3MLYL

Crystal structure of anti-hiv-1 v3 fab 3074 in complex with a ur29 v3 peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNMVSWYQQHPGTAPKLLIYENSKRPSGIPDRFSGSRSGTSATLGIIGLQTGDEAEYYCATWDGSLRTVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVRAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab light
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
total genus 45
structure length 214
sequence length 214
chains with identical sequence M
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlyL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mlyL01
1T0MA 1HNFA 1FRGL 4RZCA 2DM4A 3U36B 4OSUH 1ZHLA 2JCCA 3W11C 3HE6C 3LKOB 3WUZA 3O6LH 1ZHBA 1F2XK 4HG4K 2XY1A 2IPKB 2XN9A 4JRXE 1NEZA 1YEIL 3TM6A 3MXWL 1WFOA 1D5XA 1GRWA 5C92A 3PWUB 1L7IL 1DE4A 5EBMA 4RNRB 1MRCL 2EDDA 1EHNA 5C0NC 4G42A 2W60B 3TGXA 4W6YB 4LIQL 1KJMA 4ZUWA 4LCIH 3TCLA 2OTUA 3H9SD 4X6BB 4MDJA 3WFBL 4KQ4L 3JUYA 3ES6B 1UM6L 2BNQA 5JHDB 5EU3A 1NAMH 2X4RB 4PJ9A 1Z5LA 1G9NH 4IIQB 4QOKA 1HCFX 1GHFH 5DJ6B 1RJCA 4PV9A 4X5WB 2X5PA 3ARGC 2BY1A 3V79C 5EO0B 3KLAB 3IFOB 3DRQB 3IYLW 3I84A 1CQKA 1ZLSL 5DLMH 4JFQB 2E27H 1KV3A 2WMPA 1GZPA 3T4YA 4KK6D 3MRDB 3MO1A 1XGRB 5GISH 2GJ6A 3O9WC 5CP7B 1BLNA 4IRSB 4A6YL 1KC5L 5L9DH 2C3HA 4K3EH 3EOYG 5I9QC 4XNYH 2EYTB 4NO0D 3VCLA 2AEPL 2FB4H 3SY0A 1PG7H 4PBXA 3GEWB 2R4SL 3MRPB 3VXQA 4EBQL 4JM4H 1BREA 4IJ3C 1H0DB 1KB5B 1ZANH 4JFFA 2APBA 4LLDB 5C6PB 4KK9C 4V1DD 1N8ZB 3LPWA 4HUXB 1XCQA 2QQLH 1ZSDB 2LTQC 3H9HA 4RGNE 2OX5A 2BSTA 1MRDH 1FAKT 1FFPA 4F15B 3M17B 4JJ5B 1T21B 2NPLX 3MJ9H 5F6HJ 2GSIB 1DCLA 2WWKT 3LQAL 4R4ND 2C26A 2VO5A 1OQXA 5L7XL 2W65B 4JZOA 3QZWG 5ACLA 5EB9A 3EOTL 4JFPA 3C9NB 1JGDB 2NY4B 5KZCD 4P57B 5EZLA 2X4TA 1VFOA 3GHEH 1F4YH 5I2IA 4KI5C 5KN5A 3BRDA 5MEQB 3FQXB 1B0GA 3NCJL 5C08B 2J5LC 3VRJB 2V17L 5HTSA 1BEYL 1T1WB 2B4CL 3V5HA 4BFGA 2F5AL 2ZUYA 2B1AH 4GRWF 5JXED 2YD4A 3DX9B 5HHQB 9CGTA 1F3DH 1E6OH 1ZGLB 1R5IA 3MRHA 1YN7B 4FQPA 4PP1C 1UZ6F 4UZGA 2J6EH 5I0ZA 1U93A 3QR2A 1QSFB 5DC9B 5KOVC 5ICYA 4HZAA 4LSQH 2XFXB 3D2UB 3MRBA 4L4VA 1KLUB 1UWXK 5MHSD 3RWCB 1HINL 3S4SB 4HKJA 3G5YA 1HHKA 1J05A 2NZIA 4YHKL 1JWSA 3EDEA 1M7IB 3KPPA 1PYWA 1K8DA 1BIIA 3OJMB 3RUGF 2X1WL 1W8OA 2VUYA 3NH7L 4FQIL 3R8BB 3MCKB 4PJEB 5E8EB 1R3KA 2H6PB 4FP8H 4U2ZA 3UP1A 4L3CB 5EZOH 4LLMB 5ALBL 3NCFB 3BJ91 4MD0B 4UT6L 4I2XB 1ZA3B 5J13C 2OJZL 3HUJE 5JPNA 1AQKH 1QBMH 4HGWA 4HCRA 4PY7B 4Y2DC 2F74A 2A1WH 3WNNA 1YEDB 2HT3C 5HHOB 5CCKH 1AQDB 1A7QH 4GBXD 2A6KB 1LK3L 4GG6A 4G3YL 4M6ML 4Y0GA 3O2DA 1XF4B 2J8OA 1P84K 4Z5RA 1BZQK 2F19H 4L8BA 2HRLA 4DVRH 2E7LC 2PCPB 5EU6A 4YNYA 1U3HA 4DGYL 3LN4B 5DVOA 3JWDL 5DR5H 3OSKA 5LVEA 3H7BA 4FN0A 4MJ6B 3OB0H 3BHBA 3VRIB 3MYJA 2H26B 4QRTB 1BQHB 2UZYB 1N3NB 5C6TH 4ZO8A 1TJGH 2CLVB 4PLOB 1UM4H 3KJ6L 1FIGL 3BWAB 1VPOH 1HHJB 4PY8J 4LDLB 1L0QA 4U49A 5EU5B 4C57C 3QIWA 4XNXH 5T5NF 5EN2B 1NMAH 1RMFH 4IRJB 1W0VA 1OHQA 3IFPA 5J6GA 1FBIH 3C6SA 4ODWA 1ETZB 3PJSA 5I15L 3FQWA 2P44B 3DMMD 3HN3A 3VDCA 5IHUH 5CEXB 1LD9A 5HDLA 3RX5A 3SBWC 1HE7A 5DVLA 4DN3L 1T0NA 3UO1L 1KACB 3L3DA 4XPBH 2AW2A 3G9VA 4WW2B 2VRAA 4Q9RH 4FFVD 2CUHA 4JKPL 2ZP0T 1J0KA 4JFEE 3HRZA 5TDNA 3WFEH 1MUJA 5LG1A 2J8UF 2R9HD 1U8KB 5ACMA 1K5NB 1OM3L 4M1GL 4KHTH 4D2NA 3MXVL 2YZ8A 1DBML 4ZFGL 4YAQB 3DURA 3G5XA 4KRPC 2FIKB 3DYMA 1CD8A 5HYSA 3LQZB 2FWOA 2QADD 4N0CC 4NM4L 5INDA 4BK5A 4CW1A 5J9PB 2XPGA 4HFWB 4Z76B 5I8KH 1DQQB 1XR8A 1ED3B 4I18B 4GUPA 1X4ZA 3CVHL 2P49B 3T4AA 1MJ8L 4UB0H 4XP6L 3IXAA 2DYPA 4HW6A 4Q6IA 4PRNA 3IF1B 3C5ZD 1FDLL 5E8NB 2VLRE 3CFCH 4NNPL 3BYTA 1TENA 3GBLA 2KUTA 4GSDH 5HHNB 5KANG 1ES0B 2XQBH 4JO1H 4OZFG 1A6PA 1EHXA 1UZ6E 3O6KL 4DKEH 3T2QA 3QCTL 3V4PH 3GIVB 1JPTH 4ZXBA 1RZKC 3GI9H 3MJ6A 1BZ7B 2FZ3B 1N26A 3EUUA 3SCMB 1VFMA 4GXVH 5KSAA 3DBXA 2AP2A 1AY1H 3ULSA 1DBBL 1RHFA 5AG9A 2EZ0D 1NSNL 4FXGB 3DYOA 2J2ZA 2CLRA 1EHAA 1WCQA 4X9FA 3UYRH 3MNZA 1NCCL 1A1OB 1I7TA 3WO4C 5K59E 1U95A 3L5JA 2XN9D 1NFKA 1KJ3L 1A3RL 3G6JE 4Y4HB 3FRPG 1PX3A 3A0OA 3KPSA 1HHIA 1OAXH 2DF3A 3MLVH 4OZFH 1C1EL 1OWRM 2V7HB 3UEZA 4GKSA 1HZHL 5JR1L 3GMOB 2VQTA 5DK2B 5IROA 1GPOH 4W4OC 4UDUA 1H3XA 4BKLB 2ZPKL 4Y8AA 4UQ3B 1MQ8A 1I3RB 4KH2A 2BVPB 4TSCH 4YHOL 5IW1B 4XXCA 3DUSA 2E7BA 4NN5C 3LZFH 5IBLD 3BPNC 3EHBC 3IJSB 4JPWH 1KG0A 2WK2A 3MJ8B 4XP4L 4NGHH 5HI3C 1T83C 3CXHK 5CWSB 4NZUL 3NCYP 2BNQD 3BZDA 4PJ9D 1TQCC 5LKNA 4QOKD 1OPGL 4KGJA 3DWTA 2E5EA 4UDTB 3ROLB 4I8DA 5JO5B 3K46A 1ORSA 2G75A 4Z77A 4FQXB 3QPXH 3EOBA 3LOWA 1KNOA 3RHWF 2W9DL 3MREB 1MFCH 4ONFH 3VW3L 4K3GA 4JFOA 4G7YL 4PJ8A 4JRYB 4JEGB 4IRZH 2GJ6D 2VWEC 5DJYB 4QRRA 4JGMA 2OTWB 5AEAA 1U8HB 4CU7A 2EDLA 5HHME 2RQ8A 4OTXH 4M62H 3RL1B 4UT9L 4NSKB 4R7DB 4KKNA 3KG5A 4P59H 5A2FA 4KI1A 5IB1B 3Q5YA 5TFSH 1MCIA 5CINH 3B9EA 3OHXA 5HHXL 2I25N 2X9YA 2JB6A 3KDMA 4HS3A 2DQUH 3VXNB 4JFFD 5SX5K 3MV8E 5TDOA 4G80B 5I73C 3P4MB 3NFNB 1EHLL 3VXRB 5KSVA 4LCWA 4D9LH 1JRHH 2NYYC 5KSUB 3F62A 3S35H 1DJSA 4XP5L 3KPLB 3DUHA 4XNUH 4LF3A 1ZA6A 4HWUA 5IVOA 1P9MA 3DO3A 3CFDA 4N8VA 1U91A 5IM7A 1D9KB 5DDHA 1EGJH 2QHRH 1YEGL 4XMLH 3SDCB 4M7LL 4QY8B 4TTDD 3SGKC 1FYHB 3JV4A 4R4FH 3MOQA 4HKZB 5AG8A 4OD2A 1Q1JL 3A67H 1CGXA 5JNYA 1CXFA 1W0WA 3LV3A 2FHCA 4J3SA 4NOBA 2NY3B 5D93C 5D2LB 1Z0MA 2IEPA 5I76B 43C9A 1JZ4A 3HB3C 3BGMA 1MFEH 4WEBH 3QI9B 5E2UH 4OB5H 3O9WB 4FXLA 1GAFL 3JWOL 7FABL 2JJWA 3ILQC 3K7UA 4M48H 1DVFC 5I9QB 5E9DB 4F37F 5I1AA 2EDKA 4HAGA 1OTSC 2Y9RT 3N1MC 4HBQA 4DWHA 1EJOH 2P48B 2WLYA 2X4SB 3OZ9L 1BPVA 3FQRA 1CE1L 1JZ2A 5DK0B 1RUPH 2FGWH 3GI8H 4N90D 4IJ3B 4ZDHB 2G5BA 4S0TD 3BVNB 3ULVL 5M95B 4KKBD 1DSFH 4OZHA 4WJ5A 4ODXB 3UJTL 1WJ3A 4F8QA 3PIQA 4L4VD 4XVSH 4PJEF 3QG6A 2EO1A 2YD5A 4ZNEE 5E2JA 3GSRB 1TPXC 3EYOB 3H42L 2ID5A 3I9GL 1NC2A 2AERT 2IQ9L 2EDWA 3LKRB 3PV6B 2EIZB 3VFPB 4UTBH 1JN6A 2XYCA 1T89A 3MRGA 4TSBH 4AENA 1CDCA 4L4JA 2BSSB 5JHDE 3DLQR 5GRVL 2NLJB 4GKZB 3UTSB 5BW7C 3MCLL 5EOTA 3K8LA 5DYOB 3H3PL 4XP1H 3BPOB 1G7MB 4GKNB 4Y19B 3QISA 1KBGH 1LO5A 3MLWL 1WLHA 2HVJA 1JGUL 1MI5A 3B43A 4OCYH 4B53A 2BVEA 2FEDC 1BJ1J 3SE9L 2W91A 4CMHB 1L9NA 5DJZB 5DMKB 1JYWA 1SJXA 3HTLX 1DDHB 3WHE1 1YJDL 3BYYA 1WT5C 5FKPA 4Y16A 5DHVH 1I85C 1VERA 4XPFH 2HKHL 3VGGA 2C7UA 5EU6D 3C6LA 2ZCHH 3DX6A 4PJXA 4ZTOH 4Z7NE 1IBGH 1U3HD 4Q9CA 2HFGL 1Q72H 3QIUB 5E99H 4NT6A 4MNHA 3RNQB 5CJOL 4NUGL 1G6RB 3QIBC 1IT9H 2BOCA 4KXZI 4ORGB 5L6YL 1ZLWH 4JDTH 3ULVD 1X5GA 4E5XB 1FLRL 1NPUA 3B6SA 4YBQD 4IOSD 3TP4A 3UYOD 1RZ8A 1A7BA 5JHLH 2A0LC 3FOMB 3ZL4H 5HGGS 3NZ8B 3UPAA 1HH6A 4APQC 4QYOB 3QIWD 3WNOA 4R4BB 3HPLA 4UAOB 1D6EB 4WW2F 5D1ZB 2SEBB 4MA3B 1C5CL 4XBEH 4HIIB 1PLGL 4KZEH 4AG4L 3PWPA 1N6VA 5I1HH 5J13B 2QSCL 4UU9A 1ZHNB 2IANE 3BGAA 1JGVL 1OAZL 2VDMH 4TOYL 4OV5A 4OZGE 5JOEA 5CD3B 1OARL 1CE6A 2GCYA 1QVOB 5I18L 4JHWL 4YDJB 5JPMA 1VEMA 2N7AA 3MGOB 5DZOA 5F7YC 3ZT5A 5IB3B 1MQKH 4MA7H 2BNUB 3OG4B 5DXWA 5C08E 2X7LA 3QCVH 3U7YH 2P4AB 2BVUA 3STLA 1YMMA 4F9PA 3QULB 2X70A 3VFTB 3V6ZB 3N50A 4Y5XC 2H32B 1BQLL 1UCBH 4JCMA 1I8KA 3KPRE 2AK4E 4KUCF 3C60B 1KTLB 4HPYL 3NAAL 2HN7B 4G9DB 2NY0C 2IPKA 1QRKA 5IP4A 2DYPD 5EO9A 4P5KB 3U1SH 1YNLL 1E27B 4POZD 4E0RB 1IKFH 4H8WC 4POUB 2A6IB 3IXTA 2GSGB 1Z9OA 4R90H 4OKVB 4EVNA 2K3TA 1M6OB 1P2CB 4ZXBD 5BS0A 4LOUC 1I9JL 4KFZC 5F7HA 3FB7A 1F5WA 2XTLA 1G0XA 1YMHB 5KSAD 4QT5B 3MLSL 2H9GB 4OZIE 3WE6B 2AGJL 4X6BA 2DQGL 3R06B 3ES6A 2ORBL 1G9MC 1NGPH 4BZ1L 2X4RA 2NQCA 1XF2A 4U1SB 4I2XE 1TZIB 1A7RH 1FO0B 3VXTA 4LCCA 3D39E 3GMRB 5D7JB 3KPSD 1UKSA 3IFOA 3DRQA 2ITCB 3DVFA 3VXUB 3FB6B 3WFDH 5IBUB 3K2MC 4LAJH 3D25A 4JFQA 3GKWH 3VG9C 2M8XA 4JZJC 1CTNA 3MRDA 4M6OL 5IGXL 4XPHH 3CLFL 3SGDH 1XGRA 1OWWA 5F7DB 1U8QB 1P4BH 4QWWC 2PTTB 4IRSA 1S7VB 2WUBH 1T3FA 4KVCH 5FYLH 3VMPA 4M8QB 2OYPA 4FG6C 5MERA 2UY7A 3WV0A 4UV7L 4U0RC 1I1RA 3P0VL 1IQDB 3JVGA 1WCBA 3K4AA 1ZVSB 2KBGA 3MRPA 4YC2B 3HZVA 2V2TB 4RCAA 5J1TC 5DFVD 3LKPA 5JUEL 2AJ3A 1SHMA 1ZSDA 3WDJA 2IQAB 4KAQH 4EI5C 2A74B 5ISZE 1SBSL 4JJ5A 2YUVA 3CX2A 3VI3E 3FMGH 3X12A 2DWDB 2GSIA 2PTVA 3BKMH 4QNPE 4PJ8D 3QO1B 3SGEH 3TJEL 2VLLA 4LLYB 4PB9L 2P7TB 1DQDL 5IFAL 5DUMH 2WBKA 2P47B 2VITA 4M4PA 3SDXB 3C9NA 1JGDA 2MKWA 3C8DA 5A40E 4X6CF 2A6DA 4EZMA 1FHGA 5TQ2L 2VDRH 3LB6D 3QUXC 5L8JB 3T0EA 3CD4A 3HKFA 4ZUTB 3V4VH 3JV6A 1HQRB 4HPOL 5DTFB 4FFWD 5FECA 4RMQA 1NCAL 2NY1D 3QDJB 2EE6A 4F7MB 5MEQA 4LCWD 3ZSSA 3BP6A 2R8SL 1NANI 3OR6A 3HRPA 1UCTA 3ZYJA 2CUMA 3I2CH 4EJ1C 1A0QH 5FUCE 1N0XL 4U1GB 2FATH 4JQXC 3FT4A 3S3SA 1OGAE 3T0VA 1BAFH 1NUGA 4JJHA 5JIHA 3BPNB 1CL7H 4LGSB 3WEXB 1ZV5A 4LQ1A 3UBXI 4F7EA 1VGKA 1G7JA 3O6FC 3CU7A 2GITB 1WZ1L 4LDEB 1UKQA 1YN7A 5D2LF 5ALCL 1ORQB 4G5ZH 1MLBB 1BM3H 4X6DA 3TH3T 1JZ6A 4CDHA 2Y6SD 4HXBH 3NACL 4WFEE 2HT2D 4M5ZH 1JL8A 2BRQA 4P46B 3BH8A 3GUTA 1C12A 3AM8C 4YGAB 3LPFA 5IVXF 3U9PH 3NIFF 4FTVA 4LU5L 2NZ9D 3RWCA 3S4SA 2IH1B 5BV7L 1SMAA 2L4OA 3CFIC 4KVNL 3L1OH 5TE7L 1V7MH 3GMQB 2HJFA 4YE4L 2CKBL 4RWHA 5FYLE 4I3RL 1HYRC 3MCKA 1MCEA 3CDFA 1LDSA 4KU1A 5EIIB 2CO6B 4NCC1 4OCRH 4L3CA 1T66D 5AYQA 4LLMA 1MJJB 5D9SA 4EDWH 3S36L 1LP9B 1S7XA 5C0EA 3JWNC 2CIIB 1AP2B 4RISH 3RY6A 3TT3L 4ONHB 5HI5D 3EO0A 4HKBB 2WBWB 3E8UH 4HT1L 3SKNA 5CBAB 3D0LA 1YPZA 1UB6B 5HHOA 4XVTH 1DN2A 3S37L 3Q0HA 5IFHL 4L3EE 3CFEA 3MA7A 1EVTC 3U0TA 3W2DH 1JK8B 1VADB 3BPCB 3TA3C 4AEHH 3N1PC 1RSFA 4CGTA 4JVPA 3EDKA 2BOBB 2IPTL 1NC2D 1ZWIB 3V6OA 4PUBH 1IAIM 1XCTB 2HJLA 3LN4A 4ZOCA 3MLPA 4NQEB 4JVWA 1IGTB 4U31A 5HYIA 3ARDC 1QFOA 4ZPTB 4AEIH 3TYFB 5L2KB 2EEBA 4S1RL 4QRTA 2DIBA 3P77A 1BQHA 1XGYL 1TIUA 3VWJA 1MI5D 2CLVA 1KCUL 4KJQC 1AXSB 1IL1B 1NGXA 1IEAB 1MVUB 1CYGA 1I1AC 3MLYH 4WWKB 3MRJB 3WO3B 4RAVB 5DQ9A 3VH8B 1CU4H 1RK1B 2BRRL 5DWUH 4M7ZC 4Y16D 4IRJA 3CH8A 3C6LD 1ETZA 3WD5H 2CRMA 5CGMA 1F58L 3GGWA 5CEXA 3GM8A 1NANH 3BFOA 3CVIL 3FFCD 3QH3A 4U1IA 4GW5B 4XX1G 3MV11 3MOAL 3BXNB 1E0OB 3RWFB 4K9EC 4F7PB 1U8KA 4UNTA 3E3QC 2R56H 4YAQA 2A9ML 4U1NB 1NGQH 3MLZL 2HT4C 2I9TA 1S78C 3LQZA 1E4WH 2R29L 4L8SB 3LS5L 1OLLA 4NZTH 4OGAD 4YHLL 1X44A 4HFWA 1B2WH 1EO8H 1BFSA 3C8KB 2AJXH 2DLFH 2ICES 1GGCH 4I48B 5F9OH 3PWPD 2IBGA 2H2SC 4XBPB 5FO9B 3B2VH 2IWGA 4LFHG 3HI1B 1QNZH 3IF1A 4RFNB 5E8NA 1DQML 4P99A 1G6RH 2GFBB 4J2XA 3V7AG 4G6FB 5BJTB 4H0GA 5HHNA 1SY6H 4RWYH 2YMXH 4OUOA 2CGRL 2Q7YA 2ZNWA 2QTEA 3LHPL 4HWNA 2EECA 3TLRA 3U9UB 3UTQB 1FCCA 1FL5B 2O5ZL 5CMAB 3HR6A 3CSYB 1BZ7A 2FZ3A 4NNYA 1KIPA 4I5BA 4ZODA 4LSSH 1YMMD 5DGRA 3F12B 3I50H 4JRWA 4HUVB 4I1NB 2VB5A 3NIFE 5CUSL 5AZEL 3WSQL 2YA1A 1C8PA 1WFTA 2ESVB 4FXGA 1RZFH 4I4WB 1JWMA 2OBGA 4Y1AB 2EXYD 5FUOH 4WTZA 2V6HA 1MF2H 1A1OA 4KMTH 3EO9L 1GGTA 3S98A 5KW9L 1UC6A 5ESQA 1YDPB 4LCUB 1KCKA 3VE0A 4E41B 3VFGL 1F4AA 2UWEE 4P3WA 1UZ8B 4GAYB 1DLHB 3P30L 3WXWH 1RUML 3GMOA 3THMH 5DK2A 3N1GC 2EO9A 4Z7QF 3MLUH 4BKLA 5BS0D 4CVUA 4HJGB 3HS0B 4UQ3A 1I3RA 3GSOA 2BVPA 2D31A 2RBLA 2DQJL 4GLRH 1FYTB 3F6IA 1X5KA 5GQBA 1CGSH 2VLMD 3WNLA 4M1DH 4XC1L 2OMBA 4Q9QL 1CBVH 1GZQA 3UYPA 2FHBA 4KI5E 5BCAA 1CGVA 1RPQA 4QTHA 5T1KB 5A3IC 1RUQL 1DBJL 5IFJB 1P1ZB 5HPMA 4XWOD 5E00A 2C9AA 3TO4B 3H0TB 2FBJL 1KIRB 4LP4A 1EVUA 4XBGB 5F3BB 4NFBA 4GXUN 3KXFB 4OI8A 5CZKA 5EH1A 4YHPA 4IRSD 3BAEH 4EDXB 1KCSL 3FRUB 3OB0K 4HEME 5GHWL 4NWTH 2WBJC 3GJFB 4LMQI 3KPOB 2FX8L 4DZ8B 4JO3H 2XKNA 4NSKA 4S1DD 4XX1E 1UWGL 5IB1A 3VWKC 2BC4A 2YPVH 2EEAA 3V9FA 2W0FA 4QF1A 4EXPX 2JJVA 3BD5A 4PJ5E 3VXNA 2C3XA 3P4NA 4G9FE 4G6JL 2R69L 4X6CA 1QFWI 2HKFL 3RWHB 3TJHD 3SDXF 4XHJC 5D6DC 3IDYB 1I8LC 4GS7B 3DETC 4HXAH 4MJIE 1NL0H 2AEQH 5JW5A 4LSPL 1G7IB 3BP7B 2Z8WC 3HE7C 4XVJH 5GGSY 4N68A 5B4MC 2IH3B 2VDNH 5CS7A 2VLKE 1EERB 3IB4A 3W5MA 3QFDB 2F58H 1WZMA 5BZWB 3V7AE 1PY9A 2FDBP 4NQCB 4NJAL 2AJUH 3T0ED 4I0KA 3LMJL 5SWSB 2NW3B 3LAFA 4Z7VA 5LGJB 2DTSA 4ELKB 3VFUB 3LH2H 4JZJB 15C8H 1RU9H 2YBRA 5HJ3B 4KTDL 1Q9OB 4LLQA 2F54B 3ZYOA 3AY4C 1M05B 3VXPA 1RZKH 3GK8H 3MOBH 4DUVA 2COQA 3KLHD 2IBBA 3AAZB 5IVXA 3BDXA 1QFUL 1R3JB 4X7DC 1SYVB 3MV7E 1YEKL 4HBCL 2WSKA 3S3PA 3RVTC 3ZKSD 3IRPX 1FG2A 5JIPA 4NQTA 2R0WL 2X4SA 4HUUA 1U8MB 1TJHH 4L8DB 1XH3B 2W0KA 3UZEA 2QV2A 5JIIA 2AABL 3M8OH 5JZ7D 3REWB 5TE4L 3PXHA 3F8UB 5DD0H 3RZCC 4KDTA 3PQYB 4JKMA 4ODXA 1JNLL 4KJWD 5D2NB 1UB5A 1JF1B 3WLBA 2PXYB 3R4DA 4FTVD 4PY8I 1DUZB 5FOJA 4RRPA 1IAIH 3HG1E 1LGVA 2XXCB 3ESVF 4OLVH 1LP9F 2DQEH 2D0FA 1MCFA 1OD7A 3TO2A 5H35A 4R96A 5JMRA 5CJXA 1N4XL 4OCSL 1MFBH 4BFIB 4QRPB 2LAAA 5E5MB 1WIOA 3UTSA 4Z7WB 3V0WH 4O51B 3UBXA 1G7MA 1MH5B 1KELH 3LIZL 5F7WC 4GRLB 3PDOA 4NKOA 3WXVL 1GOGA 3GIZL 4XAWH 1IAKA 3O3BB 4C59B 5HHOD 4V2CB 1NFIA 1S9VA 3I3DA 4K7PH 5DMKA 1T4KA 3QQ3B 1KXVC 2VDOL 3QDHA 4FXKA 4U1MA 2YKLH 4PJHB 4G6AD 3WL9A 4UIKL 5GS0L 5CEYA 2WWMC 5D5MB 4JFZL 3RJQB 4JM2C 2GK0A 4J3TA 3D3VE 4HIJB 1W72A 3ZTNL 2PO6C 1FGNL 2G60L 4O2CB 4YXLH 3NZHH 1T6WA 5CZXD 2HMID 4HS8H 2ZKHL 4RMTA 4NYLB 5J06A 4JKLA 4P23B 3ARFC 2E3VA 4ORGA 2R0LL 3P40A 2ADFL 1YZZA 1HIMH 4Y4KB 4BUGA 1R6VA 5DJXB 4HIXH 4ZAKB 3P11H 1NAKL 3CDCA 1CK0L 4JFHD 3QUMB 1ZT4B 4F57L 3VWJD 2D3VA 5FO8B 1C5BL 1HHGB 3MUHL 3FOMA 2IG2H 1SVCP 4QXGL 1FZKB 1DANT 4O2EA 5K9QG 5TH2B 4YDKL 1AJ7L 5EPMB 3IJYA 1D6EA 2VC2H 4M3JA 3RP1A 4IRJD 2YS4A 3OGOE 4HC1L 2WZPD 1UG9A 1DBKH 4MA3A 2AQ1A 4L9LB 4OFDA 2O93L 4U6VL 3L95B 4QTIH 1MHCB 5EC1B 2V2XB 2ZOLB 5GRYA 5J12B 3DO7A 2FJGB 1EEZB 2VDKH 3GMMA 4OQ1A 1KUMA 1F8TL 4YDJA 3VFWA 2YPKB 1H3PH 1UA6H 1LO0L 1AR2A 1U42A 3D6GA 3EJYD 3IKCA 3TIEA 3FTGB 4N5ED 5ELIA 2J8HA 4G8FB 1H5BC 2LQRA 3HI5L 5DZLA 5GS0D 2H32A 4Q74A 2C3VB 4MXWL 3HPJB 3GO1L 5CP3A 4LKXB 3U4EA 3BH9A 2I24N 1Q0YH 2HN7A 4RGMB 3DTXA 4G9DA 4P2RB 3UJJH 5F89B 1KJ2B 5B22A 3V6FB 3RIFF 2Y5TB 2X6MA 2HRPH 1RIHL 1BF2A 5BO1L 5I1JH 3R1GH 4E0RA 2DQDH 4X4ME 5ITBL 2OP4L 1J11A 1I1AB 1YEJH 2GSGA 3TPUA 5KVDH 4LKCA 4NRZB 1OOAA 3SDAB 3ARBB 2ZG1A 4NPYB 4M7ZB 1C16B 2XV6B 2VWEE 1KEMH 4H88L 1IZKA 3UZQA 1T1XA 5DJDB 5IWLC 3QHZL 5FM8A 4QT5A 5D6CB 3QEHB 1P6AB 5BRZE 4WFFE 4ZO9A 1TNNA 4U3HA 3UC0L 2EC8A 5D7KE 1ZGLP 2JJSA 2VDPL 3QAZC 3VG0H 4JG0H 1WVZA 3R06A 4R4NC 1CR9H 4H1LG 5CGYD 3RIAF 1XGUB 3IDJB 4XNQB 2IFGA 3SDDC 4U1SA 1QG3A 1TZIA 12E8H 1I3UA 2FX7H 1A3LL 3PWJB 4ZUUB 1PZ5B 3K81A 2CDFA 3GMRA 4X8JB 1KULA 3MFGB 3ZKQD 1SM3H 1IM3B 3S88H 1D6VH 4U0QB 4XAKD 3HAEG 1MIMH 1QEWA 4P2YA 2VISB 4UILL 1QKZL 3BKCL 3BQUB 5J11B 4MNGB 1AIFB 3IAQA 5JQ6H 1U8QA 4MAYA 3ZTJG 2QQKH 2PTTA 4P3CL 5HHVL 1WEJH 4ALAH 1AGDB 5CBEB 5GRJL 1HH9B 4LSVL 3TWCH 4H1LH 4F3FA 2R0KH 3L3GB 3MV9E 4NZRH 2DKUA 3BI9X 2C5DC 1YYMH 4F37K 5DT1L 1MCNA 2DQIL 3ULUD 5HDQH 1FFRA 2YXMA 3HUJA 2Z92A 5ACZB 3SE4A 2EDEA 1KLGA 3QHFH 5E56A 1F6AA 1HI6B 1NBVL 4MS8D 3U6RA 3VXSE 2Z9TA 3ZTJH 1N7MH 3QO1A 5D7SH 1M7DB 1KPVB 5MP6L 5SWQA 4G6ML 2DDQH 1YEFH 2P7TA 2GYSA 2OXGA 4Z7UB 1FNFA 4PJ7A 2J7LA 4OBSA 4XPAH 2XACC 3ZKND 4JQIL 1ZLWK 5LGKA 1E6JL 1C5DB 4G8GA 3GSWB 5H37G 2VYRE 4K3DL 5F71A 3MRKB 1F11A 2DWEA 4LVHC 1JNNH 5KVEL 1VFAA 4MX7A 5DTFA 3W39A 5I1GL 2A83A 5LAXB 4MWFA 2X44D 3QDJA 4HF5H 5CHNB 3T3PF 3W9DA 2WUCL 1GIGH 1DQTA 1YY8A 4KKCC 3F7RA 2ZUQB 3TYGL 5FM4A 5FGBC 1I9RH 3E2HC 2X05A 4HWEH 2DMBA 2CK0H 4Z0BL 4E9LA 4M5YH 3WEXA 3QQ9C 4AIZB 2PR4L 2R2HA 4JB9H 4CNIA 1IAMA 4LPTA 3QZWA 2GITA 1ZLUH 1H3WM 4ODSH 3ZSTA 4ZD3H 3GJFH 1ORQA 3DGGB 3E6HB 5H37H 3STZB 1Q9LA 3CXDL 4XWGH 4KHXH 4P46A 3HR5B 2Z4QA 3FZUC 2VLJB 1CLYL 3GHBH 3WFHB 1DQJA 3DVGB 4H8WH 2NY3D 2IH1A 1GGIH 1CZ8H 1UM5L 1EAJA 1TMCB 2FR4B 4OZ4B 4JFEA 2LV4A 2GJZB 4MXQD 1T20B 2VXQH 1IGML 4GMSH 1U92A 2DB8A 5EWIL 2WBJB 1E4XH 1W72L 4ACPA 1J1PH 5MENE 4OGXL 3LKSB 1BFVH 4BQCA 2EH8H 4Y1AE 5A16B 1G9MH 3EYQC 4NHCH 2D7PA 4PRHE 1DANU 1CIDA 2ED9A 4PPTA 5FK9B 4YPJA 4AH2B 2D0GA 1AD9B 3DMMC 2OL3L 3CPLA 2EXWD 4NJ9L 1P6FA 1QPPA 4HKBA 5CBAA 4DN4H 3WN5A 4ZTPL 4ETYA 4AMKL 4K8RD 1PKQA 2VLRA 2ATKB 5IQ7L 2GAZA 4FFVC 5HD8D 1EFXA 5GS3A 5LCVL 2IGFL 4IS6A 4M02A 1SJHB 5E6IC 1VADA 4FQLH 2R9HC 2ZOKB 3RVVD 2QBWA 2FD6H 1J0IA 4Z7WF 3HLAA 2Y06H 5DMIH 4QHNA 5GSRB 5E8PB 4F7CA 3FQTA 5E2WH 1XCTA 4HEPG 1VEPA 1AGEA 4K3HA 2QADC 3QFJE 5HHPA 4NQEA 1IGTA 3UTSD 3LSOA 5DRNB 3C5JB 1T5XA 2LE9A 4ZPTA 4PJDE 1OTUD 2X1QA 5D5MF 1YY9D 3MA9L 1KB9K 4MNQB 3G6JA 4JFXB 4OT1L 3T0DA 3B2UD 1T2QH 3C5ZC 3CDGB 4TVPH 4LQFL 4KJPD 3RU8H 2GIYA 1Q38A 3MRJA 3QCUL 3QDME 2XY2A 4WWKA 4P5MB 5DRWB 5DUPH 5C0GB 4ODUA 1MEXL 4PJGF 3EYFB 3VMOA 1HSBA 2JJTC 3DJ9A 1S7QB 4FFYH 4PTTA 1I7UB 3BEVB 3MR9B 3U7AA 3E1F1 4OSUL 1JPGB 1NCBH 2EZ0C 2UY6A 1CVRA 3O6LL 4KKAC 1URLA 1EPFA 1FVCB 1Z6JT 1AKJB 5JMOC 4C55A 5D1XB 4LVEA 5I1KL 3IDMB 2ZSWB 4LLUA 1WFNA 3X14B 3BXNA 3OTTA 4UINH 5J3HD 4WTWA 1UXWA 4F7PA 2AKRB 4X0KB 4K94H 1B4RA 3ARZA 4P5TA 3FJTA 2H3NA 2ADGA 5FCSH 1HKLL 4EUPG 1YN6B 1SQ2N 5FDWB 1BIHA 1OSZB 4OJFH 3QXTA 1TQBC 4LCIL 3ZE2E 5HY9B 4XMKL 5C0DA 4M3KB 2EEDA 4I48A 4AJ0A 2NX5E 3T2PA 4XBPA 1NAML 5FO9A 5C07B 5IBLC 1G9NL 3TBWA 1GHFL 3MGTB 5F7KC 1IC7H 4PJCB 3WHXB 4XP9H 2BVTA 4KKLD 5LQBL 3LEXB 2JE8A 3TF7C 5DLML 3V8OA 2RHEA 1K8IA 2E27L 3UTQA 5DMGD 5JIKA 5C0BB 2Z93B 2UYLA 3ZYZA 3HZMB 4EUPH 5SX4I 4MA1C 3SJVE 5HYJA 5GISL 4MCYB 3BT2H 4HMEA 1LO3H 1A21A 4GRMB 1NBYB 4HUVA 4ZOAA 5L9DL 4K3EL 1A64A 1OT2A 1CI5A 2I07A 3LD8C 3L3OB 5E1HB 4XNYL 1KF9B 1UJTA 3MNVA 2RCSH 2FB4L 2AQ3A 1Q94A 2XWTB 1A6ZB 2BXZA 5C0AB 1MJUH 4O58H 4JM4L 4U1LB 1ZANL 5BZDB 5FYKH 3MBXH 5HI4D 3ZDXF 3QT2A 4TVPE 4GAYA 4WY7H 1DLHA 3EDFA 3HI6H 1MRDL 3WKMH 4AL8H 2ZJSH 3VFNB 2A6JA 2J4WH 4U7MA 3MJ9L 5K93A 3C2AL 3HS0A 3UJIH 4MQSB 1QSEE 4MD4A 5IEKB 1FYTA 4EXKA 3I6GB 1NBQA 4U3XA 3AB0C 3F7QA 1D5IH 1OD9A 1RJYB 3H9SB 3OJDB 1DL7H 5EORH 2F53B 1DR9A 1CLCA 4J4PA 3WJJA 3T0BA 5J7CC 1VACB 2IMMA 3FCTB 3GHEL 1F4YL 3FRPA 4PREB 4W6XB 4FQ2H 3S96B 3VXUD 3FB8A 5H2BA 3JSSA 3QXUA 1B90A 3TO4A 5F3BA 1U36A 1XR9A 5F97E 4PJHE 3ARXA 4GFTB 4MAYD 4EDXA 4ERSH 3G6AB 5D7LB 5EUOB 3KPOA 4DZ8A 3CSBA 1JV5B 2BJMH 4PYHA 3KYMA 4D0CA 6CGTA 4NO0B 4OQTH 2J6EL 5C0JA 5J1AB 1AO7B 4BSVA 4LSQL 1OAUH 4V1DB 4K9EH 4Z7UF 1CIUA 1JNHA 3PHQA 4KKBC 3CFKB 1J5OH 2VXUL 4QRSA 3HZYB 2Q1EA 5DUBA 1CD1B 4HV8B 1TZGH 4Z95H 1DTUA 3ET9F 1A4KB 4ZQKB 1G7IA 3BP7A 3G08B 2V9RA 1ZS8B 2IH3A 2A73B 4D0DA 4FP8L 4XRCB 3SOBL 4UBDC 3QFDA 5EZOL 4G8GD 4AZ8A 1VFBA 4NQCA 4DGIH 1Y18B 5FYKE 3SKMB 1AQKL 1CF8H 2J3SA 4KY1H 2NW3A 4D0BA 1S9KC 5LGJA 2VJXA 1N6UA 4M03A 4JN1H 5F1SA 2AS5M 3GNMH 2A1WL 3QDJD 4LGPB 5CCKL 2F54A 1A7QL 4YHIA 3QPQD 1BBJB 1M05A 3WIHA 5IJVA 5BQ7B 3GMPB 1RIVH 5GGRB 4YDLB 3R8QA 3LN5B 2F19L 1R3JA 3DPBA 1SYVA 3NMEA 1GGYA 2P43B 4JANA 1XIWC 1U8MA 3LKQA 4CRPA 4L8DA 5E2TH 4YUEL 1CT8A 1XH3A 5DR5L 5F9WB 2EE9A 4MZ2A 4NC1C 5IMKB 2VE6B 3ESUF 3REWA 4I9WE 1PGRB 4L29B 4M93B 1INEH 4P46D 3RWJB 3P4LA 2IANA 3WNMA 1JPFB 4KMQA 1JNJA 2ERJB 4OZGA 3KLDA 3KWWA 4BK4A 4EI6B 3RAJH 4HG4J 1DUZA 5C6TL 1TJGL 4FS0A 1MFDL 5EU4B 3ULVC 4JFED 4TRPH 5DEGB 1VPOL 4L4TB 3T2NH 4R2GB 4LK4A 4XNXL 1FJ1A 1H15A 4PJAB 1NMAL 1QD0A 1FBIL 4CMMB 1MHEA 1NQBA 3V0VB 1WAAA 2FEEI 1MCDA 2YPLB 1JUFA 3QIWC 5I8OH 1WZKA 5IHUL 2B2XH 1MNUH 4HMCA 2UVFA 1IEBA 2VN7A 3BPLC 5E5MA 3KPRA 3W0WB 2AK4A 4XCEB 1NUDA 4LVHB 4RA3A 2Y4SA 4Z7WA 4XPBL 1MH5A 4GRLA 5ANMB 3LVEA 4WFGD 3E3QE 3WFEL 1AFVH 2D7QA 4KTEH 2VLRD 1FNAA 1INQA 1EFXD 3OWEA 3QQ3A 4GBXB 2LVCA 2FECL 2Q20A 4XNZC 2LAGB 3K1DA 5D5MA 1X5FA 3ZHDA 1N59B 1R5WB 1NJ9A 3L7EA 3VFSA 3ZDYE 3X3GH 1PEWA 4ODHH 5I8KL 4O2CA 1BECA 4OZIA 4PJFB 5C09B 4PJGA 2FYYB 4NYLA 1CXEA 4NQED 2AJSH 3NIGE 1T7YA 4WV1A 1RZJC 5TE6H 1OGTB 4BFEA 3TN0C 4ZAKA 1RJLB 3WIIH 1ZK9A 3CFCL 3QUMA 1QFPA 4GSDL 3CK0H 3P73A 2XQBL 4JO1L 4PJIE 3B9VA 4PG2A 4Q6IC 4LRIA 4XPGH 5F1NB 5FO8A 1WWCA 3CAFA 4YIQB 3AXLA 4DKEL 4POZC 4Q6YA 1IFHH 3V4PL 3NN8B 1JPTL 3HZKA 4WWKD 1IARB 3GI9L 5CLTA 1C08A 3UROR 2AVGA 4C54A 5EPMA 3RY5A 4J3VA 4GXVL 3DUUA 3QXDB 4IHOA 5ICZA 4QEGA 3UPRB 2EC9T 3DI3B 5HVHC 4OFPA 4JDZB 5KSAC 2V2XA 3Q1SH 4G43B 3UYRL 2R15A 1V7NH 3T2OA 5CJ5A 4HFUL 4TUOB 4QGTA 3KYOB 1FSKC 1RK0A 4OGYH 1EEZA 2QEJA 4CADB 4Z8FH 1JTPA 1BFTA 1O0VA 2OCFD 1OAXL 4N8CL 3MLVL 5LWYH 3O45B 3OJVC 3GSNA 4HWBA 3BKJH 4P5TD 5IQ9B 1GPOL 1YQVH 1BVKA 3FN3A 5ISZA 2DKMA 3ZYIA 2B5IB 1NFDE 4HWZB 2J88H 3IDUA 3TBTA 4TSCL 2QADB 2M2DA 3LZFL 3OB8A 4LKXA 3AREA 4JPWL 4NGHL 3F5WB 4GW4A 4JQVA 4P2RA 4XXCC 2VZOA 3V6FA 2Z91B 1A6WH 4N0UB 2Y5TA 2MMXA 2DKSA 4RAUA 3L6FB 5EBLB 5DQJB 4G6FD 3C5ZB 3UTZB 3PGFL 3QPXL 1EEQA 4NRZA 4EKXA 3RA7H 5DFVC 1MFCL 3F58H 3ARBA 3NCBB 4ONFL 1ZT7B 5T1DH 5HYJD 5ID0B 4IRZL 1D5BA 1FGVH 2Z8VC 4HS6B 4WUKH 3NIDF 1BWMA 3NPZB 4PJ8C 5K9KB 1XGQA 1OGAA 2HFFB 4NO5B 1WBXB 5L8LB 4PR5B 2NTSP 3F65A 4NKDB 1T0MB 2ZUWA 4OTXL 4PRPA 2DM2A 4M62L 4F33A 2E9WA 4FFZH 4RZCB 4U1KA 2JCCB 1RJZA 5TFSL 5CINL 3HCVB 2MQCA 1ZHBB 3QEQB 4ZSOE 3U0PB 3LQMA 3D0VA 1D3CA 2DQUL 3WS6A 1JYNA 3H9ZA 1IM3A 1NEZB 1JCKA 3ORJA 3P0GB 4D9LL 1D5XB 1QRNE 1JRHL 3S35L 2APVA 1DE4B 5EBMB 1S3KH 3BQUA 4DKFH 1A6TB 4YZFF 3EKCA 1AIFA 1I1YA 3LRSA 4XNUL 4URTB 2Q86A 5J6HA 4R26H 1TQBB 4Y4FA 5CBEA 4G42B 1HH9A 4FZ8H 1FYTD 4QXTA 3KS0H 1KJMB 5F6IB 4ZUWB 1P84J 2FJHA 2QHRL 2ZUXA 5EA0H 3TCLB 4XMLL 2OTUB 4N9OB 1L0XA 1P9MC 3QRGH 2WM0A 3BIKA 3ARTA 4MDJB 4LPWA 1N5YL 4D9RE 4GOSA 5FIEA 1MAKA 3CVHB 4PJ9B 4R4FL 4BQ8A 3A67L 4HQQH 4BM7A 2Y6SC 4I3GA 5ACZA 2HT2C 4PV9B 1LHZA 5B38G 5EUOF 3EAKA 3HHRB 1HI6A 4G8IB 4WEBL 5I6XC 4HK0A 3TO4D 5E2UL 4OB5L 2CJUH 3AMLA 2VTFA 3OXRA 3OQ3B 4NBXB 1GZPB 3T4YB 1KPVA 4L3EA 3KXFD 4M48L 1NLBH 4RIRA 1H8OA 3MO1B 4YDIH 2GJ6B 4JY6A 1X5HA 2FSEA 2XTJB 3NCYS 1C5DA 1EDQA 5B3NA 1RUPL 2FGWL 3MRQA 3VCLB 2XWBB 3MRKA 1T66C 1GOFA 2L0DA 1OAKH 4YK4B 1DSFL 3EFFA 3VXQB 5FHBH 4JFFB 5F9AC 1NMBH 4XVSL 1I9EA 1XCQB 4E42A 3H9HB 5C0CE 2BSTB 3VI4F 4R3SA 1X5AA 1FFPB 4HJ0D 5I75C 4KV5E 3BP4A 4AIZA 5IR1A 3AB0B 1FNHA 1GC1C 4UTBL 1YNKH 2AQ2A 4DCQA 2WW8A 2OZ4A 1KLFA 2MQ0A 4NQCD 3OPZH 3ZKMC 2VLJA 3WFHA 5T5FH 4U1HB 5EZLB 5SWSD 1TCRB 1KBGL 2V7NB 4PJCE 5D7IE 5I2IB 3B9KB 1EO7A 2V5TA 5KN5B 4OZ4A 2FR4A 2F54D 5C0BE 1I3GL 1T20A 3VXME 2VIRA 2XKUA 2QSQA 3TZVB 4CVZA 1J8HE 3MJGX 3NGBC 2GTWA 1L7IH 4XPFL 5BV7C 5L0QC 1MRCH 2ZCHL 4ZTOL 5E08H 3KJ4B 4FZEH 2R2BA 5KG9B 4Y16C 3QQNA 1IBGL 5E99L 1K6QH 2X10A 3C6LC 1GOHA 1JHKH 2OTPA 4AH2A 1KENH 1B0RA 1AD9A 1R5IB 3MRHB 2E6JA 3NIDE 2EC9U 2X4NA 3WFBH 2IAND 4JDTL 1N2RB 4PJAF 3PQYD 3T3ME 1INDH 4Q2ZA 1FNEA 5ICYB 2ATKA 3U0WH 4P4KC 4S2SA 3MRBB 2NMSA 3NTCH 4IM8A 4WIQA 4WUUA 4L4VB 2AXFA 3V4UL 4AEEA 5JHLL 3QXAA 3TFKD 3ZL4L 4HKJB 3G5YB 1HHKB 3OMZA 1J05B 1JWSB 5JOFB 5E4EB 1EH9A 1OP9A 3PWLA 1ZLSH 4XB7A 1T7ZA 3WFZA 4F2MA 1K8DB 1BIIB 5F7EH 1U0QA 4XBEL 1F4HA 4I0PC 4Z0XA 4KZEL 1TTUA 1R3KB 1DZBA 2K9UA 5I1HL 4WO4B 1BBDH 3C08H 3GB7B 3KPRD 2AK4D 2VDML 2ZG2A 4JY5L 5DRNA 3T0XA 3C5JA 1K4CA 1MCPH 4GRLD 3CXHJ 4HGWB 4MNQA 4JFXA 2GY5A 5CKGA 2F74B 5GZOD 4EBQH 2UWEA 1MQKL 3GZKA 3Q6FA 4MA7L 5T3XH 3WLWD 4PJFF 1UJ3B 3QCVL 3U7YL 4Y88A 4JAMA 5SV4A 3HC0B 1A6UH 4GG6B 1KIUA 4MQ7B 4DZBB 3I02A 4YBLC 4Z5RB 3OR7B 1ADQH 1S7QA 4K71C 1I7UA 3MR9A 5EU6B 2IAMC 2ICCA 5I30H 1QHPA 4YNYB 1KFAL 1JPGA 3S5LG 5KSBE 1RHHB 1WTLA 1U3HB 2GQHA 1FVCA 3HA0A 1MLCA 5D1XA 1LWRA 1IRAY 3H7BB 1QQDA 2EXYC 4H5SA 3IDMA 5DJCA 5DHXB 5C9JA 3RNKA 3X14A 1JMZA 3BHBB 4ZAKD 4HULB 1IKFL 2AKRA 4V1DE 3MYJB 2OXHA 1YYLH 4MHHG 2I5YH 4R90L 4DAGH 2NY7H 2QR0A 4O2FA 1QYGL 1YN6A 1J1XH 3KNBA 5ERWB 3AS1A 3U4AA 1U58A 5KAQG 3K4DA 3QIWB 3S9DB 1MHHA 2JTDA 4JR9H 4MA8H 3V7MA 1W0VB 2OSLB 2ZWLT 3F7YA 1OL0A 3IFPB 4R8WH 2V17H 5HY9A 2BVOA 3C6SB 4IOFD 1XFPA 4ODWB 4UT7H 1NGPL 5C07A 3MUGB 3FQWB 1LD9B 1A7RL 1T0NB 1UXSA 3L3DB 3V95A 4IIQC 4K3JH 3WFDL 4OLZH 1AD0A 1BGXH 3GKWL 4PJ5A 3HRZB 4LCCC 5TDNB 1F00I 1E4KC 1U8OA 4MD5B 2PF6A 3HZMA 2E6PA 4G9FA 3TEUA 3O3DB 2XG5A 3RFZC 4XPHL 5I16A 3PXJA 1ZLUK 1B4JH 3HNTH 3MRRB 3DURB 3GJFK 1P4BL 4JG1H 4TNWF 4XWOC 4KVCL 5FYLL 3L3OA 2Y23A 3S34H 3ARED 4IRSC 1UENA 1U3ZA 3QDGB 1NCTA 1XR8B 5C0AA 4GUPB 4P2RD 5AYUL 1TVDA 3S36X 2VLKA 4QHKI 4PJBE 4S1DC 4U1LA 5BZDA 3ZHKA 4A2MA 3JVGC 3IXAB 4PRNB 3V2AR 2PN5A 4K7FA 5T3XE 4KAQL 2EDYA 3L5HA 3JZ7A 1RFDH 5MHSE 3VFNA 3S37X 3ARBD 3FMGL 3BZEA 3PWVA 3BKML 5H8DA 1P7HL 1RV6X 2JCCF 4NM8H 5F3HA 3RWGA 4ZXBB 4Q0XH 2YD7A 4F15C 3EO1A 3TJHC 3PNWB 2E7LA 1B3JA 1LK3H 1R3LB 5DUML 5KSAB 3DBXB 5JORA 1T2JA 3ULSB 1OGAD 4OM0H 5ILTH 3MV7A 4PRPD 2F53A 5CEZD 2VUOA 4QRQB 2VDRL 3HMWH 1DEEB 3NA4A 1VACA 3MNZB 3V4VL 2NY4C 3BKYL 3QJFB 1U95B 4DKDC 2PW2A 4W70A 3S96A 3HC3H 4NNXA 3KPSB 3E6FA 1FVDB 1T1ZA 5F9DC 5KBNC 4ZFZA 3I2CL 4GKSB 3BQUD 4NN7B 3LEVH 1BX2B 2DMKA 5DA0B 2FATL 2X4OA 1OSPH 1BOGB 4LLVA 1BAFL 4Y4FD 4UDUB 3TPKA 4Z7OF 1CL7L 5FUZH 1ZEAH 4H20H 2P8MA 1CLOH 4PG9A 4XI5D 3T8XA 1Z9LA 3KLHC 5EDXA 1MWAH 5FYLD 2VSDA 1BM3L 3AU1A 4HXBL 4X5XA 3SBWA 5J1AA 4M5ZL 4C56A 1AO7A 3IDGB 4RGOH 4UTAH 5I15H 3BJLA 2MNUA 5JZ7C 3U9PL 2AXHA 2IF7A 3EJZD 3IJHA 3DARA 3DX7B 4KJWC 3EOBB 1MCBA 5BVPH 5HGBB 1KNOB 3L1OL 5INCA 2WIIA 1V7ML 2VAJA 3C87A 1S7RB 3O0RH 4L3ED 4JFOB 4K2UH 1S7TB 3QUZB 1CXIA 2Q8BH 3BEWB 2A73A 4QRRB 1J10A 1V3MA 2BY0A 4DK3A 1CFQB 4OCRL 2K1MA 3D3VA 5I1DA 4EDWL 2ADJA 4BQ9A 1MJ7H 1L6ZA 4RISL 1WTGT 5IV2A 5E6YA 3CJJA 3E8UL 5DS8B 3KDMB 4G8EB 1JE6A 1MJ8H 1PD6A 4UOJA 3RY6C 2ICEA 4Q7DA 4XVTL 2NY1B 5TDOB 2AV1B 5BQ7A 1VEOA 5KSVB 4LCWB 5GGRA 3DGCR 3LN5A 1CLZH 5DQDH 3W2DL 3W9EA 4AEHL 2BVQB 2C1OA 3DXAA 3ZE0F 4LF3B 3QCTH 2X89A 4RFOH 4PUBL 3MRMA 3CFDB 4A6YA 4N8VB 3GJEB 4ZMAT 3OKEA 5B39G 1BOYA 5EBGA 5DFTA 1QA9A 2UZXB 5IMKA 2VE6A 3V6OC 4AEIL 4LL9A 2HYMA 2VLJD 4PLJD 3JV4B 2OS7A 4GQ9H 4OD2B 4EI6A 4RDQG 1V3JA 5KVFH 1W0WB 4NQVA 3BSZH 3LV3B 5EU4A 4NQDA 3MLYL 3Q6GH 43C9B 4L4TA 3T1FA 1IE5A 1CU4L 3ME0A 2EICA 4W4OA 5DWUL 5KOMC 2FL5B 3CFJB 4CUCA 3L5IA 1XAUA 3V0VA 2YPLA 5HDBE 3RWEA 4I0CC 4IRJC 5I1AB 3W0WA 3ARYA 3NA9H 4XCEA 3OAZH 1JGEB 4OF5A 2FO1A 3TBSA 2VKXA 2G5BB 2XN9E 1OLZA 1JWUA 2X42A 4WW2C 4OZHB 5DA4A 3PIQB 4WUUD 4PP2B 2R56L 3M45A 1N64H 4WI7A 3VU2A 1EMTH 5I75B 1NGQL 3HFMH 2BCKA 1N59A 3EJYC 4LPVA 4ODTH 3SKJH 5ID1A 3T65A 4NZTL 1ODAA 4F80A 4J6RH 4O02H 1B2WL 3CU1A 1VGEH 1EO8L 1NC2B 5DVKA 2AJXL 1FFOA 1GGCL 1HOCB 5F9OL 5C09A 5J57B 2FYYA 1JN6B 3MRGB 4AENB 3B2VL 5CKAA 2BNQE 3QNXB 4I18C 4U6HA 1QNZL 4LGRB 5IHLB 5EOTB 3ZDZE 3VA6A 4GG6F 4QOKE 4DFIA 1RJLA 4DOHB 1SY6L 5IEHA 4RWYL 4MNQD 2YMXL 2CDGB 1GCFA 4Y2OA 1AGFA 2HVJB 3G5VA 1MFAH 5DJ8A 1T7WA 1FE8H 5BV7B 4ZFOA 1CDBA 2H41A 4LSSL 2JLLA 3QXDA 2VSCA 4FQJL 3I50L 2GJ6E 3ARWA 2CKBB 1ZT1B 3SCMC 1RZFL 2C7UB 4FHBD 5DHYA 2BDNH 3DX6B 2ZUTA 4PJXB 4G43A 3ULVF 5FUOL 2UZIL 3PF2A 4KMTL 4M43H 3RQ3A 4NT6B 4LVOB 3IFLL 4MNHB 3SGKA 5IMMB 5D1XD 1MVFA 2GT9A 3QNZA 4PLKD 1PQZB 3F7VA 3X13A 3BDYH 2AI0H 4HCRH 3B6SB 3WXWL 1IC5H 2AJYH 5KS9B 3THML 3CZJA 5F44A 3MLUL 1WZLA 3FO9B 4HWZA 3RWIB 3VXSA 1A4JA 3O2DH 3HPLB 2B0SH 3Q5OA 1LVEA 2WQ8A 3EDJA 2D7MA 1CGSL 4M61A 4M1DL 5C07D 3VMNA 3QEGH 3PWPB 2HWZH 4N0UA 1CBVL 4GT7A 4OV5B 1UVQA 3MRCA 1CE1H 1U2HA 3ULUC 2XZCH 1CE6B 3BN3B 4WHTA 4FA8A 4CN4A 2IADA 1Y6MR 5JPMB 1A7OH 3ULVH 4NKMB 4G9FD 4FQXC 2EDOA 2VAAA 2KKQA 2X7LB 1DFBL 4LCYA 1T1YB 3J8F7 3BAEL 3KVQA 1YMMB 3QO0A 4MS8C 3STLB 2XG4A 4ESKA 3B83A 2X70B 3H42H 2HFFA 4NWTL 1PW3A 1WBXA 5K9KA 3WUWG 2VH5H 4B50A 1I4FB 5HYSG 1I8KB 4JO3L 4LP5A 1NDGA 2DBJA 5JLZA 5C0AD 4S0SD 3AS2A 3HCVA 3ZKNC 1J12A 4LFHD 3QEQA 2VLKD 3U0PA 2YPVL 3MTRA 2MFNA 3SGJC 2OMNA 1CN4A 4YGVA 2MPAL 5EO9B 3B8SA 2N4IA 1U6AH 4L4VE 2CD0A 2PYEE 3IXTB 2DQHH 1A6TA 1S9YA 2R2CA 4NRYB 2WP3O 2ZNXA 4HXAL 1NL0L 4EVNB 5BS0B 2AEQL 3QEUB 1WT5A 2HG5A 1I85A 4XVJL 3FB7B 2VDNL 4ELMB 2FH8A 3MV7D 2F58L 1D9KC 4O5LH 5F96H 2PW1A 2F53D 2CRZA 5EIVA 1PG7W 3CVHA 2AJUL 1RZJH 3QIBA 3SDCC 1XF2B 5IT2H 1S9WA 3VXTB 3U46B 4K7PY 4XVUD 4KRNA 4LCCB 3LH2L 1RQ5A 4LAQH 2AXGB 4NUGH 1RU9L 2MTPA 2ED7A 3HAEA 4G8IA 3D25B 1PEZA 4D9QE 2NY3C 1RZKL 2WIMA 2AXJA 3GK8L 1G7QA 2X40A 1UQSA 4JHBA 3QI9C 4APQA 5D7LD 1QLRA 1V05A 3B4NA 4PB0H 5JXAL 1T3FB 2JKXA 4MDIB 4NP4H 4NC1E 5MERB 1TJHL 5B8CB 2XWBA 3M8OL 1JTOA 1WCBB 4C56D 1AO7D 4MCZB 5DD0L 3HZVB 4P0DA 1OAZH 5CJQH 1YA5A 4XZUA 4PJDA 2EXWC 4MLIA 4O9HH 3LKPB 1IAIL 2AJ3B 4KDTC 3N1FC 4K8RC 4OLVL 3CCHB 2AJZB 2V5SA 1YQ2A 2DQEL 5GGQH 2NTFA 2EDHA 3X12B 2R1XA 2HTLC 2VLLB 4ZOBA 3L3HB 5JOPD 4GMTL 4N0CD 2YEZA 3Q5TA 1HHHA 1MFBL 1T2XA 2V9QA 5F7UA 3UTTB 3ZMRA 3V5KB 2VITB 5CJXC 3D3VD 5CZVH 4CL7A 2M1KA 3KYKH 5D96B 4L8CB 5IBTH 3V0WL 2A6DB 5EOQH 2A9NH 4U1HA 1TCRA 3T0EB 2V7NA 5C70A 3JV6B 1WBZA 2BNRE 2BXYA 4OUUA 3B9KA 3BPOC 3HNSH 4XAWL 4DTGH 5FECB 5DRXB 3WIFA 1OTUC 1BD2B 1YY9C 5DZNA 4K7PL 3CUPB 1A7PH 3TZVA 3MROB 3QA3B 1OW0C 3BP6B 3B2UC 2YKLL 3OR6B 4CMHC 3DXAD 3DHJA 3LS4H 3MMEB 4QGYA 3BW9A 3FT4B 5DRZA 3IU3B 2X89D 5KG9A 5F9JA 4UNUA 1F3DJ 4MQXC 4YXLL 3NZHL 4F7EB 2BSRA 4KGLA 4Z78B 3MZTA 1VGKB 1G7JB 5CSBA 5DC4B 4HS8L 5IMOA 4JREB 4ODBD 1S7SB 3RVWD 2XWJA 5D8JH 2NX5A 4X6DB 3QIUC 3JBG7 2XOTA 3J7HA 1J0JA 4J12A 1HIML 1N2RA 4BZ1H 3GUTB 3BD4A 3BH8B 3GFUA 4IEFB 4HIXL 1C12B 3P11L 4ETQA 1CVSC 1BMGA 1CFTA 1NC4A 2R1WB 4JPVH 2OI9B 2CPCA 4HLZG 4FTVB 1H3TA 5J3HC 4NQDD 3ARRA 1DBAH 2IG2L 3BP5A 5DD3H 4ZFOL 2DJUA 4L4TD 4PIRF 4R2GD 3ZO0A 5JOFA 3Q2CA 5DD1H 2GTZB 2EIDA 2VC2L 1F4XH 2HJFB 1Y6KR 4IDJH 2XZQH 1DBKL 3SJVA 2YPLD 4UAOC 4NUJA 5D1ZC 4WO4A 3DSFL 3GB7A 4QTIL 5CIPB 3EHBD 4OZHF 1ZKAA 3W0WD 3V52H 5HI3D 5D9SB 3IU4L 1A1MB 1S7XB 1UWEH 1X3DA 5C0EB 2VDKL 2I9LA 3TV3H 1H3PL 3EO0B 1UA6L 2EDBA 1WK0A 3KPSE 4HLZH 4JLRB 3SKNB 3ZKXB 2P5EE 3D0LB 4GRWH 1YPZB 1WIUA 5DJ2A 3U4BH 2B8OT 3GSQA 1UJ3A 4KKLC 3VGAB 3HC0A 5EG6C 3CFEB 4MQ7A 3MA7B 3FOLB 1G7HB 1QO3A 4KQ3H 5DMGC 3S97C 4DZBA 3FL7A 4X5LA 3P3YA 3U0TB 3OR7A 1SBSH 5GJTH 4ZS6D 1OAYH 3QG7L 1QSEA 1QSZA 2GK2A 2H2PC 4MGXA 1A9EA 1Q0YL 1RHHA 5C09D 1I75A 1MY5A 4NCC2 3TJEH 5D7KD 5EBWB 2HLAA 4R7NA 2HJLB 3UJJL 1UEYA 3C60C 5IFAH 5E95B 4DFHA 1WGOA 1K2DB 1Z3GH 2HRPL 5JDSB 5I1JL 3R1GL 1T5WA 3RRQA 3MRIA 1RUKL 2PTUA 2DQDL 1VB9A 4IMLA 3BUTA 3UTPD 1YEJL 3E0GA 5KVDL 3P77B 3VWJB 5HI4C 5C9KA 2X1XR 4PJXF 1NGXB 1FCGA 2NYYD 3GSXA 4PTUA 4HJJH 1ZGLM 5C7XH 4OD3H 5LJYH 1WFUA 32C2B 5ERWA 1OT1A 5DO2D 5DQ9B 5IG7A 2R8SH 4D3CH 1RZIA 1ZVYA 4R0LB 3EIFA 2OSLA 1GC1H 4JG0L 1CR9L 4I3SH 4TUKH 5F7NC 1OF2B 3O6FA 1CXKA 3MUGA 3GGWB 1ONQA 4LASL 2JJSC 5KS9F 5GGSB 2FX7L 1U9KA 3QH3B 1S7WB 4U1IB 5ESAB 3HMXH 5IW6A 1SM3L 5T5NG 3F6LA 3S88L 1D6VL 4YHNB 4MD5A 5D7JC 4JFYA 1C7TA 1MIML 3O3DA 4LHUG 2NY5C 4NQUA 3MRRA 5JQ6L 2QQKL 1WEJL 4ALAL 5BV7H 3VXSD 2VABA 2I9TB 3I6LE 3O8XB 3TWCL 1KTKE 4MZ3A 4WI4A 4KVNH 2R0KL 1R3HA 1TVHA 3QDGA 1OTSD 4I3RH 2O5XH 2UV3A 1YYML 5ETUA 2FX9H 3CZFA 4PBVC 3RJDA 4YC2C 4GRWE 2DLEA 4H0HB 4Q9BA 4DUWA 3QHFL 2Q7YB 3EOAA 4KRMB 3SE4C 3BZ4B 1N7ML 1CGYA 5D7SL 4P9MH 4NNYB 4HH8A 2DDQL 3PNWA 1KIPB 4I5BB 1YEFL 1R3LA 1IAOA 2V9TA 2LU3A 3VRLF 3L5WA 5C86A 4XPAL 2HJKA 5I74B 1J87A 2XA3A 5IB2A 2Q87A 3SN6N 1JWMB 1EFQA 4QRQA 2Q6WA 1DEEA 3PGDA 1NGWA 3QEQD 3ARDA 1JNNL 3QJFA 3RUGE 3F7PC 4TN9A 5ESQB 3OKNB 4HF5L 3VFMB 3VE0B 4BSJA 5F88B 1FVDA 4BSWA 3K2UL 1GIGL 3R0MA 4ELMF 1MCCA 4S1RH 1XF1A 1BX2A 3FAWA 3MJ7A 1BOGA 4M5YL 4WW1B 4P2QE 4YWGH 4U1GC 4JB9L 3GSOB 3TBYB 2D31B 4NDMA 1IGCH 4ODSL 4ZD3L 5JA8B 4XWGL 4KHXL 4OCLC 4XH2A 3IDGA 1GZQB 1NGZB 3MSPA 2X1OA 4L1DA 3EZJB 4H8WL 3WS3A 4P46C 1CZ8L 2OM5A 3DX7A 1HWGB 5BMFH 1MI5E 4QTHB 5IVZA 3ISWA 3L3JA 2JB5H 5HGBA 3S8WA 4PGBA 2VXQL 2R4RH 3B5TA 4MXVF 1OB1A 2VQUA 1S7RA 3TNMA 4GMSL 2A0LD 5E00B 5HPMB 2C4FT 4NKIH 1S7TA 2KL6A 3QUZA 4APQD 3BEWA 1E4XL 1J1PL 4YHPB 1BFVL 2XTJD 1CFQA 3BN9D 2EH8L 3PHSA 4PJXE 5DEFA 4EIZC 1D5MB 1G9ML 3G9AB 4NHCL 1RZ7H 2R29H 2F8VA 4YBHA 2XKNB 4O4YH 3P9MA 5LBSH 4NO2A 4JZNA 3FFCE 4CJ1A 4LSDA 1PX4A 4LRNL 5DS8A 1A1NA 2BC4B 2Z8RA 4G8EA 4DN4L 2W0FB 4QF1B 4PRIE 1KGCE 3MLXH 2AV1A 2A77H 3I85A 3P4NB 3GMLA 4NHUB 3NBNA 1XMWA 4X6CB 4JE4B 4HK3N 1MAMH 3O3UN 2BVQA 4FQLL 4JGJA 1M7XA 2CRYA 2FD6L 2FHFA 4M7KH 2Y06L 5DMIL 3O4LA 5JW5B 1F97A 4FQHB 5E2WL 3NOIA 3GJEA 4UOW0 5IMLA 2J8UE 4X7EC 4Q58C 2HTKC 3EYSL 3GBMH 2P5WB 3P4OA 2DL9A 1FV1B 1PG7X 5D70H 3RGVB 4M8VA 5T1LA 1P7QA 3EO9H 4Z7VB 5KW9H 3B9KD 1T2QL 4WRLA 1KB5H 4TVPL 1UYWH 2D03L 2YBRB 3RU8L 4LLQB 3TZVD 5DUPL 1FZJB 3VXPB 2FL5A 4LOUD 1AXTL 3CFBB 3CFJA 4X6DF 4WWKC 1BFOA 4FFYL 5IVXB 2Y7QB 3QXVA 5L88H 4UMGA 1FG2B 3N9GH 1NCBL 1JGEA 4HUUB 1R0AH 3DROB 2Y1VA 2DQJH 2DQTH 4Z6AT 2NX5D 5C1MB 4AQOA 4UINL 4HDIB 3LDBC 1FLTX 4OLUH 1NC4D 2VZTA 2VQ1A 1UB5B 3WLBB 4PP2A 1LQSR 4GAFB 4PGZA 1FPTH 2P8LA 3S4SG 4OJFL 1OP5H 4QWWD 1JFQH 1KCRH 5F7MC 5CLWA 3TO2B 3SJVD 4WCYH 5H35B 4R96B 1RAMA 1HOCA 4L8SC 4WO4D 5JW3H 4F58H 4WI6A 4NC0B 5B3JF 1YPZF 3QNXA 4MHHI 2VLME 1L6XA 1I3VA 3GKZA 1IC7L 1I1CA 5C0IB 4DVBA 1ZTXH 3UBXB 2VXSH 4XP9L 3TNNA 2CDGA 4ZSOA 5IB5A 3PDOB 4RFNC 4NKOB 4X8XA 2QQQA 4JRXB 2Y07H 3MRNA 1IAKB 5GSVB 1NFIB 1S9VB 4KWUA 1B0WA 1P5VA 1T4KB 4FXKB 2R69H 4U1MB 1LO3L 2HKFH 2MSPA 4N0YL 3WL9B 5CEYB 2CKBA 1ZT1A 3HE7A 5SWZA 2GK0B 1QSED 5CJ8A 1W72B 5ITFA 2W0LA 4LSPH 2D7TH 1N6QH 3RX8A 5IMMA 1MJUL 4O58L 5HYEA 3IVKA 3ARPA 4H0IA 1PQZA 4XTRC 4X4XB 5FYKL 3RTQB 3MBXL 4GW1A 1V5JA 2OL3B 2EDFA 4JGUA 4WY7L 3WKML 4BQBA 5KS9A 4M6NH 4OCMC 1F4WH 1BQHG 3FO9A 4YHMH 3MUZ1 3RWIA 3BMVA 3UJIL 5E24E 4O2EB 3UPCA 1T04A 3IJYB 4P4RB 1IILE 1D5IL 3BX7C 2FRGP 3O6FD 1DL7L 4F8TA 5EORL 2QL1A 3ROOA 1HXYB 5LXGL 3SKUD 1KIQA 4NQXA 4ZOEA 5EZIH 3DX8A 1F02I 3DO7B 4FQ2L 3RZCA 2F9BT 1XGTA 1EAPA 3TT1H 3FB5A 3WJJC 1SEQH 3GMMB 5A2IH 3VFWB 4NKMA 3IKCB 4IMKC 3OKDA 4RGNB 3TIEB 1T1YA 4ERSL 3TO4C 4S10A 5FGCB 5DJAA 4PRBA 1QLFB 1I4FA 2BJML 3QDGD 1I7RA 4WENB 5CSZA 2C4FU 3U4EB 3BH9B 1QR1A 4OQTL 3DTXB 1SVZA 3NVQA 4ZYKA 1KOAA 4N1EA 3BGFB 1QSFE 4PFEA 5IF0A 1OAUL 1T80A 4K9EL 4KROD 1VESA 5HGHA 1J5OL 4FTVE 5D7IA 3TPUB 1D5ZA 4LKCB 4NRYA 1TZGL 4Z95L 3VFVB 3QEUA 3VXMA 3OAZK 3IDYC 1T1XB 4GS7C 2OK0H 3PGCB 4ELMA 4HJ0C 4PJEE 1F6LL 2PO6A 8FABA 2VXVL 3ZT6A 43CAA 4DGIL 3RPKA 4L1HA 3ARFA 3ARDD 4KY1L 1A22B 3U46A 4JN1L 4WTZG 3RWDB 3GNML 2CDFB 2AXGA 2DQCH 3WDHA 4DJMA 2V2WA 5HHOE 4ZNCD 4KJQD 1G1CA 1KXQE 3P9WB 1RIVL 1KB9J 1QEWB 2PETA 4X6FB 1CS6A 2N1KA 1OY3B 4F57H 5E1AA 4KXZH 4MAYB 1C5BH 3ULUF 2APFA 5MEOA 1UH3A 2DI7A 4F9LA 4YHZH 3KYNA 1A7NH 4MDIA 4F3FB 4YDKH 1AJ7H 3V6OE 1FP5A 5E2TL 5B8CA 4X83A 3VA2C 2DI8A 1LEIA 3H8NA 35C8H 3MFFA 5J8OA 3V0AC 1INEL 4MCZA 3QUKA 4CN6A 1B6DA 4JFDA 5GS1B 1WQVT 4ENEC 1KYOK 3DV6A 3HUJB 2Z92B 4G6KH 4JFHE 1SJVA 3FT2A 4NN6B 5D2NC 4TRPL 2PXYC 2JELH 4ONGH 2AJVH 1KLGB 3CCHA 2AJZA 1F6AB 3LRHA 1HKFA 3T2NL 4YQXH 3U6RB 4X4YA 3TFKC 1H5BA 3QUZD 3L3HA 3C8HA 2HP4A 5SWQB 4QRRD 1BJ8A 3UTTA 5I8OL 3RPIA 4PJ7B 3V5KA 2B2XL 1MNUL 3QBTB 5CILH 4L8CA 3P0YH 4G8GB 4OLEA 2RGSA 5F7FA 5ENWA 3GO1H 5KSBA 5FOBB 2AV7A 1F11B 2K7PA 2DWEB 5I1EH 4JHZA 2KZ1B 5J4MA 1VFAB 4MX7B 3ULUH 1WBYB 3W39B 2N7BA 2A83B 5DRXA 1AFVL 4MWFB 3OF6A 1BD2A 4KTEL 4GRLC 4K94C 1JZ7A 3W9DB 3CUPA 4X6EB 4EN3A 2F5BH 1RIHH 3MROA 3QA3A 4TULH 3MBEB 1YY8B 4NFDA 3EDDA 3BRGC 2HA1A 5HVGB 5GZOC 3DOSA 3TESA 3WLWC 5FFLA 3MMEA 4S1SL 3X3GL 3IU3A 3O4LD 5C0RH 1LE9B 1QBLH 4ODHL 2ZSVA 4H88H 1OP3H 2NR6C 3DRTA 2R2HB 4W81A 4CNIB 4Z7VF 4Z78A 3QZWB 5TF1H 3UC0H 1S7SA 3SDDA 3A6CH 1CCZA 2AJSL 3SPVA 3TC9A 4QRUA 1T7XA 5BXFB 1Q9LB 2ZUSA 3JUZA 5TE6L 3QXWA 4LSRH 2VZ1A 5FA4A 2Z4QB 4BH8A 4P23C 5C2BH 2R1WA 5T1LD 1P7QD 3CK0L 4TSAH 1DQJB 2NXZD 2VKWA 4XPGL 4Y4KC 1AGCA 2O26U 3BDBA 4ZAKC 4EEEA 1C7SA 2OJEA 3S35X 3OGCA 4JFEB 4WGWB 4OD1H 1FNLA 2GTZA 2QKIA 5IB4B 3BD3A 1I9IH 3ILPA 3GSVA 2EDJA 2QQNL 1U92B 4UILH 1QKZH 3BKCH 4LNRB 1FQ9C 2E6QA 4JN2B 4XXDB 3ARVA 2X09A 5GRUH 5CIPA 2YXFA 2HVKA 3OG6B 1IZJA 1Z2KA 4L9LC 1V7NL 2VR9A 3ALPA 1A1MA 2D7OA 5E2VH 2H1PL 3O6MH 4OGYL 3CH1A 4Z8FL 1EEUA 1LEGA 3CPLB 5J12C 3AVEA 2DOCA 4JLRA 4PJBA 5LWYL 3WN5B 2YSSA 1CGUA 3S6CA 1PKQB 3BKJL 2VLRB 2GAZB 4C4KT 1YQVL 4OLXH 1EFXB 3FOLA 4IS6B 1G7HA 2BMKB 1KCVL 4KC3B 3I75A 4RRPG 2B7DT 1WWWX 3HLAB 2VL4A 3WJLA 4QHNB 2VZSA 4F7CB 3FQTB 2MKLC 2X2YA 5EBWA 2CSPA 3S3JA 3L3KA 1AGEB 4RX4A 2OR8A 4WI3A 5HHPB 1A6WL 1NDMB 4U1JA 2YD6A 4MSWA 1K2DA 4LVNB 4RGMC 1WC7A 3ULUE 3LSOB 5JDSA 4JQVC 1T5XB 3VGDA 3ARUA 1NEUA 3L3IA 5HYQB 2R0ZH 3T0WA 5BOZG 4U33A 2YWYA 5FF6B 3KPNB 3UBXG 3G6JB 3FAXA 3F58L 7CGTA 4CDGC 4K8RH 4RBPH 1XEDA 1H8SA 32C2A 5FA3B 3QUYB 5T1DL 4ODUB 3DETD 3SDAC 1IVLA 1FGVL 4JRYE 2ZCKL 3ARBC 4J8RB 4R0LA 4WUKL 2Y36H 4DGVH 3TYGH 3SO3B 3FN0H 1HSBB 3HE7D 5SWZD 5B4MD 1OF2A 4PTTB 4D8PA 3S5LA 1MCOH 4FFZL 3ETBF 5GGSA 1S7WA 1HQ4B 2XA8H 3LDBB 2IBZX 5ESAA 4P2OB 4LLUB 1W8NA 1XZ0B 4YHNA 4N1HB 1UXWB 1QFWM 5EOCH 3VXRE 4WDIB 4X6CE 1S3KL 4YFDB 1FZMA 1YECL 4P5TB 3IDIA 4B7LA 4R26L 2H3NB 2ADGB 2O5YH 5EULV 1ACYH 2WNGA 3BQUC 3KLSA 3O8XA 5J11C 4FZ8L 4P9HC 1ZOXA 1A6VH 5F8QC 1J88A 3PV7A 3RVTD 5EA0L 4M1CD 3QRGL 3PHOB 4XI5C 5C0DB 1HNGA 3CSPA 4OGXH 3TBWB 5HHMB 4HQQL 5SV3A 5GRXG 2VMFA 3RZCD 3JXAA 5E94B 3UAJC 1U8JA 3NFPA 5D2LE 1MCHA 3WFCH 3S7GA 2WANA 2BFVH 2CJUL 1K8IB 3BZ4A 3MV8B 3EJZC 5E6IA 2UYLB 5IOPA 4GG8A 2X4UB 1NLBL 3KHQA 5HYJB 4EOWH 1LO4H 5IVXE 4XC3H 4HC1A 5E9DE 1IGYB 1WISA 2I07B 2J12B 5TDPA 3MNVB 1OQOA 2MHAB 4WEUD 2GEEA 1Q94B 3K1KC 4LSTH 3V8CA 1IQWH 3FQUA 3A6BH 1OAKL 3OKNA 1WUNT 5FHBL 4UQ2A 3VFMA 1KN2H 5F88A 1NMBL 1FFNA 1IGJA 5F6HI 2CDEB 4OZFB 1ZHKB 3O11A 3P2TA 4WW1A 2A6JB 2ZUQC 3VXMD 4XB8A 2WWMD 3TBYA 2JJTA 2JK5A 4MD4B 1TJIH 3B9AA 4X4ZA 3IS0X 1YNKL 2B39A 2PO6D 2H32H 2CUIA 4RMSA 3PABA 5CP3H 3UTSE 2MWCA 1NGZA 4H26B 3IGAA 3ARFD 5T5FL 4NWUH 4TUJB 2EDNA 1RUAH 1AHWA 2NXYD 2YA2A 3LPGA 4Y19E 3SO5A 1HXMA 3G5ZB 3O2VH 4PLJC 3C09B 4YDVA 3INUH 5AUMA 2WLZA 1NUFA 4DEPB 3FB8B 3DI2B 5I1KH 5F8RC 5H2BB 5KJRH 1PAMA 2RIKA 5IBUG 1XR9B 2ARJB 5ADPH 2AAVA 4ONOA 5E08L 4FZEL 5HBBA 1HKLH 1HYSD 3QJHA 4JHAH 1D5MA 4XGZB 1K6QL 3CC5A 1JHKL 3HUJF 4N0FA 1KENL 2RAMA 3KYMB 4D0CB 2OQJA 2APWA 4XMKH 4QXWA 5C0JB 4JFDD 1INDL 4BSVB 2C1PA 2L7JA 1FO0H 3U0WL 1G1YA 2Z8SA 3NTCL 4NHUA 1MCJA 4LBEA 3SKOA 4PJ7F 4DW2H 1K3ZA 1JNHB 3PHQB 1VCAA 2EKSB 2NY5H 5C8JA 4QRSB 5DUBB 4B5EA 4GAJH 5LQBH 3FONB 4YXKH 2HLFD 4OCWL 3KHOA 5F7EL 2W59A 1II4E 2P24B 4FQHA 4X9IA 5MI0B 4G7VH 2DTMH 3O2WL 5FM5O 1RIUH 5JA9A 3UTTD 3VDAA 1BBDL 3C08L 4D0DB 2P5WA 1J7VR 3AUVA 1FV1A 2MCPH 1EBPA 4QHUA 1VFBB 1MCPL 3RGVA 1ITBB 3OAUH 1OVZA 4GXUM 2KZWA 2YK1H 4D0BB 3G6DH 3OF6D 4K23H 1BD2D 4CVXA 3RVXD 4EN3D 2W07A 5T3XL 3LEYH 1FZJA 3PDDA 4YHIB 5IJVB 1EBAA 4U6YA 1A6UL 4GAGH 5DJ0A 3CFBA 5FGCE 1ADQL 2Y7QA 3HC4H 3LY6A 3C2AH 5I30L 4MAUL 2FLBT 2QJDA 3EGSA 5B39A 1F13A 1BVLB 3DROA 4JANB 3LKQB 2EE3A 1NH6A 3VD5A 3SDDD 1CT8B 1BF8A 2ZUUA 2PKDA 4FABH 1IM9A 4HDIA 4UV4H 4CU8A 2YRZA 3BO8A 2IANB 5D1XC 1L7TH 4OZGB 1YYLL 1NGYA 4PLKC 2I5YL 3KWWB 1FFQA 4JO2H 4DAGL 2NY7L 2IFFH 4NCDA 1RZGB 2EH7H 5IK3B 1U3YA 1J1XL 5D1QB 4FQQB 1YEHH 1FJ1B 1H15B 1H3GA 4OF6A 4JR9L 4MA8L 4R8WL 1EXUA 5K9JH 1MHEB 4UT7L 1TCMA 2EDQA 3FO1A 5AD0B 1IGFH 1JUFB 4HHAA 4M7JL 4Z7QE 1IEBB 3KPRB 2AK4B 1F90H 4QHMA 4U7KA 5C0IA 3UX9B 1YUHA 5E0QA 2Q8AH 4K3JL 2FECI 3SDYH 4OLZL 4JRXA 1BGXL 2EKJA 3VXUE 1CFVH 5GSVA 2F8OA 4Y5YB 3IAPA 4HKXB 5T3XD 1B4JL 3HNTL 1INQB 2PYEA 2HFEB 4JG1L 2VXUH 1CDYA 5E5UB 5DHVB 1NJ9B 3L7EB 3VFSB 1EJ6A 3S34L 5K59F 1QFWH 4OZIB 3G6JF 1WF5A 4RX4D 4PJGB 1TTGA 3SQOH 3RTQA 4X4XA 3MNWA 1CICB 3SOBH 4WV1B 2OL3A 2NNAA 5IIEA 3K4ZA 3VFRA 3P73B 5FB8A 1RFDL 3AS3A 3D39B 4DQOH 3W81A 3AXLB 4KKCD 1P5UA 4LPXA 4NM8L 3HZKB 3QQ4A 4Q0XL 1C08B 3FQNB 4P4RA 3DUUB 4IHOB 3QQ9D 5ICZB 3VH8G 4GH7B 4PJ7E 4OM0L 5ILTL 1XIWA 3SDXE 1HXYA 1QLEH 1JZ3A 5KANI 3V5DB 4G8GE 3HMWL 4X80H 4NKQB 4XMPH 3FZUD 2DI9A 4YUEH 4AM0A 4BH7A 1RK0B 3HNVH 1OTTD 1AR1D 3HC3L 4WNQA 3CMOH 3QDJE 5DMJB 1CD0A 1AE6H 3MRLA 4XVUC 3GSNB 3TVMB 1ND0A 3LEVL 2XICA 3B5GA 4YH6A 2RR3A 4KK5D 1OSPL 1MCWM 3CDYA 3U30B 3MLRH 2PYFA 1MFDH 3OXSB 1BVKB 5ISZB 5FUZL 1ZEAL 3RHWK 4H20L 3O8XD 1CLOL 4KK6C 3K3QA 1MWAL 1QLFA 3TBTB 1L4IA 1K4DB 4POYA 5J0BA 1U41A 3DVIA 2WINA 1LO2H 3AREB 3D5OF 2Z31B 3EYQD 4YPGB 4GW4B 3O3EA 1J18A 2ZG3A 4RGOL 4UTAL 3C5SA 3CX5K 5ICXB 3D9AH 1XF3B 3VD7A 2YD9A 4LMQE 4RAUB 3T77A 4Q97A 1I8IA 1QACA 1TZHB 1F3RB 1HDMA 2BNRA 2CQVA 2GW5A 3N1QC 5BVPL 3SEPA 2IALB 3VFVA 1ERNA 4JPKH 5E6ID 3O0RL 3IETB 4MLSA 5IKCA 2YZ1A 4K2UL 3JTTB 2Q8BL 1D5BB 1MFNA 2DMCA 3PGCA 3WKNA 1OCWH 2LU7A 1LNUB 3WUWA 5EC2A 2ATPB 4CKVX 1G7LA 1XGQB 1OGAB 1FORH 5F70A 4WFHE 5E8DL 1MJ7L 4PRPB 4F33B 4U1KB 1LP9E 5HVWA 5TPWH 1NAMA 5FCUH 1RJZB 1S7UA 4WI5A 4WU7A 3RWDA 1JRHI 5LGHH 3TN0A 3NPSB 3D0VB 3U48A 4WFGE 1OP5K 3MC0A 1J1OH 3P9LA 3L5XH 2IPUK 1PKQE 5DC0A 1N5AA 1CLZL 1NBZA 3D85A 5DQDL 4X6FA 3BE1H 1I1YB 3LRSB 4YDLC 2Q86B 5J6HB 3FO2A 1KTRL 4Y4FB 3SE3C 4AT6A 3IS1X 4IOIB 4RFOL 1QOKA 1YC8A 4QXTB 5FHAL 3ARQA 2FJHB 4I77H 4ZS7H 1X5ZA 3BIKB 4KKAD 5JW4R 4NQEE 3GBNH 5EO1A 5JXEC 4M9PA 1S5HA 5F9WC 5GS1A 1HN1A 4KDVA 3RVWC 1M71A 2CH8A 4GQ9L 5L2KE 5L2JA 4M93C 5KVFL 4MB5A 3BSZL 4HFUH 2ERJC 3Q6GL 4ISVA 4N8CH 2P5EA 4HK0B 1QUNA 3GMNA 3OXRB 4HUWA 3MJ9A 4O00A 4L3EB 1A9BA 1S8DB 1GL4B 4R2GC 4RIRB 4WHDA 3QB7C 4L5FH 3RDTB 5F21B 4JY6B 2FSEB 1J9CT 2G9HB 2V5RA 3NA9L 4HUKB 3LQAC 1PFCA 4OCXH 4TYUA 3TCXA 4PD4K 4OFKA 1I7ZA 3MRQB 2WQRA 5FOBA 1G7PB 4YJZL 3PL6A 1JGLH 1DUYA 2ICWJ 5GS2H 1WBYA 1KPUA 4LLWA 2E8ZA 3EFFB 5HGAA 4X6EA 5I1IH 1FZOA 1N64L 3MBEA 1E28B 3CNKA 1EMTL 4E42B 3HFML 3PGFH 4R3SB 5DSCA 4ODTL 4X7TA 3SKJL 4Z7NF 4GBXC 4AEFA 2YRPA 4J6RL 4O02L 1LE9A 1VGEL 3BP4B 5IR1B 4RFEA 4KJYB 2J1KA 4DUXA 4ZS6C 1QSVA 1UACH 2B4CC 2P5WD 4N9GA 5BXFA 3HE6B 4DCQB 2DBLH 3QWOA 1CFBA 1H8NA 3RGVD 5BOPA 2J6EA 4PGDB 1YEEH 2BY3A 3KPMA 1U8IA 1IC4H 4FMKA 1MFAL 1EUUA 1GXEA 1FE8L 1NCWH 3VJ6A 4LHQB 2VIRB 3O41A 5IB4A 5D71H 4CVZB 1T03H 4FOMA 5HYJE 2GTWB 1O7SA 4LNRA 4JN2A 4OLYH 4XXDA 5DO2C 3RKDD 4Z18A 2JIXB 3R0NA 6FABH 2BDNL 1MHPH 3GRWH 2ESVE 2HAZA 2R2BB 1RURH 3B3IA 4OZGF 5CAYB 4QXUH 1PY4A 5FEBA 1MIEH 4M43L 3U79A 3EYVA 4OF7A 1B0RB 4X98A 3RKPA 3EFDH 2NCMA 3G04A 1IM9D 1H3