3MMEA

Structure and functional dissection of pg16, an antibody with broad and potent neutralization of hiv-1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
237
structure length
235
Chain Sequence
b'QEQLVESGGGVVQPGGSLRLSCLASGFTFHKYGMHWVRQAPGKGLEWVALISDDGMRKYHSDSMWGRVTISRDNSKNTLYLQFSSLKVEDTAMFFCAREAGGPIWHDDVKYYDFNDGYYNYHYMDVWGKGTTVTVSSASTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PG16 HEAVY CHAIN FAB
publication title Crystal structure of PG16 and chimeric dissection with somatically related PG9: structure-function analysis of two quaternary-specific antibodies that effectively neutralize HIV-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 235
sequence length 237
chains with identical sequence C, H
ec nomenclature
pdb deposition date 2010-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mmeA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mmeA01
2XICA 4NBYB 5JDSB 3HMXH 1G9NH 4U1MA 2Q7YA 2GTWB 3LKOA 1HHHB 2BY2A 1U8OB 3P73A 4YGAB 3MJ7B 4YHYC 3HPJB 1D5IH 2IPUK 5E94A 5ID1B 2AXJA 3MTRA 5GS1C 1WSST 3VXRE 2JB6B 5F6IC 4ZMAT 2VXSL 4X6CB 2P49B 3MUGB 3DECA 1YEDA 3TCLA 1P7HL 1RHHA 5KOVC 1TJHL 2CUIA 3G9AB 3TP4A 2EIBA 5I66B 4HT1H 5FOBA 4Z77A 4Z18A 1CGSH 5KVGH 2P5WB 3E8UL 4JHAH 2DWDB 3ZYJA 3O4LE 4JE4B 4DK6A 5HHVL 2APBA 4Q9RL 4XCNB 2R2EB 5HHOD 2FB4H 1HH9A 4PJXB 5IBTH 5CD3A 5GXBB 2DN7A 4MCZB 5FOJA 1E4XI 1EDQA 3I02A 3MLXH 5D7IA 3DX7B 4HKJA 2BC4B 1G1YA 4NQSA 1RZ8B 3NTCH 3UTZB 5HVFB 4CN6A 3BRFA 1R0AH 1IGCL 4OZHA 2KQNA 4WJ5B 3X11B 4A6YB 3KPLA 1OTTD 5I1AA 1V3LA 3T0AA 4GRLC 2JJSC 1UKTA 1XGQB 4OQTH 1DE4A 3FQWB 5GJTH 3KPRE 1LWRA 3QDGB 4MCYA 3FFCB 3G6JF 3JXAA 3BX7C 1VA9A 1WBXA 4LSPH 3DURB 4WWKB 4APQB 1U58A 3V7AE 2E27L 4P5KB 3SE8H 2MTPA 2M8XA 1MHPH 3VXSD 4GQ9H 3TWCH 4PJFF 4NWUH 3RUGF 1Y18A 3C5ZC 1TZHB 3SEPA 2W9LA 2AEWA 4JPVH 3T65B 2XXMB 2W0FA 4FTVA 2OM5A 1OAUH 4HEME 1CG9A 5C0CB 5J1AB 5LG1A 3AFLA 4GG6E 2Y1VA 3VXMD 2F8VA 2NX5B 3BAEH 1S5IH 3EGSB 3SGEI 4OUUA 2V2TB 1G1CA 4LARL 2PW1A 1T1WB 5T3ZL 2CMRL 1H3PL 2OXGA 4PREA 1RZKC 4TTDC 4Z7VA 3BKJL 4NKOA 3IU4L 1B0GB 5F7YC 4YHPB 4PJAB 4QRQA 25C8L 4L9LA 3L3OA 5CS7A 4G6FB 4F37K 4FQHB 3N1FC 4WENB 1K8DA 2V9QA 3B5GA 3ROLA 4MAYC 1LP9A 1YYMH 5IFHH 2D2OA 4Y5VA 2O26U 4ODXB 4M7LT 1WZ1H 3BISA 3D25A 4MJ5B 2OR9H 4Y1AB 3B3IA 5CZXD 5L2JA 3HI6H 3V8CA 3SGJA 4F2MA 2DLIA 3MLWL 1DP0A 3ZT6A 2BJMH 4UDTA 4ZUSA 1ZSDB 4KRPB 3E3QE 1DEDA 3LIZL 4JO1H 4QHLA 4DAGL 3RBSA 1GOHA 3LPGA 3W5MA 2F54E 4H8WC 1D5MB 5F44A 5IJKA 4X9FA 2NXYC 3E3QC 4MB5A 3EDKA 4X4ZA 1C12B 1A7OL 4Q6YA 3QFDA 1NCDL 1RFDH 4PJ7B 3WS6C 3QIBA 1EH9A 4OF8A 2RFXB 5HHNA 5E9DB 5JZ7C 1IC7L 3P4OA 4BH7A 4POZD 3DV6B 2BSED 1VB9A 4PJHB 4JHWL 1JE6A 4W81A 1I3GH 1ACYL 4NZTL 4U6VL 5KS9E 2ZCKH 1XF4A 4H1LA 3VXTB 5C9KA 3BO8A 2GT9B 4XX1E 4YBQC 3ZE1F 3LY6A 5DD1L 4Q7DA 2FBJH 1MIML 3VFRB 1SJXA 3Q1SL 2I9LA 4PGZA 1T2JA 5EUOB 1L0YA 1WCBA 1XR9A 3WHXA 1NLBH 5KVMC 3HE7B 4ORZC 3HAEH 1AR1C 3G5YB 1UVQB 2VOTA 4GMSH 1CQYA 3IRZA 4LCWD 2Q76A 3TH4T 4DZBB 3GSNB 4QKXB 4NO3B 1FCGA 1CL7I 3FCTA 3DMMD 1EGJH 4XP4L 1KNOA 3ZDZE 4DN3L 3VFGH 1H3WM 1GZPA 4TSCH 5FEBA 4Y2DC 5T5NF 3D39E 4NQVB 4ZO9A 5F89A 5IFJB 4J8RB 3H8NA 4DFIA 1LO2L 5K93A 2X40A 4KHTH 3MCKA 3GI9H 3TM6A 4OTXL 5GRVL 2BSSB 4PJ5A 4ZSOE 4JGJA 3HZMB 4K71C 3EIFA 3AS3A 5E2WH 5CGTA 1I7TA 1VACA 5JIKA 5HI4D 4XWOC 2W9EH 5KSAB 4MA1C 3U4BL 2XNAA 3BYYA 4MXVF 5D1QC 2I07B 2X89D 3OKNB 5ENWA 2FR4B 3THMH 2CLZB 3QSKB 1KJ2B 4TSBL 5HYIA 2R9HC 3DROA 5CJ5A 2X1QA 1LE9A 4G43A 5I1KH 2I27N 3BWAB 1FCCA 4FQLL 1RZJH 3BZEB 4OLEA 1T7VA 4MS8D 3UJTL 2DKSA 4P2CG 5D6CB 4PRHB 1A14H 2F8XC 1MWAA 3BE1H 3E6FA 3HFML 4OCRH 4JLRB 4L8BB 1Z9LA 3VI4E 5C2BL 1A1NB 3LQMA 2P1YA 3D5OF 4FZEL 2QADB 1A21A 5I15H 5E5UB 3TVMC 1S3KH 1MREH 5HD8C 4E9LA 1F58H 3MNZA 5KZCB 1HQ4A 3OAUL 4WI9A 4OCXH 4UILH 4GW4A 1NL0H 2VLJA 3M8OL 2GTZA 2P8MB 4EIZC 1BLNB 2BCKA 3MFFB 1MVFA 5DQ9A 4ZAKD 1G9ML 3EJZD 1FYTE 2R0KL 3GHEH 4U6HB 5CBAA 2ZPKH 5EU6B 1GIGL 3PNWA 3TT3L 2DRUA 4Q9BA 3SO5A 4EVNB 3RX7A 3WFBL 3BKMH 3SDYH 3GSRA 4L3CB 4NJ9H 1AFVL 3SKMA 5DK2B 5C0IB 1I1AD 5DRZA 3TA3D 4W6XB 3O2WL 4PLJC 3RVWC 1JYWA 3T1WA 4AMKL 3JUYA 2AGJL 4G8GA 5D1XB 3QNZB 6CGTA 4B50A 4LHUB 1FC2D 5BZWA 2XN9D 3WJJA 2QLVB 1TJIH 4K3HA 3VXRB 3LEXB 4L1HA 3L95B 2V2XB 4YFLF 3IF1B 1YN6A 1FL3B 3O6LH 2VLRA 4OLUH 3STBA 3EO0B 4KMLB 1XIWD 1X4XA 5JUEL 1INDH 1NCCL 5D93B 4J3TA 5DMYA 1UADC 4FMFA 3B9DA 5F21B 4NKQB 4P2OD 4Z95L 1VDGA 3VG0H 3EFFA 1G6VK 5GHWL 3OJ2C 5C0BB 2YMXL 1KCLA 2DICA 2Z92A 5GGRA 1JHTA 1YPZE 3HN3A 1AI1H 4JG1L 2BMKA 4OSUH 2C3VA 1JZ6A 1C5CH 3UTPD 3PP4L 2CKBA 2PCPA 1G6RH 1CICC 5BCAA 3IFLL 2X70B 3OKOA 4JO3H 4JVWA 1J88A 4MNQD 5KTEL 5FYLD 1IQDB 4A2LA 4IOIB 4WI3A 2HJKA 4AH2B 2Z91B 5IW3A 4PG9A 2HJLB 4LLDA 4N8CH 5D7IF 5ESAA 4Y0GA 2A38A 4RFOH 4Y7MA 4OZHF 4P2RE 3MV8A 1AKJB 5SWSE 4RIRA 5IWLC 1S7XA 5FB8B 1A7PL 1IC5H 4HZAA 1SHMA 5IT2L 3IJYB 2F9BT 4ZFOA 3D0LB 1JN6B 4LEOA 2ORBH 4G6ML 2R4SL 3V5DA 4F7EB 4X6DB 2NYYC 4LLVB 4YXHL 2NW2B 5A2LH 4WGWB 4GG6B 4WTWA 4Z5RA 1GOFA 4OZGE 1FN4A 3O6MH 5E8PA 4L29B 3MUZ1 1TZGH 4M6MH 5F9OL 4O58L 2XACC 3MLPA 4QRSB 5IB2A 2XZAL 4U1IB 4QRPE 1DANT 4K23L 4PJ9B 3T0DA 3TYFB 1IARB 2ITCB 5EO0A 3TBWA 4U1JA 3GBML 5AYUH 3M17A 3ULVD 2RJMA 3S34L 4GJTB 1OSZB 2Q3AA 4H20L 4I77H 4M7LL 5T33H 4TOYH 1F3RB 5E8DH 4TUJB 5BS0D 1VGEL 5DQDH 5L7XH 5F7EH 4HKZA 1QKZH 4OLWH 2HTLC 1XF2A 1FNAA 4WUUD 3D9AL 1E27B 1H5BA 3QUYA 1NCNA 4UINL 1NGWB 3TFKC 2A6JB 4RAHA 2LAAA 3W0WD 1ONQB 2J6EH 1DSFL 4Z7VF 3QNYB 3D3VD 1P7QD 3L5WB 3QA3B 4NT6A 4X6EB 1B4JL 5SV3A 1CLZL 4H26A 3MUJA 5B39A 4PJGA 2F54B 2EECA 5HHOB 4I1NB 2Q20A 1CDGA 3T3PE 1Q8MA 4HFUH 1LP9F 4U1LB 4GH7B 4HK3J 2WBWB 3W5NA 4J6RH 2A6DB 1DBAH 3IAPA 3MNWA 1IEBB 1CVSC 3PGCB 4GKSB 4JY5L 4OFKA 1AC6A 1BP3B 3KGRA 1W8OA 3FO2B 4QNPF 5B8CC 2NY0C 5DD5L 4L8DB 5CEZH 1A6AA 2O5ZL 1BF2A 1T66C 5BQ7B 3P4NB 2YPKB 3UJIL 4E5XB 2BRQA 5C7XL 4K8RH 4X4XA 3TNMA 3SDXB 1Z9SA 3VXNA 1JGDA 1EVUA 3MBEA 1AO7E 4XPAL 1QYGH 4P46D 2BVOB 2C9AA 3MLZH 1BBDL 2NY3D 2HLFD 4PBWD 2QQQA 2IAND 1IILE 4JZJB 3VXSB 4HS6B 1MFEL 2MHAA 1DFBL 4K3GA 4OFYA 5ID0A 4MHHI 4PJ8A 3KXFE 1DQLL 3I2CH 3BW9A 5ADOL 1YQ2A 2GIYA 3FAXA 3B8YA 2ZWLT 3ARBA 4ODBD 4ETYA 2XWTA 2FIRT 3S37H 4LCUA 2M2DA 5FKAA 1T1ZB 3DUUA 1C5DB 3TBVB 1D5XA 3VFOA 1DUYB 3VXMB 3BUTA 3JWOL 1Q1JH 3RDTA 5BRZE 1JTPA 1S9WA 1XGPB 1IBGL 4F33B 2OP4L 4PGEA 4M6AA 1MFBH 3OJDA 4PRBB 1KEMH 4EN3C 3W39A 4EDXA 5IW1B 1WQVT 1BQLL 2E6JA 4AG4H 1NBQA 3OAYK 1UQSA 2QR0A 4XWGL 4ZFZB 1I85A 1N0XL 2CGRL 3T0EE 32C2B 2IGFL 4HJGB 1LEKB 4O4YL 1KN4L 1UWEH 1U8PB 4FQXA 5EOQH 4NUGL 1DVFC 4KTEL 1E4XH 4LSRL 3T0EC 4GAFB 2J8UE 2J8HA 4JJ5B 5DC0A 5HGBB 3W9DA 1BZ9A 1LDPH 2Q86B 1S9XB 4NM8H 4QYOB 3T0VA 3B2UC 1FJ1A 3U6RA 4KTDH 4ALAL 2FATH 1RHFA 3FRUB 1GHFL 3CFKA 1IE5A 3WDIA 5HJ3A 2WUCL 3EOAA 1I1RA 3GSXB 5FGRA 3G5XA 3QIUC 4U2YA 5DURD 4YDVB 1UZ8B 4F80A 1Q0YH 1RIVH 5ALBH 1KCRH 4R4NC 1GZQB 3SO3B 1J9CT 3WLWC 4I4WA 3KJ6L 1X7QA 5ANMA 3V95A 3KLHD 2BNQA 2VXTH 1NMCB 2MCPL 4KC3B 3EFDL 4LF3B 3AU1A 1DUZA 5FA4B 2IMMA 3P9MB 5DSCB 2DMKA 1KLFA 4LHUG 1HHKB 3WJLA 4YGVB 4NQED 4KAQH 5KVDH 3RX5A 2H2SD 5HHQB 1DQJA 5ICZB 2OTUB 2R0LL 5INDA 4Y4HA 5JA8B 1F4HA 4ONHB 3LMJH 4LCWB 4LP4A 2IPKA 3FOMB 1IVLA 3D85D 4LPUA 3T8XB 3DMMB 3D69B 4PBXA 5DXWA 3ILPA 3IRPX 3SCMA 3VI3E 2CDEA 3UTQA 3SKOA 3P30L 1TDQA 3L3DB 3OXSB 3QI9A 2UZIH 5FGCE 3UC0L 4YPGB 1AC0A 3H3PH 4KKAD 1S7SA 4ZOBA 4Q6IC 2AJSH 4LRIA 1RZGA 3RAJL 5BJTB 5TDNB 3BEWA 3IFOB 1HQRA 1FG2A 1KTDA 1CFSA 2NXZD 1I9JL 5IB4B 4DEPC 5HHXL 1H0DA 4FNLL 5MHSE 1CTOA 3RVVD 12E8L 4H1LH 2NR6D 4XB8A 1OLZA 1EFXA 5EFIA 5AYQA 4PRDA 5MP6L 1ZVHA 1A7RH 1RMFL 4ZTOL 5DO2D 1MQ8A 1MI5D 2H26A 3N9GL 5A40E 5T3ZE 1AJ7H 1TTFA 3QXDB 1D6EA 3P9LA 2KDGA 5CSGA 1C1EH 4WFED 1YPZB 3O9WD 3PL6D 3ZKXB 2YPLE 2DIJA 3F7VB 4U4BA 5E4EB 3T09A 2GK0B 1MJJB 3O3AA 3MOQA 4RFNB 1NAKH 3MREB 5F9JA 3C87A 4BK4A 1MF2L 4UOW1 1KYOJ 1XZ0A 5F7DA 3ROOB 3I6LE 4P2QE 5TDOB 2BNUA 1NBZA 4LRNH 4JZOA 5BO1H 2ARJA 1WC7A 3L5IA 1NUNB 4OB5L 4FFVC 4OIIH 2ZUQC 3KVQA 2R1WB 1ITCA 2BVPB 1NEZB 3LSOB 5KAQG 3BP5B 1CU4H 15C8L 4I5BA 5DT1L 3BDYH 5TQ0L 1NFIB 4PB9L 2DQEL 1OD7A 4C59B 2P43B 5ESVB 1DZBA 4KXZH 2XKNA 4ZAKB 5DYOB 1WISA 4IRSC 5C08E 4S1RH 3S4SA 2KKQA 5EB9A 5JW3L 1OL0A 3F58H 4WU5A 3AY4C 1DQQB 4U7SA 3QO1A 2ZOKB 1I1AB 1TIUA 4G6KH 4XAWH 3KYMA 3TA3B 1MHEA 3PV6A 3LKRB 4QRRA 1FIGL 1J0JA 2YSSA 3IFNL 1V7NH 4NFCA 1YEHH 2XN9B 1AXTL 1YEKL 1T04A 4P3CH 5IMKB 4H25B 2C1PB 2CDFB 3EYFB 5CLWA 1DLFH 1MWAH 2R69H 2MMXA 1PG7X 1I9IL 1XIWB 4DGVL 3D0VA 5BZDB 3MYJB 2G75B 2R1XA 5D1ZC 4AIZA 1LO5B 4NFDA 4JQVC 2QHRL 4NQDE 4ZPTA 5DGRA 4P2OB 5IQ9B 1S8DB 1JZ4A 4NZRL 4KHXL 2AEIT 3CZFB 2CLRA 4WCYL 2ZZUT 3U7WL 3F6IA 3WE6B 3B9KB 2R0WL 3NN8B 3QH3A 4ESKA 1UM5H 5D6DA 1J8HA 2XWJA 5KG9B 4D9RD 1MCFA 3MGOA 1P1ZB 5FUOH 4PJGF 5DK3A 4AL8L 4GRWE 4PY7A 3WXVH 1QVOB 4HIXH 4UNVA 4MNQB 5J6HB 1JNHA 4AEIL 2DAVA 2V7HA 3WFEL 2VXUL 5KJRL 1HOCA 3IFPB 4BSWA 3X3FH 3T4AB 5EIQA 4JO4L 2BERA 4EDWH 5I1GL 1IGFL 4LP5A 3MRCB 4IS6A 5D72H 4P9MH 5TF1L 4KDTA 3GB7A 4QLRA 1CE6B 4Y4KA 5K9OA 1HEZA 4WEBL 2YD7A 4MQ7A 3PP3K 1MFAH 1AHWC 1YY8A 1OSPL 4WI8A 5DUPL 2PNDA 3QXWA 2AV7B 4LLYA 1INQA 3ARFC 2ZJSH 4ODWB 4EN3B 3QUXC 2AJYH 5ELIA 3BFOA 3F62A 4K3JL 4LQFL 3FZUD 4HLZH 1JRHH 2B5IC 2ZOLB 1KJMB 3KS0J 4CVZA 3S35L 2CKBH 3B9AA 5E2VL 4M5YH 4YLQT 5BS0B 2E9BA 5JR1L 4J3VA 2IFFH 1DVFB 3MRLB 1IAOB 4HIIB 5EA0L 3LKQB 1N7ML 1T83A 1YMHB 4TVPH 5BVPL 2R23A 4JRXE 5C9JB 5ITFA 2IQ9L 4KJQD 4D0BB 2JCCF 3W0WB 4GBXA 4YDKL 5IROA 1TVBB 1TVDA 1ZT1A 1G9MC 2R2CA 1T0MB 3M1BA 3D3VB 1P7QB 3PDOA 3MRDB 3IJHA 4RBPK 3HMXL 4M6NH 4ELMB 1G9NL 1T89A 2NY2D 1LK2B 3BESR 4DGIH 3OXRA 1BMGA 4FXGA 3HZKA 1X5KA 1FFNA 3R8BB 4JFFE 4ZS6D 1H8OA 5JHDD 1KCUH 2VLMD 2EXWC 2BSRA 2X4PB 4OLYH 3GMMB 2EE2A 2YKLH 3CX5J 2HT2C 1LMKA 3MRNB 2FL5B 4HT1L 4JAMA 1FAKT 5KVGL 3NGBC 4JHAL 3ALWA 5DJDB 4FA8A 1ITBB 5CJOH 2R0ZL 3ILQD 1UWXK 3FB8B 2FB4L 5D7JA 1R24B 5E1AB 3Q3GB 4P46B 3IB4A 3NCJH 4MA3A 3TN0C 3ECBA 2IANB 5DGQA 2ZP0T 3CFEB 3R1GH 1YNKH 1HDMA 3NTCL 5GGUB 3QUZB 4MNHB 1TETL 1R0AL 5SWQB 4YDIH 4L4TE 5IMMA 1UJTA 4OQTL 4LPXA 2AK1H 1ACZA 3U36A 1KTLB 1R3KB 5GJTL 1OQOA 5C0GB 4NN7C 1KIQB 2P48B 5F7FA 3PHSA 4QHNB 2ICWI 3MV7A 1FNEA 5H8DA 5B3JE 3EYSH 5MENA 4CVXA 3VXUA 4PJDA 5BMFH 2E7LA 1X44A 2P5ED 2Z4QB 3SHSA 4ZUWA 3SE8L 1R3JA 4D8PB 1MHPL 4G7VH 1M05A 2V5SA 3TWCL 3UTSE 1CD1A 1E6JH 3I85A 2DWEB 1CK0H 1Z5LB 3VXOA 2FO1A 5E6YA 1JWSB 2ICEB 4FQ2L 1RUMH 2ICWA 4FXKA 3NABH 1WF5A 3J7HA 3BAEL 5C71A 1WT5C 3O11B 1F2QA 4R0LB 3QFJA 4HG4J 1J1OH 3HRZA 1IAKB 1P6AB 4GLRI 2HWZH 3OAZK 4M4RA 1OAZH 3VWJA 1GC1C 3GJFB 3AAZB 5GGVY 5HPMB 1JF6A 1M7IA 4WFFE 3CFDB 3L7EB 4PRAA 4YNYB 5CKGA 2VDPH 5IW6B 1NEZG 4XHJC 4WV1C 2OL3A 3E2HB 1ULVA 5D2NE 4KJPD 1YYML 4DCQA 1G7MA 4WFGE 3V4UL 3IDNB 3L7FA 5D2NC 4RISL 3HI6L 5D8JH 5DURB 1J11A 3WUWA 2J8OA 2GJZA 5EZOH 2BJML 3DVGA 4P99A 3G5VB 1S7RA 1DQML 2F74A 4NOBA 1KN2L 1CD8A 3CSYB 4JO1L 2NTSP 1UCTA 3B5HA 4K3DH 3E6HA 3WO4C 4P23A 1JK8B 2Y6SD 4U7KA 4Z8FH 1A2YB 3MXVH 1NC4D 5AWNH 1QFHA 1JPSH 2ATKA 1FSKB 4JFHD 1RFDL 2D7QA 3K2MC 1MFCL 5LXGH 4XZUB 4PRPA 1BBJB 5CINH 5IMLB 3BXNB 1FO0L 4UT6H 1HYSD 2ZCKL 4KY1H 3DV4A 3D85B 2Y9RT 3JTSB 4PLKC 1KT2B 2ED8A 1YN7B 2F53A 2VN7A 3CMGA 3SBWA 1ZANH 4GRMB 2UY6A 2FBJL 5ESQB 3U0PA 5DC9B 2BOCA 2W1NA 4LAQH 3WKNA 2X1OA 3NCMA 5I0DA 1FNGB 5T1DL 4U6YA 4DZ8B 4FQ1L 4I0PD 1X5GA 1NLBL 5F9AC 3GMNA 4N68A 1EEYA 2D0HA 3LEVH 3IU3B 4MJID 3EDJA 2NXZB 1IJ9A 2VR9A 2EC8A 4R96A 1RIHH 4GMSL 1T5XB 3V0WH 1LNUB 4I3SH 3MUY1 4E41A 4XNQA 1K6QH 1OWRM 1EGJL 1QSEE 1AXSB 2C3XA 5D2LA 5TFSL 3P4MA 2GITB 1NPUA 2ID5A 1AE6L 2BNRD 4TSCL 2PYED 1MI5B 2IALB 2MFNA 1KB5A 3HS0A 1XGUB 3FJTA 5IG7A 1F42A 3QCVL 4R2GD 1ZXQA 4JFDA 3O9WB 3OX8A 3PL6B 1U92A 3GI9L 4IMLB 3GSUB 3U2SA 3PWLB 5ACMA 3QEUB 4L3EA 3FO9B 4WHCA 3UYPA 2FJGB 1NGXA 4KFZC 5I75B 1VADB 4O2EA 4CJ0A 5E2WL 4V1DE 4OKVB 1JNLH 1Q9WA 3T2OA 4JFEA 2OJEB 3SY0B 1JP5A 4JDZB 1SEBA 2PO6C 1GGTA 3H9YA 2O61B 4HDIA 2AJVH 5JDJA 2ADFH 1A5FH 4GG8A 3OJVC 1PSKL 4NNYB 1I7UB 3MGTB 4OQ1A 4Y5XC 1K4DB 4LLWA 4HK0A 5I1KL 1RZJL 1JUFA 3PXHA 2UWEA 1W0WA 4Q9QH 4PJIE 4PTUB 3BE1L 1ED3A 4JFOB 2GJ6A 3MV9E 1UB6B 4KROB 3LB6C 3MRQA 2B4CH 3OKYA 3KYKH 1FBIH 3MRMB 3KJ4B 4ZUUB 4F7MA 2GCYA 2DI9A 1BX2B 3REWB 4MWFB 5L6YH 5I15L 5C70A 4NO0A 1S3KL 1MREL 2EIZB 1F58L 1MCCA 4CJ1A 2XZCH 4JRYA 4OCXL 1NL0L 4HH9A 2VLKE 3ME0A 4Q2ZA 4JRXB 3EDFA 1YJDH 3PHOA 4PIRF 1ZAGA 1UYWL 5HVHB 2Y72A 3QUMA 4JCLA 1TVHA 3HUJB 3BKML 3SDYL 3ARUA 1TQBC 5DQJB 4NJ9L 1L9MA 3VFTB 4X7CC 3L3IB 3QEQD 4ZXBA 2VQUA 1II4E 2H32B 5EU5A 4R7DA 2HVKB 5KSBA 1CFTB 3X14B 5EG6C 1AGBB 2FGWL 2AXGB 4JGMA 1EEQA 4NRYB 5B3NA 4RZCA 1RUAH 2H3NA 2LFGA 3PWNA 2EEDA 3GMQB 1YMME 1NDGB 4RMQA 1XF3A 3GMLB 1G84A 1INDL 1HI6B 3DWTA 1J5OH 3VH8B 4PP2A 1FORH 4S1SH 1EBAA 4KI5E 2IC2A 3UTTA 4CW1A 3WHE1 2F5BH 3QJFB 4KKCD 2OR7A 1YDPA 3KYOB 3ZZ1A 4KI5C 2OSLB 4XNXH 2LABA 4OSUL 3IDJB 5BW7C 2QQLH 1C5CL 2YWZA 3A6OA 2CLVA 4BSJA 3OKMB 4PV9A 2AV1A 4NSKA 2IWGA 4X4MA 5CGMA 3OZ9L 3FB7A 3HNSH 3RWCA 2FO4A 1QRKA 4XGZA 4Z7UE 2B0SH 3VWKA 3CDFA 4MNGE 1OAXH 5BV7H 3RDTD 4HGWB 4N8CL 4QTHB 5I8OH 4TUOB 1PYWA 1OCWL 5CGYD 1ZEAH 1IGMH 3B9VA 1JGLH 3BP6A 3U9PH 4KK8D 2ZSVB 3WMSA 1UB5A 5D7LA 3S9DB 5I1HH 5E6IA 2ORBL 1VKXA 1MVUB 3PWPE 1S7TA 3FTGB 2B1HH 3MMEA 3DBXA 1S7QB 4L1DA 1D7FA 5LJYH 4N0FA 1IEAA 1YUHA 1PKQE 1QBBA 5F7MC 1LK3H 3O6ML 1A3RH 1X3DA 4PJDF 4XXDB 5EIIB 4M6ML 3RNKA 2GAZB 4NQCE 4P5TC 2SEBB 5E00B 5DK0B 1G7HA 2C4FU 2WUBL 2X7LB 1NQBA 3V6OC 3VFNA 1KOAA 2W0LA 3LKSA 3EDEA 5AYUL 5H94B 4TOYL 5T33L 3IXTB 5E8DL 3LRGA 5LWYL 1Q9LB 5DQDL 3BI9X 5L7XL 5E7BA 5F7EL 4Y16C 3OKDB 5JHDB 4WUKH 1SMOA 1VSCA 5J57B 1UM4L 3NIDE 1X6LA 5IB3A 1XR8B 3GJFK 2H6PA 3ZTJH 3RRQA 3L3GA 4KQ3H 2ED9A 4M43L 5DEGA 3SKNA 4QO1A 5C07D 4R3SA 1CXIA 3C09C 4UIMA 5CZVL 4XVUC 2VDKH 5DS8A 4KJWD 5HYJD 4HFUL 2NPLX 1QBMH 4JO2L 5KSVA 2A73B 3Q6GL 4J6RL 2WQ8A 1LVEA 1DBAL 4L8SA 2C1OB 3GUTA 4P4RA 4U0QB 2YD2A 3EYUL 3I3EA 1SJHB 2YEZA 5C0ND 3O8XD 4NRXA 3WFZA 4WO4D 2X42A 4RGND 5IQ7L 1AY1H 2OTPA 5CEZL 4U1SB 1ZHKA 3CSBA 4P9HL 1A8JH 4JREB 5F3BA 5HDBF 5FKPA 1JZ3A 2X5PA 5T1LA 1QYGL 3VRLE 3MLZL 5TJWK 5LAXA 1NGQL 2P5EB 1F3JA 2PTVA 2UVEA 3WFHA 3SQBA 1FP5A 1XGTB 5LBSL 2APTA 4EXPX 1SYSB 1ORSA 1IKNC 2JJTC 4PG2A 3A6CH 4LOUD 3ZE2E 2V5YA 3S37L 4G7YH 4I2XE 3MLVL 5JORA 1MPAH 4Z7OF 1RIUH 1WWWX 1A22B 3BGMA 5DHYB 1Q1JL 4Z0XB 3WCYA 2V2WA 3BPNC 2BDNH 4BK5A 3AROA 5TE4H 1FZMA 2XQBH 5TQ2H 3HB3D 4YXLH 1ZT4B 3SE3C 5CMAA 5C09D 2YRZA 4AG4L 4RAUA 3ARTA 4HGMA 2YA0A 4KDVA 4KPHL 2LAGB 4KKLC 1K5NA 3CVIL 4Z7WE 5IHBA 5D2LF 4D3CH 4GXUM 5E8OB 2GSIB 4LEXH 5DJAB 3JTTB 1IM9B 3SGKC 5LGHH 1VGKB 1E4XL 3GZKA 4MD0A 2FJHA 3C60A 2OZ4A 2D03H 3DRTA 1VHPA 1NGZB 4I18C 4R4BB 3ZDXE 3SQOL 1ZWIA 2YRLA 5IVZB 4LCCA 5SX5K 5GRVK 1P4BH 1IC1A 5DJCA 2EH8H 5GS0H 2OYPA 5JPNA 2L4OA 2FATL 1AD9A 1NC4B 4WU7A 1G9NC 4HWBA 3TZVD 1BF8A 2W60A 4P4KC 4R97C 2H2PD 4GKNB 4N5EC 3P3YA 2HT4C 3KWWA 3WN5B 4CRPA 1YQVH 4NKDB 2GHWB 2OX5A 3WKMH 3QDMA 2VIRA 3NFPA 3TNNB 4EI6A 5E8NB 1ZA6A 1Q0YL 4L4VE 4JFYB 5ALBL 1KCRL 5B4MC 1JGUL 4IRZH 1L6ZA 2IAMA 3FKUS 1T2QH 4X80L 3ZYIA 5CP7B 1IZKA 4GKZA 1INEH 2VXTL 2UWEF 5I1LA 2OL3H 1DBBH 4CGTA 1G0DA 4YEEA 5FFLA 4MA8L 4KAQL 2APFA 4I0PB 4YWGH 1BZ7A 1O5DT 4PGCB 3VMNA 3NFNA 4MJ2A 1XGYH 2RGSA 2FNBA 2X4SA 4MJIB 5FYKH 2BSTB 4WW2A 5FGSA 4LCIH 3LMJL 3S3PA 5IK3A 2NNAA 4JFQA 5DVOA 3T2NH 1QOKA 9CGTA 1YY9C 2BNRB 4Y5YA 2OBGA 2PYEB 5LQBH 1XF5B 3MLTA 2VKXA 3VH8G 2UZIL 3MRJA 4FABH 4U33A 3GK8L 3S88H 1DJSA 1B0RB 3ELAT 4KDWA 5HDOA 3H3PL 4XC3L 4R2GB 2X2YA 3H2WA 2AJSL 4OZ4A 3O4OB 2PKDA 3IJSB 2FIKB 3HI1A 2MOVA 4QOKA 2FEDD 5D96C 3GBLA 3BKYH 5FF6A 2B1AL 4LLMA 5JOPE 4KK6C 1JPGB 3MRPB 1KB9K 5KSBF 3NCFB 1T5WB 1RD6A 1T80A 3NAAH 2FDBP 1A9BB 4J12A 1C1EL 3NZ8A 4FFYH 1VEMA 3LDBB 4R7NA 3CH1B 3CX5K 1MCLA 5IEKB 4MXWL 2CJUH 4LLQB 1LO0H 5L8LB 3MRHA 5DJYA 3LPWA 4F9LC 1M7DA 2LVCA 1OB1A 3LN5A 4P5MB 1OTSD 2ESVA 4OBRA 2D7PA 3L3JB 4OZGF 4OV6F 1CI5A 1A4KA 3H6JA 4YHMH 1PG7L 4Z6AT 2B2XH 2B39A 4ZDHA 2XT1B 4X7TA 3DARA 2VNCA 4HEPG 3W81A 1JIBA 1ZHLA 4LRNL 3H9SE 5DR5L 1KB5H 2ADJA 5BO1L 3NIFE 4M8QB 1IGJB 2JJWA 2Z9TA 4UB0H 5JDSA 4FQPA 1P84J 2GTWA 4Z7QF 1HHHA 3RZCC 3CFBA 2FYYB 4OV5A 2BVEA 1U8OA 3ULUF 3MJ7A 3HPJA 3BDYL 1CDBA 3CAFA 5ID1A 2XY2A 4P5TB 4G5ZH 1FG9C 2JB6A 3ZTNH 4JHBA 4X6CA 4GW5B 1WAAA 2G5BB 3CNKA 5DJ8B 4S1RL 3FQTB 1ZA3B 1JPST 5I66A 2G2RB 2WLYA 5GRUH 4C56E 3F58L 2LTQC 2P5WA 2DWDA 5H2BB 5CD5C 5GIRB 2A0LC 3QEQB 4XCNA 4XAWL 4G6KL 2R2EA 1F00I 4PJXA 1QLRA 2WBJD 1VERA 2DBLL 4EI5B 1NANH 1DBKL 1KCKA 1ZGLB 3V52H 4MCZA 4OI9A 3ZLQC 1BGXL 1YEHL 4HWZA 2AKRB 1ZLUK 3TJHC 2VDML 3G6AB 3DX7A 3QXAB 2BC4A 2X4TB 4FQJH 1RZ8A 3UTZA 5JXEA 4KV5F 4HG4K 1DLFL 2HMIC 1CDJA 4WJ5A 3X11A 4A6YA 2R69L 3T77A 3BPLB 4L8CB 4JKLA 1XGQA 5F1NB 1U8IB 3FQWA 3SOBH 3VRJB 3BD5A 4HV8B 4JVUA 4NCC1 4XRCB 3ARDD 5F9WB 4N90E 3QDGA 3FFCA 2DQUL 1RK1B 1ND0B 1LGVA 1N6UA 3DURA 4WWKA 4APQA 4YDLC 4OGYH 3IDMB 4P5KA 2ENSA 3HLAB 5BOZG 1T1XB 4XBEH 1N64H 2EDHA 4ODSH 6FABH 1RI8A 4JPKH 3GGWB 1TZIB 8FABB 1TZHA 4P3DA 2DQHH 1UM5L 3T65A 3NA9H 3RL2A 3QUMH 4PJFE 3RUGE 3I3BA 3OPZH 4ODVH 4NOFA 2GY7B 2LQRA 5C0CA 1LEIB 5FUOL 4JN2B 5J1AA 2XY1A 1EK3A 3WXVL 4HIXL 1O7VA 1K4CB 3Q2CA 4FHBD 2NX5A 3EGSA 4O02L 1IGIH 2V2TA 4J7RA 3CMOH 4ODHL 3AB0B 3X3FL 5FUCE 3Q48A 1F02I 5GGQH 2EKJA 4H0HB 3GBNH 1B0GA 5IVXE 5FUCC 4YHPA 4PJAA 4UOW0 4P9ML 1SJEB 1NCBH 1I9RH 4FQHA 2Y06H 1MFAL 4XP5H 1A6UH 1UG9A 1N6QL 4LSDA 4ODXA 1S5HB 4LIQH 2C4XA 4MJ5A 5F7LB 4LPYA 4Y1AA 4S10A 3EUUA 2J88H 5FYJH 5A2IH 1D5ZA 3EHBC 2AJYL 1CXLA 5GRZA 3IDGA 1ZSDA 1L6XA 4Y19E 4LQ1A 1JRHL 1UWGH 3NFSH 4HSQA 3UROR 4E42B 5C92A 3K80A 4HIJB 2CKBL 1D5MA 4M5YL 5IMOB 4NNPH 1C12A 3QULB 2IFFL 2VQTA 4UTAL 4YDJB 3AM8C 4TVPL 1U8LB 2EKSB 3ULUH 5TPWH 4PJ7A 4ZPVB 2RFXA 1B6UA 3OR6B 5E9DA 5EO9B 3DV6A 2VAJA 3BUYB 3LQZB 4PJHA 4MDJA 1N5AB 4YHOL 2BY3A 3S36X 3VXTA 3OQ3B 1CWVA 1F11B 8CGTA 1UM6H 2AJ3B 2GT9A 4M6NL 4OBSA 1OD9A 4DGIL 3DYPA 5I8EB 1DL7L 1WCQA 4G42A 4HWUA 4ZFOL 2L0DA 4R97B 3VFRA 5HYJB 4HXBH 1KCUL 5EUOA 1M71B 3S7GA 1EX0A 5F96H 3HE7A 4OLYL 4G3YL 2ARJQ 3G5YA 2YKLL 4EUPH 2AK4D 3QEGH 3S8WA 1W8NA 1UVQA 2BHUA 2Q1EA 4H5SB 2VXQL 3O8XB 3ARGC 4RAVB 4WO4B 4XP6L 3GSNA 4DZBA 4RGNB 3JWDH 4NO3A 4JM2C 1E4JA 3HPLB 1TTUA 2X4NB 4NQVA 4S1DC 3NCJL 5IFJA 4J8RA 4OM0H 2X4OB 4ERSH 1QRNE 3G5ZB 3R1GL 1EUTA 3ZKQD 4UV7H 5DZLA 2R29H 1HNFA 1CT8B 4KGLA 2BSSA 2WIMA 3RGVC 1YNLH 1AGDB 2AK1L 4FFWC 3HZMA 4JY6B 4C57C 4E41D 3OL2A 1S7VB 4EKXA 3EO1B 4N1CA 3RTQC 3VW3H 3R06B 5KSAA 3EYSL 3OKEA 2I07A 3OKNA 3WFCH 4PJBE 4MXVE 3TO2B 4G7VL 4QF1B 2ZCHH 2FR4A 3QQ3B 5GQBA 1SVZA 1E6JL 5C09B 3MZGB 3ES6B 4YK4B 2CLZA 4WW2F 1CK0L 3CSPA 4IEFB 4PYHA 2XKSA 1KJ2A 1U8JB 1MCKA 4MVBC 5ISZE 1TCRB 4G9FE 5HDLA 5BXFB 1RUML 3QISA 3BWAA 1I8LC 2Y5EA 1R5VB 3PIQB 1L0QA 3NABL 1T7YA 3GI8H 3BZEA 4F9PC 4PYGA 5D6CA 4PRHA 5D71H 1U3HC 1IC4L 3UDWC 1N59B 1CBVH 2HWZL 4JLRA 2FH8A 4L8BA 1OAZL 1PQZB 4JFZH 1A1NA 4FZ8H 3V6ZB 2XPGB 1YECH 2DL9A 4D0CB 1WIPA 1NLDH 1OAKH 1X9QA 1PGRB 2E7BA 2VDPL 3TYGH 5I9QB 3BQUD 1IAII 4KU1A 2XZQH 4JKKA 2VE6B 2P8MA 2HRLA 4J4PA 1BLNA 1EHAA 4ONFH 1G9EA 3MFFA 4ZUVB 1JZ7A 2EDTA 2VABB 4LKCB 4MQXC 1NMBL 4U6HA 5ETUB 3LV3B 5EU6A 1V5JA 5EZOL 4B0MM 1QLEH 3ORJA 4EVNA 1DQTA 4L3CA 2EZ0C 2WP3O 5DK2A 2EDNA 5C0IA 3P9WB 4N0UB 3BPOB 5I71C 1JHKH 3FONB 4QHUB 2EIDA 5D1XA 1F4YH 3MXVL 3QNZA 5AWNL 2D31B 4LHUA 3H7BB 2I60H 4JRYD 3MRRB 3WFDH 2P47B 3A67H 1JPSL 3VXRA 1R5WB 4K94H 3LEXA 5JW4Q 4DJMA 3L95A 2V2XA 3FRPG 4HMEA 4TVSa 1FL3A 5CINL 5FM5M 5IBLD 1FO0B 1JPFB 4UT6L 3HE6D 4C56B 4OFIA 2OZ4H 5K9JH 4KY1L 5CEZE 1NSNL 2M26A 5C0EB 2FHBA 2YBRB 4MXQD 3T2PA 5AEAA 3EZJB 4AQ1B 1KJ3H 5C0BA 4K8RC 4LAQL 1BIHA 5IVNA 1NGPH 5CILH 4X6CF 3NPZB 4HWBH 1F4XL 5C6WH 2JJSA 4F57H 4XPGH 4E0RB 2W59A 3LEVL 1F13A 3O3DB 4G6AC 5MI0C 1RIHL 3V0WL 2NY4D 2ZSWB 2X70A 4I3SL 2VSCA 4F8TA 3OKLB 1JWUB 2P24B 4DVRL 4X7FC 1K6QL 2P45B 3CFCH 4NZUH 4PJXF 5IOPB 3FOLB 1IQDA 2EDXA 4IOIA 4XHQA 4X5LA 2Z91A 2HJLA 3REVB 2ZUXA 5GS2D 1T21B 5H35B 3G6JB 4OZFH 1TCMA 4JY4B 5FM4A 2WSKA 3DHMA 3AS2A 5D7IE 1MCDA 2AJUH 1AKJA 5GPRA 3I6KB 5FB8A 2FWOB 4BFBD 1WJ3A 4HXAH 3IJYA 1IL1B 4OZHE 5HYQB 1QNZL 1JN6A 3D0LA 3RUGB 5EORL 1ZLSH 4ZG1A 4F7EA 1WICA 2BVTA 4X6DA 4LLVA 1YYLH 2NW2A 4GG6A 5J12B 3MRKB 1FFQA 2X9YA 4L29A 1RZIB 4YJZL 5L0QB 2HRPH 4NWTH 4U1IA 5E2UH 1J0HA 4F7CB 1BEYH 2AJVL 1L7TH 4PJ9A 4YBLC 3I84A 2ADFL 1VFMA 2WINB 2ITCA 3RHWK 5AZEH 3TYFA 1QSZA 3UXFA 4A2MA 5A16B 1QBLH 1T3FB 3VGHA 2CRYA 4KJYB 1OSZA 1CFBA 3C5JB 4TUJA 3EOTH 1E4WL 3QHZH 4YE4L 5TE6L 4FTVE 5AUMA 4Z76B 4KGJA 4HS3B 2PXYD 3W11C 1NGWA 4AEFA 2A6JA 3P0YH 2B4CL 1P4IH 3KYKL 1ONQA 4BZ1H 5E95B 3C6LB 4K07A 3QNYA 5EULV 4HHAB 3SGDI 3QA3A 5SWZD 5L6YL 4OCYH 4X6EA 4Z7VE 2DLEA 2VC2H 4LBEB 1KPRB 5DMIH 2F54A 5A2FA 5HHOA 2Q6WB 5F72S 2WBJB 1FNLA 3V6FB 1B9ZA 2XZCL 3HG1D 1EJOH 2JF1A 1NDMB 3EOBB 4L9LC 4U1LA 4F15C 1LP9E 1NFDA 2NLJB 2A6DA 1YJDL 2LVEA 3EDDA 5LCVH 3PGCA 5F88B 1IEBA 4GKSA 4XCYB 4CMHB 4WGVB 4Y5VC 3DXAD 2XFXB 4HIEB 1A6VL 2OJZH 3W2DH 4L8DA 3UO1H 3ARDB 1KXVC 5ILTH 5BQ7A 4QNPE 3P4NA 2YPKA 4E5XA 1I7ZB 5D70H 3SGJC 3RKPA 2XYCA 3SDXA 4LVHB 4QWWC 1MRFL 3IKCB 4NIKB 2BVOA 3K4AA 2MKLC 1YC8A 2HKFL 2OI9C 2NY2C 4JZJA 3JVGA 3VXSA 4HS6A 3RKDC 5IJKC 1KENH 4PJHF 1Z0MA 5E8EB 3I75B 1EAPB 4QXTB 4O2FB 2Z31D 3QIBC 5F70A 1T1ZA 1C5DA 1EEZB 3TBVA 3RNQB 3MR9B 2H8PA 3VXMA 1DUYA 2O5XH 1HHJB 1FORL 3D87B 2FZ3B 3DSNA 4S1SL 2KZWA 4PJEA 3SN6N 2VZ3A 1XGPA 4F33A 2F5BL 3GMPB 2VDRH 5C8JB 3BVNB 3CPLB 4YHNB 3GM8A 3BEVB 4XNXL 4HF5H 2DMBA 2QQLL 4ZQKB 4ORGB 3F5WB 2K9UA 4A6YH 4M61B 5I19H 1ZS8A 4ZFZA 4KK9C 5E0QA 1JTOA 4RGOH 3HNSL 5DMJB 3T1FB 32C2A 4HJGA 2F8OA 1LEKA 5H37G 2B0SL 1UKQA 1U8PA 3CVHA 1OAXL 5HGDB 3QIWD 1JI2A 4KUCD 5BV7L 4X83A 3V79C 3ZL4L 4JJ5A 1MRCH 2DI7A 4TUKH 5HGBA 3EAKA 3FQNB 1OF2B 1AQDB 1ZEAL 2Q86A 2Z8SA 3U9PL 1S9XA 4QYOA 3RWEB 3PQYD 1JMZA 5I1HL 1N0LA 4PJ5E 5T3XD 1U36A 3WUZA 2B1HL 4HS8L 4MA7L 1NAMB 4PRNB 1A3RL 1YEEL 3GSXA 3BSZH 1T03H 3VA2C 5I1DB 4YDVA 1UZ8A 3UEZA 4HFWB 1J10A 1GZQA 1NKRA 1G7PA 3VCLB 4KZDL 4RNRB 1HXYB 1QFPA 4S1QL 2GFBB 4M1DH 5M7QA 1IZJA 2V7NB 4LF3A 5C0FA 3C8KA 2A6KB 3P9MA 5FA4A 1KSRA 4WUKL 2H41A 1I3RB 1HHKA 4X99B 4YGVA 3IAQA 2WMPA 5HHQA 5ICZA 5DJ2B 2NZ9C 2OTUA 1XT5A 2AK4B 4ONHA 4LCWA 3L5XH 2FLBT 1CCZA 5DA4A 3FOMA 1OP5H 1RULL 4KQ3L 3DMMA 3T8XA 3GIZH 1JGEB 3D69A 2RHEA 1EHNA 2VN4A 1MIEH 3SDAD 2IAMD 3L3DA 3OXSA 1LD9B 4RCAA 2VDKL 4YPGA 1QBML 4ZOAA 2VLJE 5DHVB 2CXKA 3WLBB 4OD2B 3TT1L 5BJTA 4MAUH 5TDNA 3UBXB 1JL8A 3IFOA 3K1KC 2V17H 2WIIB 5IB4A 3CH8A 1P7KB 4DKEL 3EYQC 3WHE0 3N06B 1P84K 1CN4A 4JRWA 1U2CA 3DX6B 5I2IB 2VSDA 1IGTB 1FVDA 1WTLA 2X89A 3P73B 4G8GE 4CNIB 2D0GA 3QXDA 1FHGA 1O0VA 1UACH 3F7VA 3IETB 3DUSB 5DWUH 2GK0A 4QEGA 4OJFH 1F6FB 1MJJA 2GI7A 4UIKH 2VLRE 3WJJC 2D3VA 3MREA 5HVGB 3A6CL 4Z77B 3KDMB 3GSNH 1OARH 1MPAL 1RIUL 4KVCH 1GAFL 1KELL 4YX2L 1GRWA 5EN2B 3ROOA 2J4WL 2J5LB 5CJ8A 1RZKL 4U1KB 5TDOA 1YNTB 2BDNL 4OZIB 2CK0L 1D3CA 5E24E 3BKCH 1J7VR 2XQBL 4YXLL 2R1WA 2BVPA 1NEZA 3LSOA 4OZHB 2H9GB 3BP5A 4LSUH 1C16B 5I1AB 1J8KA 4R8WH 3BQUB 1MHHB 4HWNA 4D3CL 4TVPE 4KRNA 5ESVA 4ZAKA 5DYOA 1SVCP 4MGXA 2WANA 2P8PB 1ZVYA 2D03L 5E2TL 2A74B 1D9KD 5DMGC 2ATPB 1DQQA 3MV8E 1F6AB 1V7MH 2ZOKA 1P4BL 1I1AA 3TA3A 2P8LB 3K8MA 4QRUB 2EH8L 5GS0L 3LKRA 4X6DF 5INCB 1OGAD 3GIVB 1KJ2H 3QDJD 4XNUH 3L3KB 2XN9A 2X09A 2OMBA 3FT4B 2Y7QB 5IMKA 4H25A 2C1PA 2CDFA 3EYFA 4HUMB 4WHYG 1YQVL 4OUUB 2YS4A 2RB8A 4UTBH 3WKML 5KAQF 1W0VB 2DJSA 3HE6B 3TJEH 1XIWA 3EJYC 3MYJA 2G75A 1KTKE 1LO5A 1NJ9B 3MQIA 2J7LA 4P2OA 5IQ9A 1INEL 2ERJB 1MCHA 2OL3L 1DBBL 3CZFA 4XAKD 3VGGA 1B2WH 1X5HA 5I6XB 4XXCA 5DEZA 3WE6A 4LGSB 1Q72L 3B9KA 4GS7B 3NN8A 5HI3C 5FYKL 4F2MB 5KG9A 1H5BC 2NY4B 3QUYC 43C9B 3T2NL 1P1ZA 4CAGA 3MRFB 1QVOA 4MNQA 5J6HA 4D9QD 4X9GA 1KG0B 1IAIH 4PJGE 4BA8A 5LQBL 2HFTA 4U6XB 4HLJA 4FABL 3IFPA 5IB1A 1TNMA 4X5WB 3BZFB 3T4AA 1NFDF 2QSVA 4N0YH 5EDXA 4HC1A 4M5ZH 4N5UA 5T5NG 3MRCA 4IRJD 1P53A 3QDHA 4BSVA 2DQJH 1QFWI 1CE6A 5IFAL 4M3KB 3JV5A 4YHIA 1BFOB 4GAYB 2AV7A 1RV6X 3BKYL 3DI2B 4XC1H 1T7XA 5EU4B 1JZ5A 3JV4B 5C0AD 1HXMB 3NPSC 2RIKA 1RU9H 4ODWA 5L2KD 4LASH 3NAAL 4U49A 2J12B 5IBUB 5DD0H 3N85L 3ZHKA 4MYWB 4FFYL 1H9VA 3MBEC 5EWIH 2ZOLA 1KJMA 3HR5B 4ZFFB 1LO0L 2YD6A 3U7YH 5BS0A 1D6VL 4PJ8C 3MRLA 1OAQL 1IAOA 4HIIA 3LKQA 3L5HA 1YMHA 2HTKC 4WUUA 4PJEF 5C9JA 2PXYB 3C08L 3ARBC 1MEXH 4JDTH 4G8IB 3W0WA 2HVJB 2CQVA 1TVBA 5HI5C 5LGKA 5F1IB 3QXUA 1T0MA 1GH7A 3D3VA 4PB0H 1P7QA 4KRPD 2JIXD 2XWBB 4N0CC 3MRDA 4ELMA 1QSFD 1LK2A 5F1SA 3R0NA 4KKBD 5TF0A 3HI5H 3HG1B 3TO4D 4GXUN 1TQCB 5IHZB 4G5ZL 5DI8B 2J1KA 4I9WE 3ZTNL 2X4PA 3ZKND 1I85C 3KPSE 3GMMA 5KW9H 3MRNA 2FL5A 5GRUL 4FQXC 3DXAB 3GNMH 5DJDA 4AZ8A 3N1GC 3FB8A 3QQ4A 1NCAL 1R24A 1CS6A 3OB0H 4OGXH 5E1AA 5GGTA 3Q3GA 4P46A 5C0DB 3V52L 1MCOH 4OCSH 3DROB 1T20B 5J6GB 1LE9B 2IANA 1MNUL 3CFEA 1EO7A 4FQJL 3PXJA 5J9PB 5GGUA 3QUZA 4MNHA 5SWQA 3TBYB 1HZHH 4ACPA 4FG6C 4M48H 5FHBH 3UBXG 1EUUA 2Z31B 4I0KA 3SOBL 2AI0H 1KTLA 1R3KA 1HKFA 1X5FA 5C0GA 3VFMB 1KIQA 1AIFB 3ZKMC 3WV0A 1KTRL 2CXGA 3MJ9L 1CGXA 4QHNA 5IF0A 1BHGA 5ANME 2BNQE 3MNZB 2CDGB 2Z4QA 3MLUH 4M93B 4D8PA 4XBEL 1N64L 3LOWA 4WDIB 1TNNA 3L5JA 1X5LA 4DQOH 4IIQB 2D7TL 2DWEA 4ZO8A 4BUHA 3VD9A 1Z5LA 2X4RA 3ETBF 2CIIB 1JNJA 1JWSA 2ICEA 4ODVL 3WJLC 5AAWA 4U7MA 1NEUA 3G9VA 1RSFA 4ZD3H 4LVOC 5TDPB 4UUJB 3QIWB 1FZKB 3O11A 4Y4HC 5EBWB 3SJVD 5T1KB 3D6GA 3LKPB 4R0LA 1WFOA 3S36L 3CMOL 1IAKA 3SDCD 3NIGE 3SCMC 2P7TB 3BP7B 3GJFA 5GGQL 3U46B 3AAZA 5HPMA 4OAWB 4HIHB 3QI9C 4KWUA 3P77B 3PQYB 5I1IL 3CFDA 3L7EA 4RFEA 4N9GB 2VERN 3QXTA 4YNYA 3DUHA 2DKMA 3RWGB 4UQ3B 5IW6A 1NCBL 2V5TA 1CE1L 4LPCA 2P44B 4M02A 4QXGH 1VFBB 2Y06L 3QEHB 4XP5L 4LRIC 5TE7H 3ISWA 3VGFA 1A6UL 1U3ZA 1FL5B 2AQ3A 4MMXC 3VDAA 4LIQL 3QUKB 4OLZH 4I48B 5DLMH 2J88L 4JG0H 2EO9A 1Q0XL 4XNMB 1HE7A 1BOYA 1Y6KR 3FQXB 4HKBB 4OIAA 2Z92B 1A1MB 2YWYA 2QADD 2B4CC 2Y07H 1UWGL 3NFSL 3ARED 2IADA 2NY6D 1JK8A 1FC1A 3RU8L 4K3EL 1A2YA 4NNPL 3O6FD 3ARQA 5KSUB 1S7WB 5KZCD 5FIEA 3T4YB 3OKOB 2BHZA 4PRID 3LZFH 3RFZC 3ULUL 1ZLVH 7FABH 3CVHH 1RJYB 3GMOB 1MCWM 1E28B 4XZUA 3O81A 1BBJA 4GAGL 2DM4A 3LS4L 5IMLA 3BXNA 4OCMC 5EU6D 1YJDC 2APVA 2RAMA 5EZIH 1DQDL 3D85A 3QR2A 1JGVH 3JTSA 4MD5B 1TPXB 1KT2A 3T0WA 4OD3H 1HINL 1MJ8L 4ZFOB 3I50H 4GRMA 5IHUL 2VYRE 3ABZA 5EOTB 1UWXH 4HXBL 3BIAX 4XBGB 1FNGA 4DZ8A 3MRIB 3VXRD 2EEBA 4P2YA 5CUSH 3IU3A 1FH5H 2HT3C 2P42B 3QEGL 2UZXB 3PHQA 1T5XA 1LNUA 4PGDB 1U8HB 2GY5A 4ENEC 4DN4H 2YXMA 1Q9OB 3Q5TA 3O4LD 1V05A 1AXSA 3VE0B 1JMXA 2GITA 3DSFH 3M17B 1MI5A 2IALA 3O2DH 4QRRE 4OCLC 5JHLH 1XGUA 2AP2A 1BJMA 1BD2E 4ERSL 3ZDYF 3O9WA 4R9HA 2R29L 4GRLD 3PL6A 2X4QB 2VDLH 5JQ6H 4IMLA 3GSUA 5ERWB 3PWLA 3BMWA 2IH1B 4FXLA 2AJZB 3O45B 3QEUA 3FO9A 4BFIB 2COQA 2ZNWA 1MCPL 3PV7A 4R26H 5J13B 2FJGA 3FT3B 2VTFA 1CDIA 1VADA 4DW2H 1G0XA 3KPRD 5HTSA 3VW3L 3SY0A 4JDZA 3RL1B 1WVZA 3V0AC 2O61A 3C5ZD 3WFCL 5BV7C 2ZCHL 4YFDB 4XCFH 5CIPB 1AKJD 2D0FA 5IBUG 4XVJH 5JNYB 1WFNA 4OFPA 4NNYA 1I7UA 3MGTA 1J8HE 1K4DA 4UBDC 2PR4H 2FCBA 4HUWB 3GI8L 4M3JA 5D6DC 5D71L 4PTUA 2GSGB 3MLYH 4JFOA 4NHCH 4X4XB 1UB6A 3MBEB 4TTDD 3HZVB 3NIFF 1I1FB 4C55A 3MRMA 1Z3GH 3UCRA 3G6DH 3WIHL 4FZ8L 1D9KB 1BX2A 2NCMA 4PJ9D 3REWA 4U0RC 2NQCA 3MX0A 1FZOB 1NLDL 5GRXG 3S96B 1JF5A 2EIZA 4YZFF 1UT9A 3TYGL 4MAYD 2N4IA 1OGAB 2HKHH 3HMWH 3QDJB 4LVNC 2O5YH 5CCKH 4ONFL 4KDTC 1CQKA 4Y4KC 4XMKH 4PGJA 5CEXB 1MAMH 2DTSA 2VR4A 3HUJA 1P6FA 4F3FB 3ULVF 2JCCB 2NXYD 5DQJA 5EOCH 1PLGH 4YQXH 2XKUA 3VFTA 5E99H 3L3IA 5GGSY 1N8ZB 4KRLB 2F54D 2H32A 1BIIB 2QQKH 1JHKL 1X5XA 2HVKA 2X41A 4NYLB 2A9MH 1OAYH 5JZ7D 1CFTA 1HSBB 3S35X 4D94A 3IS0X 3X14A 1AGBA 5I30H 1CXHA 3Q5OA 2AXGA 2P46B 4K94L 2VITB 4NRYA 3FO0H 3KPSB 3F65A 4WFHE 4HCRA 5DEFB 1MRDH 1GXEA 1T83C 4UAOB 1NDGA 4AM0B 2OZ4L 2A9NH 3GMLA 4YBQD 2BRRL 5JXAH 1HI6A 4ELMF 3VH8A 5DD6B 2GW5A 4LSQH 1FGVH 1KLGB 4OI7A 4OM1H 3WIIL 4GBXC 5IROC 3AMKA 4C4KO 1ZV5A 3DYOA 4FFZH 3QJFA 1KJ3L 3JV6B 1NGPL 3KYOA 1T89C 4HWBL 2OSLA 3IDJA 4XPGL 1P4LB 3OKMA 3PDGA 4IRJB 4PJCB 4YH6A 5C6TH 2VLLB 4GAJL 4HBCL 4Y2DD 1GVIA 3CFCL 4NZUL 3UZVB 4B7IA 4NUJB 4I3RL 5C0AB 4OCNC 4HGWA 5L2KB 3D39D 4QTHA 1M1SA 3BGFC 2F58H 2WWKT 4TUOA 5DRWB 1FIEA 3KG5A 5IVXF 2AJUL 2HFEB 5D7JC 3OKKB 1BVLB 4ZS7H 2ZSVA 2XA8H 3LS5H 5DFVC 4PP1D 2AXHA 3EBAA 1OVZA 4HPOL 2V6HA 3UYRL 5INDB 1MVUA 3DX8B 1ZLSL 3D18B 3FTGA 4XWOD 4YC2C 1J12A 1S7QA 4WIQA 3HZYB 1GGIH 5D1QD 1YYLL 1LDSA 1JJUA 1X5IA 3KLDA 4NRZB 1RZFH 2FEEI 5FYLH 2E8YA 4XXDA 2HRPL 3K0WA 3QT2A 3UTQB 2A6IB 2GAZA 3MV7E 3CDYA 1ZMYA 2EDWA 4NWTL 4OCWL 2SEBA 5E2UL 5MENE 1R3IH 3KNBB 5CWSB 5DK0A 4PJDE 1CZ8H 5E00A 3VXUE 1BEYL 1L7TL 2X7LA 1K9TA 5GRJL 1JV5B 4LGPB 2WWKO 2JIXB 1I3VA 4HC1H 3X12B 2R9HD 5GISL 3OTTA 4WI6A 1QBLL 2UZYB 5J0BA 5H94A 4D0DB 3GJEB 3FO1B 1QSFB 2E7LC 4UT9H 3IXTA 1EZVX 4JEGB 1Q9LA 3QHZL 1HIMH 1OWWA 3U83A 3TO4B 5JHDA 3OKDA 4OI8A 4Z9KB 2ICWJ 5MERA 2VR5A 2XZZA 1RK0B 5GS0C 2D7OA 3WNPA 2XTJE 3NOIA 4OD1H 1IQWH 5HXMA 4IJ3C 4DUWA 3P0YL 3QFJE 1XR8A 2XTJC 3TVMD 4HJ0C 1L4IA 4JJHA 4IHOB 5T1MB 2W9DL 4H88H 1QFWH 4JHZA 3GEWB 2VC2L 1EBPA 3FN0H 4PV8B 5DMIL 3ULVH 3VMOA 3VWJC 4EBQH 1VFUA 1OW0A 1YEIH 4HJJH 2FX9H 3U4EB 4JM2F 4MB4A 2A73A 3S3SA 1OP3K 3R4DA 5LCVL 2C1OA 4IDLA 4F8QA 1FYTD 5FYKE 1SJHA 3RWFB 4EJ1C 1RJCA 4FS0A 1QR1B 1I8KB 2BX5A 3O3BA 2EH7H 2OJZL 4PLJD 3W2DL 3UO1L 1ZTXH 1OT2A 3KLSA 2HLAB 5D70L 2YPVL 2ED7A 5JO5B 4MZ3A 5HDBE 4KXZI 2E7HA 2P5EA 5GSVB 5MEOB 4P23C 1KENL 5DTFB 5JIIA 1G7LA 3RWHB 1SYSA 5F7NC 4PRPE 3VXPB 2KBGA 3UYOD 3QRFM 4NN6B 1QFUH 3CSGA 5EUKB 4YUEH 4RGMB 3DRQB 5DHYA 2O5XL 5HHVH 3B2VL 2DDQL 3SJVB 4ZFGL 4Q9RH 1YEJL 4Z0XA 2F53E 2Y4SA 4Z7OE 4PJBF 2F5AH 5J06A 1GGUA 5GGTH 3SDCB 1J0KA 3QCTL 1UH2A 5C0RH 1BD2B 1G0YR 1ZT4A 4HF5L 3SBWC 3JWNC 4P59L 1CICD 1KIPB 1EERB 4K7PH 3I6GB 4A6YL 5I19L 1H15B 5EZJB 5FV1L 5FM8A 5IIEB 2KL6A 4RGOL 1RJZB 2D9QB 5E8OA 2GSIA 3GM0A 5DJAA 3QPXH 2R2BB 1IM9A 3JTTA 5F8QC 3OMZA 1W72B 5D2LE 1VGKA 4XNZB 1IM3A 4WTZG 4TUKL 3N50A 1XAUA 1NGZA 4M4PA 2Q87A 4BYHA 4P2RD 5IVZA 3BP4B 5SWSD 4JFDE 2W38A 3SKJH 3RIFF 2YC1A 1G7IA 3AREB 2NY6B 2NYYD 5FO7B 3TBTB 1OTUC 4OLVL 4RA3A 2B8OT 4AYFA 5JOEA 3O6FB 1NC4A 3V4VH 4L3EE 3VGAB 1HHGB 1OOAA 4U1GB 4URTB 3MGOB 5EPMB 4PRIB 2Q7NA 1VPOH 3OG6B 1MUJB 4JFEE 4YIQB 4GKNA 3WN5A 3WXWH 5D5MB 5C3LD 1QHOA 4NKDA 3CJJA 4U0RB 3BSZL 4WEUD 5HGGS 5HGHA 2DTMH 1KLUA 3TNNA 3JV0A 5E8NA 4QRPD 2CMRH 1H3PH 2QKIB 2JK5B 4JFXB 3GJFH 4MHHG 3TC9A 4YHYB 3IU4H 2A77L 4LVNB 5CP7A 2HTLD 3QQ9C 3X17A 1U8QB 2DI8A 5GS1B 5F6IB 1YA5A 4CVWA 5K9OB 1HEZB 3RJQB 3TFKD 1BFVL 1YY8B 1T22B 4MQTB 4CADB 2UWEE 1RVFH 1CGYA 4TNWF 4I0PA 2G60H 1BVZA 2W07A 4GSDH 2GJ6E 4LDEB 5D7KE 4ZO7A 4YBHA 4MJIA 2VZOA 4LU5H 2BSTA 1JRHI 3L5XL 1ZLWK 4ZNCD 5DD3L 3B9EA 5J89A 3MJGX 4ZNEA 3GIZL 3O4LB 2EDLA 5EO1B 3NBNA 2BNRA 4CVZB 2PYEA 5JQHC 4FMKA 1XF5A 2VL4A 3P11L 1AH1A 1A7OH 1B0RA 3NACH 2DS4A 4NN5C 4CDGC 4M03A 1J0ZA 3PJSB 4GRLB 4MAUL 3QWOB 1XCQB 1Z2KA 2NY0D 3B9KD 4BFGA 2V17L 3IJSA 1T66D 3U82B 2CPCA 2FIKA 4JHWH 4R90H 1NBYB 3LN4A 4JPWH 4OF7A 3BN9C 1PX4A 2OK0L 1AD0B 3KPRB 5JMRA 1JPGA 2Y23A 4HUNB 1AO7D 3PGDB 4C54A 1T5WA 4TQEH 1MIMH 3MODH 3Q1SH 5KSBE 4WW1B 3C5ZB 1A9BA 1PEZA 4ZXBC 3MACH 3CH1A 4EQ3A 5IEKA 5IUSA 3KXFD 4LLQA 2UUDH 1WBYB 3H3BC 4UIKL 2OQJB 4TRPH 1ZHNB 4P5MA 1PVHA 4JAMB 4W4OA 3GSNL 2ADGB 3L3JA 1OARL 3UPAA 1NUFA 3T0BA 4XCCH 4XP4H 4LIQE 1GC1L 4UV4H 4J3SA 5BRZD 5F71A 5FYJE 4EN3D 4NQUA 3UTTE 3DVNB 1BAFL 3TH2T 1IGJA 1EZVY 3U30C 3QWQB 2CIKB 2FYYA 5IEHB 4MAYB 5SX5H 4R8WL 2W92A 4NP4H 4X4ME 1DVFD 4Z7QE 3T0ED 5D7SH 5K59E 1V3KA 3ULUE 1KJVB 4Z7NF 1DLHB 4GW5A 1B0WA 2G5BA 5DJ8A 3U4BH 5F1OB 4YHKH 3ULUC 3FQTA 4CVXB 1ZA3A 3VXUB 3VWKC 2G2RA 3B2UD 5K9KB 1MJ7H 5EU7E 5H2BA 2NXYB 2X4UB 1V7ML 2ENYA 1JBJA 5D7LE 3QEQA 2C5DC 4Q74A 4Y4FC 4EI5A 5EU7C 3TBSB 1KJ2L 1ZGLA 4OGAC 4IJ3B 2FD6H 3V0VB 4XNUL 2AKRA 1BQHB 2FJFB 3G6AA 3FRPA 3QXAA 2X4TA 5E6IC 3QIUD 4OF5A 2K3TA 2ZCLH 4R4ND 5HYFA 4UTBL 4L8CA 4KV5E 3WLWD 5F1NA 3TJEL 5C2BH 1U8IA 1KEGH 4AJ0A 3VRJA 4HV8A 5KS9B 4FZEH 5F3HB 3UAJC 4YHLH 3DNKA 2GKIA 3MV01 4ELKB 1RK1A 3JWDC 1ND0A 5HDQH 4M1GH 1VFAB 2VDQH 3EKCA 3H42L 3IDMA 3HLAA 5I1EL 3QO0B 3WEXB 4PGBB 1T1XA 1FNFA 3CU1A 5HHME 3QUZD 4K7FB 3GGWA 1TZIA 8FABA 3CFJB 1LO3H 3GSQB 3PE9A 1O7SA 4TULH 3W9EA 1JNNL 1LEIA 4JN2A 4Y2DB 1AFVH 1K4CA 1NCUA 5A1AA 1IAIL 2CUMA 3VFUB 2EXYC 2H32H 3D39B 4AMKH 2AGJH 2N56A 1KIRB 3I9GH 4PLNC 2AEPH 4NCC2 1NC2D 4GO6B 4M5ZL 1G7JB 2DQJL 2ADIB 4K71B 4UNTA 4RMTA 4W70A 1SJEA 4HCRH 4NKIH 4ZSOB 1U42A 5E1HB 2APWA 1EO8H 5MHSD 4L8SC 4MA1B 4M7KH 4XC1L 5D1QB 4DK3A 1J86A 1DN0B 1S5HA 2FX8L 2FLRT 4Z95H 1UEMA 3INUL 5FHAH 5GHWH 5CHNB 5HVWA 5T3ZD 5DD0L 2YMXH 3RVUD 4JG1H 5EWIL 5CFHA 3TEUA 1XGRB 2YPLD 4BKLB 2YOCA 4HIJA 3EZ8A 3U7YL 5IMOA 3UMTA 3QULA 2AW2A 3IFLH 1WZMA 1PDKA 4YDJA 4N8VB 1U3JA 1U8LA 2EKSA 2PYFB 4ZPVA 3OR6A 3S37X 4Q0XH 4PG2C 4RSVA 5EO9A 5CJBA 5B22A 1CDHA 4FFVD 2ZUTA 4JDTL 5CSBA 3I6LD 3RVXC 3BUYA 3LQZA 1N5AA 3HS0B 3TVMB 3QZWB 3FT2B 3NH7H 3QCUL 4MX7B 2AJ3A 2APXA 3VRIA 3IDYC 5I8EA 5DMKB 5HYSB 5C07A 3D1MC 2EC9T 3T2QA 3HI5L 5HYJA 3BH8B 4JB9H 3K2UH 1M71A 4IRSD 4GMTH 1B3JA 4HKXB 5F9OH 4M8VA 4O58H 5KW9L 1FYTB 2VL5B 5C08D 2XZAH 4H5SA 1FNSL 4K94C 5IB5B 3HNTL 3O8XA 4RAVA 4WO4A 3RPIB 2K7PA 1XFPA 5E08H 3HPLA 3CUPB 1IRAY 3CDGB 4TTGA 1WGOA 2X4NA 3C60C 3CIQA 3CK0H 4H20H 4OGXL 1MCOL 3BIKB 4LCCC 4OCSL 1MCQA 2X4OA 3G5ZA 3H9ZA 1W0WB 5FCUL 3MZTA 2EE9A 1CT8A 4X4YB 2BVQB 3MRBB 5J11C 5EU3B 2Z35B 5D1ZD 1AQKL 4M48L 5FHBL 3QDME 4RWHA 35C8H 3K4ZA 4L5FH 1DSFH 1AGDA 1U8NB 4JY6A 1S7VA 1WUNT 3EO1A 1B4JH 3R06A 4P0DA 1FDLH 4NQDD 3UPRB 4YXKH 2IJ0C 2VDOH 3TO2A 4JR9H 2IAMC 4QF1A 1A4JB 1CICB 5C09A 3V7AG 1Z6JT 3H9HB 3PHOB 4X6BB 1BVKB 1NUDA 4BZ2H 1IKFH 1U8JA 5BXFA 5KN5B 1R5VA 3PIQA 5TH2B 2O5ZH 3ALXA 4MDIB 4WW2C 5I74C 1N59A 5LKNA 5AZ2L 5C86A 3VFSB 4MMZC 1PQZA 2VZUA 5JLZB 1KXQE 3V6ZA 4UT7L 2XPGA 4MJ6B 4Y5YC 5EBMB 1LO4H 1MCNA 4P2RB 5M94B 5SWSB 4D0CA 2DJUA 1U2HA 4KK5C 3ARFD 4QXGL 3TV3L 2AJXL 2VE6A 5TE7L 2Y36L 3TZVA 4QOKE 3GFUA 4OZGB 4ZUVA 2VABA 2CKNA 4LKCA 4OLZL 5DLML 2NY1C 4JG0L 1X4YA 5ETUA 1IBGH 3LV3A 4KROD 1JF1B 2OP4H 5I73C 4UDUB 1QP1A 1KCVL 4QRPB 1LE5B 3H7LA 4XP1H 1HNGA 2Y07L 4N0UA 3EYVB 2AV1B 3L6FB 3FONA 3EJJX 4QHUA 4XWGH 2D31A 3H7BA 4AEHL 5J3HC 3MRRA 2ESVE 1UZ6F 5LGJB 1ZVSB 2YA2A 1R5WA 4JRXD 3CVHL 1BQHG 4NHUA 1I8MB 3KPPB 3VG9C 3BOVA 1KFAL 4NO2B 3T08A 3IVKB 1FO0A 1JPFA 1RAMA 3IS1X 5EZIL 5E7FA 4Y4FB 1R3LB 3FN3A 1JGVL 5IHLB 4LL9A 4OD3L 1U9KA 5C0EA 2YBRA 1J1XH 3I50L 2E7MA 5MEQB 2EXWD 4D9LH 4ALAH 3OHXB 4JFFD 4XX1G 4AK1A 1MCEA 2HT2D 1K3IA 3MO1B 4GT7A 1CGTA 2WUCH 4E0RA 2A2QT 5B8CB 4X6CE 5CUSL 3KLAB 2NY0B 1BJ1H 1I9EA 3O3DA 4EUPB 3U9UB 5GZNC 1PX3A 2ZSWA 4JDVB 3OKLA 5GSRB 4TNVF 1JWUA 2P24A 2P5WE 1CGWA 1YEFL 2VO5A 4F7PB 5IOPA 3ZE0F 3LKSB 3QG7H 1FAIL 3RIAF 3FOLA 3TN0D 3MROB 3V5KB 3K8KA 4PJXE 1AO7B 2A1WH 3REVA 3O2DL 5H35A 1T21A 3QWRD 3G6JA 5JHLL 1SEQH 2MCPH 1A6TB 4JY4A 3NCCB 2W91A 1F8TL 1DCLA 3I6KA 5HHMB 4HULB 2DM7A 5J8OA 2FWOA 1QQDB 2VDLL 4R6UA 3KXFB 3U48A 1IL1A 4NGHL 5HYQA 2PW2B 2R0LH 4L4TD 5FA3B 3RUGA 1S78C 4R26L 5JXEC 1R5IB 4YO0B 2DIAA 4X7SL 4DW2L 5IR1B 4ZTPH 1FPTL 1E4KA 3QDGE 4G8FB 3QG6B 3FFCE 4NDMB 3MRKA 1RZIA 3H0TB 5BRZB 3P30H 2MKWA 1B88A 3NA4A 4F7CA 1ES0B 3GRWA 5B21A 3F7QA 4JN1H 2WINA 3UTSD 3MXWH 4XVJL 5A16A 1T3FA 4WWKC 3RAJH 4APQC 4KJYA 2IEPA 4WNQB 3PWVA 3C5JA 3B5TA 1JVKA 1I9JH 1E6OH 1TJGH 5T5FL 4IOFC 2PR4L 3T0EB 2ZG2A 5C0CE 4Z76A 12E8H 4HS3A 2B20A 4BH8B 2NX5E 4N8VG 4WVRA 2HFGL 5MP6H 1T6VN 5JOFB 4Q97A 2EYSB 2J8UB 4ZTOH 5ABDE 2VZ1A 3N9GH 1HH6B 1U6AH 1Z3GL 3C6LA 5LAXB 2E8ZA 3QNXB 4HHAA 5DRXB 3ZYZA 2WZPD 4XHJD 3WNLA 2CRMA 1A3LH 3QZWG 5C0JB 4LBEA 4WFFD 1KPRA 4XI5C 2Q6WA 2WBJA 3V6FA 2HKHL 5HYSG 3VXQB 1D5IL 3EOBA 2O5YL 1MF2H 3QIUB 3T04D 2NLJA 3IDUA 5F88A 4XCYA 4WFGD 1MAML 4Y1AE 3IGAB 4EXKA 2R4RH 2XFXA 4HIEA 1CGSL 1I8IB 1FZMB 3ARDA 1IGYA 4LMQI 5EOCL 1PLGL 4YQXL 1I7ZA 2Y25A 2QQKL 5IBTL 4HX1B 5CBEB 15C8H 3IKCA 4KRPC 5E4IA 1UFUA 5IKCA 3ARPA 1U0QA 1OAYL 5ICYB 2PUQT 3ARXA 3UZQA 3MLXL 4PB9H 1DANU 4MSWB 5EBGA 3V6BR 1PD6A 4PJ7E 3FO0L 3OR7A 5E9DE 5E8EA 5MEPB 4PLKD 1MRDL 2VISA 4QXTA 4K55A 4O2FA 4PJHE 1J87A 3C60B 3K7UA 2A9NL 1Q38A 5JXAL 1EEZA 1EHXA 3RNQA 3MR9A 4LCCB 1AXIB 4LSQL 1HHJA 1EEUA 4OM1L 2FZ3A 4Q6IB 3GMPA 4FFZL 4XTRC 4LSPL 5FGCB 5C8JA 3BVNA 1OGTB 1HK6A 3CPLA 3SDDC 4YHNA 3RGHA 4LKXB 1A1OA 1NC2B 3BEVA 4GQ9L 5EUOE 1AXTH 4DEPB 2EE3A 4ORGA 4NWUL 1YEGH 3KWWB 4M61A 4JPVL 1T7WA 5C6TL 1J05B 2FGZA 1ZK9A 3VFVB 1OAUL 3HE7C 3T1FA 1QSED 5HGDA 3BMVA 3ULSB 1S5IL 2BFVH 2QHRH 3NIGF 3G04B 1IT9H 4KKNA 4OZFB 2F58L 4NZRH 3FQNA 3DETC 1OF2A 1AQDA 4M00A 4ZS7L 4J3UA 3GSVB 3LS5L 3U7WH 3RWEA 3V2AR 2YPLB 2XG4A 5DUMH 1M6OB 3KAAA 2NNAB 2L7JA 4XT1C 1GGIL 4V1DD 1ADQA 2PO6D 1NAMA 1IM9D 2XOTA 4PRNA 5IFHL 1WZ1L 4XBPB 2HP4A 1NH6A 5DUBB 3U0TB 1N4XH 3WFEH 2ZUQB 2VXUH 2OR9L 3OF6D 4P2QB 2DD8H 5I1DA 3VD4A 4GUPB 4HFWA 2BVUA 5KSAC 4HC1L 2DQCH 2H45A 3VCLA 1A6PA 4RNRA 4M9OA 1HXYA 4HUUB 1CGVA 2GFBA 5TF1H 3X13B 1H8NA 2V7NA 3C2SA 1HIML 4ZYKB 2IFGA 2A6KA 2NY1B 5DUPH 3WYRA 4HBQA 3LB6D 4IRSB 1I3RA 5FF6B 1C7SA 1U8KB 4X99A 4OD1L 5I18H 4PRHE 2I9TB 3MV9D 5DJ2A 3FAWA 1JFQH 2AK4A 4XPFH 4J1UB 5C08B 1I3GL 4K3JH 4H88L 4IDJH 4LQFH 1QFWL 1JGEA 4ETQB 1T2XA 3FN0L 1U93B 3HNVH 4EBQL 4J3XA 1LD9A 1Y6MR 3DYMA 4HJJL 1OB1B 5EA0H 2VLKD 5DHVA 4KH2A 3ZT7A 3SE4A 3WLBA 4OD2A 3UBXA 4CL7A 1FFRA 1PG7W 2WIIA 5D1ZB 5KANI 4J4PC 4ZUTB 3QQNA 1P7KA 3DO7B 3MA9H 2VXVH 3SE9H 1ZTXL 1SQ2N 1WZLA 3S5LB 5JW4M 3DX6A 5I2IA 3VFGL 4NQDB 3CFBB 4OV5B 1IGTA 3KPNB 4CNIA 1QA9B 2EYRB 3BJ91 5IGXH 3QBTB 3FQRB 3IETA 5D1XC 4KHTL 3DUSA 1BZQK 1P9MA 4Y8AA 1CFQB 1YMMD 4OIBA 2EC9U 4MZ2A 1EVTC 4F58H 4KVNH 4WEMB 3FB5B 1QFUL 3KDMA 4YEFA 4YUEL 4WI5A 1NANI 4GRWB 5FM5O 2DLFH 2R0ZH 5EN2A 2W9EL 4KI5D 4G9DB 1QLRB 4U1KA 3KPQB 1MHCB 2F5AL 1YNTA 4ISVB 2DIBA 5DJ0B 5GGTL 4OZIA 1URLA 5D93C 5C0RL 3LKNA 3T0XA 3QXVA 5C0BE 4HWZB 4XP9H 4NQXB 4FOMA 1TETH 4AIOA 3THML 1AHWB 2H9GA 4K7PL 1C16A 3T77B 5TGBB 4XH2B 5DFTA 5JIHA 4N1EA 3BQUA 3ARFB 1MHHA 2F19H 1FRGH 1MCRA 3FFDB 3EOYG 3MUHL 3QPXL 3QUXB 4B53A 1A14L 1U91B 3LH2H 4JZNB 4OUOA 1D5BB 1DDHB 2P8PA 4LDOB 2B5IB 4OCRL 3N1PC 2A74A 3OGOE 2ATPA 2JJVA 3QPQC 1MCSA 1F6AA 5CSZB 3SKJL 2ZG1A 1WWAX 3QAZC 2P8LA 4ONGH 4QRUA 4LHJB 4P3DB 5INCA 2EDRA 4PTTB 3GIVA 2UYLB 3PWPD 3RL2B 3V4VL 4FQ2H 5H37H 4M7JH 3L3KA 2VDNH 4UILL 4X6DE 1QD0A 3U0WH 1PW3A 3FT4A 3HRPA 4P5TD 4U1NB 1VPOL 2Y7QA 4FRWA 3RVTC 5F6HI 5BVJB 1EIBA 2GUOB 3WXWL 1BFSA 4M1CC 4NQCD 2FRGP 3GHEL 4X7EC 2DTML 1W0VA 2ZPKL 3HE6A 3GSWB 2OS7A 2VAAB 5GGRY 2W0PA 4M9PA 3Q5YA 1QR4A 5GZOC 3HC0B 1NJ9A 4Y16D 1RZ7H 5J56B 4PJ9C 4EI5D 3HHRB 4JFFB 2YA1A 2Z8VC 4FQQA 4DOHE 3WD5H 2VZTA 1TJIL 4QHKJ 1RVFL 2G60L 3NGBB 4GSDL 1KF9B 3V4UH 4RISH 4LU5L 1D5ZB 3O6LL 4OLUL 2HFFB 2ICES 3IDGB 43C9A 4JANB 1DQMH 4NQTA 1KN2H 3MRFA 4XVUD 2VUOA 1KG0A 3TN0B 1RJLB 5FO9B 5HHOE 4U6XA 4DVBB 5EBLB 3VG0L 4X5WA 3BZFA 3DVIA 4PPTA 3NACL 2DYPD 3ZKSD 2N1KA 1AI1L 2RR3A 3CCHB 1V3JA 1NFDE 2E7CA 5GS3A 4BJLA 1MFCH 3BDXA 4NN7B 3WNNA 3L3HB 1G6RL 4L4TB 4R90L 3U7AA 1FO0H 4MDJB 1Q94B 4JPWL 3L1OH 5D4QA 1BFOA 3ARWA 4JO3L 4GAYA 1RUKH 5EU4A 1OTTC 1RUQH 3JV4A 1HXMA 3SDDB 1C08B 1L9NA 3KR3H 1REIA 3G08B 3SDXE 4G42B 2ICCA 4TQEL 2OCFD 1HSAB 3MODL 3NCEB 1RY7B 4BELD 5GJSH 4J3WA 4RFOL 4OZFG 3VXSE 3MACL 5T1DH 3UTSB 4ZFFA 3HR5A 4FQ1H 1IC5L 2R39A 5CEYB 4JZJC 3JVGC 4NKMB 5JTWA 4TRPL 2FHCA 3QHTC 4GXVH 2FX7H 4XCCL 5TFSH 1MLCB 2PXYA 3VXME 1FLRH 5E56A 4UV4L 1AE6H 3P0GB 3SPVB 1TZGL 4G8IA 4PJEE 3V6OE 4HMDA 2CO7B 3DGGB 2HVJA 5F1IA 3QCVH 2XWBA 4KKLD 5SWZA 4WV1B 4I77L 4XMPH 3NCYS 2OTWB 1A9EB 1SM3H 4NP4L 4PP1C 3HG1A 5D7SL 5D2NB 3QP3A 2EYTB 3ARSA 5IHZA 1QKZL 4OLWL 5DI8A 5I1CH 4EZMA 3BZ4B 4UQ2B 4XB7A 1CIUA 1U95A 3OKEB 4YHKL 3GHBH 1EV2E 2R1YA 1CIDA 2J6EL 3WO4B 3DXAA 1MJ7L 1BQUA 2YZ8A 1QO3B 5E6ZA 5SV4A 3GRWH 1FZJB 5K9QG 5CZXC 1ORQB 1EPFA 4LNVA 1PSKH 1R3HB 5C0DA 4FP8H 4P4KD 3RY4A 2FD6L 4KUZH 5AD0B 1FE8H 4N5ED 1T20A 5J6GA 1YZZA 2HT4D 4POUB 1KYOK 1QLFB 1K2DB 3GSOB 5J9PA 5JA9A 4RX4D 4JKMA 3TBYA 4MLIA 5DVKA 2ZCLL 5B4MD 2Z31A 2ZUSA 1N2RB 1KEGL 4L4VD 2XV6B 3VFMA 4UI2A 1AIFA 4POZC 4AY0A 4YHLL 1Z9MA 4K8RL 5ACLA 2CRZA 1NBVH 4M1GL 3S5LG 5HDQL 2DQTH 1UCBH 3SO3C 2CDGA 2VDQL 1NUGA 3PABB 4WDIA 4WHYH 4IIQA 1QPXA 3UP1A 2AEQH 1NMCC 1C7TA 3I2CL 1UYWH 1QG3A 1LO3L 2CIIA 3R8QA 1YY9D 5HYEA 4TULL 1VEPA 4LCWE 1BQSA 4LSTH 4DUXA 3LRSB 3BHBB 1QSEB 5TDPA 4UUJA 3QIWA 1FZKA 2FSEB 5EBWA 5T1KA 3LKPA 2KH2B 3TPUB 1GGBH 2DQGH 1I3UA 3OGCB 3DMMC 2E9WA 1KV3A 5SX4I 3I9GL 2AEPL 5CJXA 2P7TA 3BP7A 5IV2B 1MFBL 3DVFA 1DR9A 3U46A 4JQXA 1B4RA 1WBZB 1KEML 2FGWH 4JKWA 4HIHA 4OAWA 3P77A 3PQYA 1WWCA 3C9NB 3MOAH 4N9GA 3ARRA 3RWGA 4UQ3A 3N1QC 2K1MA 4HCRL 4DTGH 2ZG3A 4NKIL 2UVFA 4KK6D 4C83A 1VFBA 1FV1B 3QEHA 1JWMB 1EO8L 4K2UH 4M7KL 1FL6B 1QEWB 1FL5A 4V1DB 2PO6B 1UWEL 5JOPD 2DLGA 1I75A 3QUKA 5EOQL 4CUCA 2HG5B 2NY7H 4I48A 1AGCB 4ODUB 3ZO0A 4XNMA 5FHAL 1AGFB 5HI4C 4HKBA 3FQXA 5K33A 1LDPL 1A1MA 4J23A 1B6DA 4NM8L 4Y5XB 1QHPA 4RA0C 4NZJA 5GGSB 2G9HA 1Z0NA 4KTDL 3BIBX 1A7QH 5KSUA 1S7WA 1KC5H 3T4YA 3ZKXC 5HHPB 1WLHA 3LQAH 3OZ9H 5E4EC 2V5RA 1Q9KB 4OZIF 4RFNC 1RJYA 4PJIB 4Q0XL 3GMOA 1E28A 2IQAB 3MV9B 1MELA 4NC1E 5DDHB 1T1YB 3KYNB 3H9SD 3QAZB 4MS8C 1OCWH 3RZCD 1TENA 4NZDA 1RIVL 3NH7L 2RQ8A 4MD5A 5EOCJ 4NC1C 4LFHD 4WHTB 3SDAA 5EOTA 4JB9L 2BOBB 2R2HB 3PWJB 4W4NA 3K2UL 2VLKB 4XBGA 4BZYA 3MRIA 4W68A 1ADQH 2H1PH 4GMTL 1NAMH 1WFUA 2R8SH 3D2UB 1EA9C 4U6TA 5KVDL 3VGBA 4AENB 1TQBB 5CD5D 2YD3A 2A0LD 4PGDA 4C56D 2WUBH 1U8HA 5E03A 4ZAKC 1Q9OA 5E08L 3EJZC 3IDIB 3VE0A 3TJHD 5ECJE 3CK0L 3PWUB 3WIFB 5M95B 4O51B 4Z78B 5LWYH