3H 3HPLA 4RWYH 2GSIB 2Q1EA 3UJTL 5CJOL 4XC1L 4F7EA 3TA3B 1UWXK 3VD3A 2ZUQB 1T89C 3W0WE 1TPXB 2X4RB 4JN1H 2P8MB 4XMPL 2A77H 5DT1H 4I3SH 4X9IA 1MVUA 1U3ZA 3MO1B 1I8IB 4LGSB 5B39A 3GEWB 5MP6H 2NXYC 2BFVL 5F8QC 3C5SA 5ISZB 2VLRD 4DCQA 4M6OL 3ARDC 2WBWB 1ZTXH 4FFWD 4LCUB 4RBPH 3KPSB 4BH8B 2L7JA 3MROB 1ZVYA 4HFUH 3C87A 5C0ND 1KXTB 2UZIL 2VITB 4K9EC 1ZAGA 2D7MA 5C9KA 4LVOB 1YMMA 5EWIH 4C56B 4NM4H 5K9QG 1U8NB 1KLUB 1FL3B 4PJIB 1A4KB 2GEEA 4KJQC 1I7TB 5I6XC 4QXWA 3BEVB 1NC2D 5DI8B 2QSQA 1PKOA 1K8IB 1IE5A 1R5VA 2AI0L 3ZE2F 4OI7A 1XGTB 4QWWD 4U0QB 4DKAA 4PR5B 1II4E 1U93B 1J10A 3EYQC 3L3IB 4P5TC 4JFEB 2OK0H 5GS1C 3UPRB 1Z5LA 3QNZB 5JW4R 5J6GB 4PD4J 4G7YH 1FYTE 1JK8B 3GI9H 3FO2A 4NQDB 1P5VA 4KAQL 1DBAL 4FFZH 4PJ9D 1AGBB 2VABB 1U8IB 2GTWA 2Q3AA 2ARJB 5IV2A 1MJ7H 4UUJA 5FYKU 4P9HC 1S3KL 4HWEH 4ODBD 1Z0NA 1XT5A 2DWEA 2XQBH 1BIHA 1D6EA 4RA0C 4OI9A 2FB4L 2C9AA 3LQAC 1OM3L 3LKOB 1DUZA 2J4WH 4HKJA 1RULL 1JPFB 4P23D 2E7HA 1JHKL 1KTLB 3HLAA 4NN6B 5MERB 3TFKC 3VA6A 4CKVX 1RAMA 3ALPA 4PREB 5E99L 4XHJD 1SY6L 3JWOL 3CUPA 3P9MB 4TTDD 2RHEA 2XRAL 4TVPD 4HS6B 5F96L 1W8NA 1MHPL 2NX5A 3LN4B 3NFNA 3IRZA 3MR9B 4KKLD 1CT8B 2EE6A 4Q74A 4HKBB 1OP9A 3O4OB 4NFCA 4M6AA 6CGTA 1DZBA 3RWHA 2EE2A 2DIAA 1MREL 1PLGL 3MUHL 4WGVB 4YHML 1D9KC 1A4JA 1AGFA 3LN5B 4XP5L 4HKZB 2GT9B 3WL9A 3QWRA 4FQCL 4AEIL 4U6YA 4UTAL 1NMCB 1B0GA 4ODWA 3RWDB 4Y2DC 4WU7A 5B8CA 1M7IA 1YN6B 3PABB 5CSZB 3NCJL 5EDXA 5KN5B 4PJXF 2CKBL 2CRIA 1NCCH 1Q72L 4I1NB 3RGVB 1AHWA 1UA6L 3CLEL 3QJFA 1D5ZA 3Q6FA 1T20B 4HJGA 1V3MA 4GUPA 3AFLA 3BKCH 1FNEB 3S37H 2A9NL 4GXVL 1CICA 3BQUC 3JTSB 2DLEA 4LLYA 4ZAKA 4Q9RH 4ZUUB 4J3WA 1J86A 5JW5A 3OKYA 4Y4HD 3C5ZB 2DQCH 4PJBB 2E6PA 4WFGD 3B9DA 2BC4B 4NZDA 1JWMB 4N8CL 1H3VA 1KB5B 1I7RB 3CZFB 3UCRA 1NAKH 4HGWB 2XFXA 5F7FA 3FTGA 4N0UA 4U1LA 3U48A 1ZHBA 2DQDL 1MCRA 3AY4C 5D5MB 4X7FC 1VCAA 3TT3L 1OT2A 5EC2A 3VDAA 1I1FA 1AI1H 5IUSA 3ARDD 1FNGA 1T03L 3PDDA 3VW3H 4WV1B 4DTGL 2B4CH 3SCMB 3VFPB 3VFUA 2NZ9D 4H1LA 4YIQB 3P0VL 2ICCA 4F7CA 4NUGL 4L3CB 4HUWB 4XWOD 5DRNB 3O2DH 3VGFA 1F6LL 1T1XA 4LHJB 4HK0B 4AJ0A 3HNSH 2VLRE 3TJHC 4JREB 5F3HA 1KTRL 4NUJA 5BCAA 4R4FL 4L5FH 1QFWL 5IT2H 1O5DT 5EOQL 4MMZC 5FA3B 1RZJL 2JELH 4GRMB 2VDMH 1RIUL 2F54A 4UNVA 3P4LA 1IFHL 4NKDA 1MFAH 3BW9A 3V6FA 4D0CB 2FIKA 3ARTA 4NQXB 4DGVH 4XAWH 3IKCB 2R2HA 4GKNB 2DMBA 3OHXA 1I1CA 4MXWH 1W72B 1CU4H 1RJYA 5H94A 1CGVA 4G9DA 5M94B 1OPGL 3MXVH 1K8DB 3LKSB 4G5ZL 2DQEL 3F7YA 3LKRB 2AJYL 3LAFA 3SGKA 1U58B 3U1SL 2X4OA 2DL9A 4JFYA 1FC1A 1WWWX 2R2BB 3O3DA 4WW1B 5DHVH 4PRHD 1Z3GH 5I8KH 3IFPA 1U0QA 1FDLH 1A02N 5L8KB 3ULUH 3OKNA 3EYOA 3SJVB 4YHYC 1CTNA 2QBWA 2ZG1A 1PSKH 2EEDA 2HKFH 4X6EA 3NBNA 1ZWIB 2IJ0C 2AQ3A 3V7MA 5TE4H 2A38A 4FQ2L 5IIEB 1I4FA 5F97E 5T1KA 3BZFA 2NLJB 5ESAA 1T66D 2KH2B 4JKWA 5IJVA 2Z93B 5MI0C 4XCNB 3VE0B 1S7SB 1CLZL 1KB9J 2BSED 2VWEE 3PWLB 5C0RH 3BSZL 4JFDA 2H32A 3P77A 2XKNA 2CXKA 4CN1A 1J05A 2PW2B 1NCWH 2OTPA 4TVPE 1I8KA 1JTTA 4XP4L 2Y06L 3ORJA 3TA3A 4OBRA 3U7YL 1EAJA 4G6JH 1A6ZA 1MHCA 2N7AA 3TH4T 5C70A 3VRLE 4Y2DD 2YPLB 1ORQA 2B8OT 3EO9L 3IDNB 5F3BB 3MODH 2R2EB 3WIIL 4YXLL 3JSSA 1YYLH 5D2NC 5ISZA 3MBXL 1JN6A 4PS4H 1NJ9A 5EB9A 1A1NB 1IAIH 3P9LB 5LBSH 3ZYZA 4ZUWA 2R0ZL 1BVKA 5AZEL 3MNVA 5HVHC 1CGSH 1RIVL 3ARXA 3GHBH 4OCSL 2PCPA 2ICWJ 4C54A 2NZIA 4LLAA 4I77H 4E41B 4PJIA 1EHXA 4PJHB 4RDQF 4LSVL 1JP5A 4XNZB 3BEVA 3R06A 3JZ7A 2HA1A 4AEHH 3RFZC 4ZDHA 3QCVH 5F7DB 5EU7C 3G08A 3RX8A 3T0EC 3S4SB 2I25N 4PJ7F 4Y5XB 1JGEA 4WI3A 1GAFL 1S7VA 4RZCB 4CVXA 3OKOA 5LG1A 2AJUL 4OCNC 2FBJH 3EFDL 1G9MH 1BZ9B 4AG4H 1JUFA 1OTTD 4WFGE 1A6TB 1FVCB 5ALBL 1TJHH 3OPZL 5GJTL 4TUJA 2LV4A 1ZHLA 4H20H 2BMKB 3BPLB 5J6HB 2F58L 4F7PA 5HYSB 4LBEB 2V17H 3O3AA 1D5MA 4YQXH 3MRFB 7FABL 1A6PA 2C1PA 4PRAB 1UT9A 2ARJA 3V6OC 1FLRL 3FQTB 4RFNB 3UC0L 3OMZA 5CUSL 3S4SG 1PZ5B 4U1NA 3EOBB 3GJEA 3M8OH 5F1SA 3SQOL 3D9AL 3MGOB 3O8XD 4L3EA 3DRQA 1JRHI 1QR1B 1D6VL 4O58H 4X9BA 2W65B 5FHAL 2BX5A 5MEPB 3Q1SH 5EBWB 3KPQB 3DUHA 5F6IB 1KTLA 1HHGA 3HS0A 5D7JC 4IEFB 4K3EL 3V5DB 3T08A 5HYSG 3P9MA 3SDDA 5GISL 4U1SA 1H3TA 3VMOA 3IU3B 4WJ5A 4NP4H 3LS5H 1QSZA 2Z4QB 4XGZA 2JJSA 1HYRC 2IG2L 4HBCH 2Y7QB 5JHDB 5IQ7L 1XGQB 5DDHA 1ZT4A 1S5IH 4U31A 5BO1H 1MI5B 1YC7A 3JV0A 3G6AA 3WUWA 4DK6A 2OCFD 2JTDA 2RIKA 4Y0GA 4NO0A 2ICWB 4NNYA 1LO3L 4G80B 2DLTA 3RWDA 3BH9A 2EDKA 3K7UA 4RA3A 3TN0D 3WV0A 5JW3L 1MNUH 4X7EC 1LK2B 5KN5A 3MRGB 3GMRB 3OAUL 4XVJL 2GFBB 3D85B 5SWSA 2MWCA 3QUXA 1QO3B 3MV9D 2XTLA 3B9AA 3TVMB 4PRHE 4JG1L 4J8RA 1YEJL 1PY9A 2MKWA 3FOLB 4G6ML 1EEYA 2WAHA 3JTSA 2A6JB 1I7ZB 5HHPB 1I1YA 3CFDB 3PNWB 4M5YL 4F9LA 1W8OA 3ZYJA 3VDBA 2CK2A 1KOAA 1OCWH 4L29B 2V5YA 3C5JB 1F00I 3MXWH 2GY5A 4EIGB 3GSNL 4LPCA 4F57H 1J11A 2E9JA 2CLRB 3FQXA 1T0MA 4WHDA 3KYNB 1G9MC 4HGWA 1FN4B 4OUUB 1Z9LA 3U4BL 2X5PA 2NPLX 5E2TL 1C08B 3IDYC 3QPXH 5D5MA 3LEYL 1F6FB 1HHJB 3ESUF 2D03H 3PJSB 5C8JB 4APQD 3HI1A 2O5ZL 4FTVD 2Z92B 1LWRA 2ORBL 1I7UA 3WEXB 4UDTA 4XBGB 2F5AH 3NZ8B 1G1CA 1MY7A 4P2OA 4JY4A 1F11A<