3MMEA

Structure and functional dissection of pg16, an antibody with broad and potent neutralization of hiv-1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
237
structure length
235
Chain Sequence
QEQLVESGGGVVQPGGSLRLSCLASGFTFHKYGMHWVRQAPGKGLEWVALISDDGMRKYHSDSMWGRVTISRDNSKNTLYLQFSSLKVEDTAMFFCAREAGGPIWHDDVKYYDFNDGYYNYHYMDVWGKGTTVTVSSASTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PG16 HEAVY CHAIN FAB
publication title Crystal structure of PG16 and chimeric dissection with somatically related PG9: structure-function analysis of two quaternary-specific antibodies that effectively neutralize HIV-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 235
sequence length 237
chains with identical sequence C, H
ec nomenclature
pdb deposition date 2010-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mmeA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mmeA01
3L3HB 3QIBD 1WEJH 3K4DA 1DBML 5GIRA 3DETD 1KELL 5CMAB 4I18A 4PJ7F 5GS2D 1KFAH 3LOWA 4MMZC 5J12B 3DI2B 1KCVH 1I9JL 1EUTA 2YMXH 2CSPA 3QDGD 4GO6B 5I8KL 3TFKC 3SDAA 3SHSA 1FC1A 2NY2D 2VTFA 1G7QB 3VCLA 2HJKB 3QFDA 2AJYL 2LABA 4XH2A 1P1ZA 4XMPL 2ZNWA 1S9WA 3GHBL 4PD4J 6FABL 2PN5A 4MXWH 4BFEA 3QEQE 5HPMB 3SGEH 2VUOA 4Z78B 4GMTH 3OPZL 2FRGP 4KJQD 1UVQB 4JQVC 4PB0L 3Q5TA 2X4RA 2XACC 4PJGB 1W0VB 4LLDB 3WDJA 5E5MA 2PW1A 4XVUD 4M5ZH 1K4DB 3ALXA 1OP3K 1GIGH 1T66D 4ODTH 5SV4A 1FAIL 3EHBD 3OAZH 5IFAH 2VQ1A 3QEQD 4PS4H 4P57B 3EDJA 3JBG7 2DQJH 5GGSY 5ALCH 3RI5K 2FHCA 1SJHB 2A1WH 1AD9A 1KTDB 1AH1A 3FB7B 3LV3B 3QUXB 1EHNA 2FJHB 4P2QE 3STZB 3KPPA 3V0WL 3VXRE 5I71C 1X3DA 1BFVL 3WV0A 1G0YR 4R26H 1Q9OA 2X4UA 1KBGH 4O51B 2YD1A 5EU5B 4ZS6D 1BQSA 5C0JA 1C16B 3FQUB 3O6FC 5IGXL 3MXWH 5I1LA 1KCSL 1IC1A 5MERA 4P2QD 1MFBH 4E42A 4X8JA 3MRGA 3IJSA 2PW2B 5HDBE 4ZTPH 4FFWC 4C58B 2GFBA 2HFEB 4YFLF 4PJFE 5DTFA 5C09B 3VFWB 4PJXE 2BVQA 1IM3A 5ETUA 2Y1VA 2V5TA 1XH3A 4UTBL 3DI3B 5A40E 5HGGS 2AEWA 3SY0B 4Z76B 1EFXB 3L7FB 1FPTH 5D5MA 3VXSA 1CD8A 3SBWA 1XF2B 4ZNEA 4Y8AA 1QVOA 3QJHA 1VA9A 1D6EB 1MF2H 4JR9L 2BY1A 3RUGA 4WO4D 1XAUA 43CAB 1DQQA 3R4DA 2HVKA 4TSBL 1CLYL 3DYMA 1S9YA 3G6DH 1TJIH 5JXAH 1QA9B 1LK2B 1QSEA 3DVNB 1FN4A 2QHLA 2ZPKH 3TIEB 3TO4B 4CU7A 3MRFA 1X5LA 4M3JA 5F6IB 3O3AB 3IJHB 3DYOA 4YUEL 5B22A 1NAML 2EEBA 4GT7A 2E7CA 4NQSA 3BD4A 2X4OA 3NOIA 4QXUH 1P53A 5F97E 4HF5H 5T5NG 4AMKL 1Z0MA 2WSKA 1NAKL 4LLYA 4G7VH 1FCGA 3O9WA 3CU7A 1DN2A 1WBYB 4XMLH 2E6PA 2WP3T 1KN4H 2A9ML 3RVTD 4J1UB 3EO0A 3DXAA 4EQ2A 3SDCD 1TETL 2IALB 4X5LA 1AKJB 1TJGL 3SE4A 5KSVB 4OD2B 4R7NB 4UV4H 3RAJL 1Q9LA 1J8HD 3I2CL 4HWBL 4X80H 5IW6B 4H1LA 4NHUA 3R1GH 2R2BB 4XPHL 4RFEB 3KLDA 4O02L 5DC0A 1AY1L 1T7ZA 5KSUA 4OV5B 2ARJQ 2HJFA 3JVGA 1F58H 1B0RA 3PL6A 1A14H 4YH6A 3SO5A 1QR1A 4NUJB 4WI4A 4KKCD 1CLZL 3WNPA 1KLGA 1IBGL 1NUGA 5DR5L 4J6RL 3U1SL 5DJ2B 1P7QA 1WLHA 2M2DA 3IAQA 4Y4HD 3CZFA 4P2CG 1C1EL 1OGAE 3MLXH 3H2WA 3BZ4B 1ORSB 2GUOA 2RCSH 3I84A 4HV8A 2B0SH 1T03H 4HT1L 4C54A 4HMDA 5IW3A 2CK2A 2EEDA 3CMGA 2H2SC 3BP5B 4PGBA 1ZLWH 1G7PA 2G9HA 2BERA 5LGJA 2V7HA 1AGCB 2ADFL 1OGAD 1HILA 1KPVB 3QT2A 2OJEA 2WK2A 2X9YA 3KJ6L 1HCVA 4LAQL 1S7UA 5DJAA 2YUXA 1EXUA 3RWIB 2VXUH 4F7TA 1E6JH 4JFZH 2H3NA 3LEXA 3G5ZB 4PRDA 3RU8L 1T1XA 4RMSA 1OWRM 4P5KA 4NFDA 1LP9F 4U0RB 4LLVB 4G8GA 1OF2B 3W11C 4R97C 4QXGL 5GSRA 4KKNA 3BGMA 4FZ8H 1VPOL 2XPGB 5GGRB 2VERN 1G1CA 4OFVA 2I9TB 3LRGA 5L7XL 2FO1A 1A3RL 2CJUL 2H26B 1JI1A 3IRZA 4PBWD 4QGTA 4O9HL 1IJ9A 1DUZA 3ARDD 3RVXC 3DARA 2C3HA 4NCC2 5KVGL 5DJXA 1U8KB 4G8IA 5D7IA 4F2MA 1P7HL 1QFPA 2DBLH 3ZDYF 3LKSB 1ZT4A 4Y5VB 3SJVD 4PJGE 3AFLA 3O6LH 1A21A 5D1XD 3EOTL 2XQYG 1J1PH 3GKWL 3FZUD 4OZFG 4OZ4A 5MP6H 4NM4L 5E24E 4LAJH 3T8XB 1VGEH 3HC0A 5C0RH 2VLRE 4IRJC 1B6UA 5EFIA 2WIIB 4G6JL 3WS3B 3QEGH 5F9JB 4DKEL 3IAPA 4NNPH 1FE8H 4LRIA 1MI5D 3FRPG 4F9PA 3QHFH 1SYVB 3M1BA 2WINB 4YDKH 1H3WM 4Y7MA 1J7VR 2YC1A 4HBCL 4QT5B 1YNTB 3QUZD 1AR2A 5IOPA 2VYRE 2CR3A 4KVCL 1FZKA 2BVYA 4OCXH 2VLRD 1VACB 1NFKA 1A6ZA 3FT4A 3MLRH 4NDMB 3DX6A 3U30B 4AENA 3W81A 4X99B 1YC7A 5JW5B 4MXQD 4QHNA 3BN9C 3W9EB 5HHXL 1A2YA 2NW3A 4MNGE 1ZS8B 2VR5A 3S4SA 3EYQD 5C6PB 4IRSB 4K2UL 1LEKA 2QADD 1JV5B 3NZHH 3VXMB 1M7XA 3MRQA 2NNAB 5IB2B 4D2NA 2DM4A 4K9EC 4NPYA 4NQCB 3KAAA 4P2YA 2LU3A 3L5XH 5F89A 3L6FB 5EWIL 4R4NC 4R7DB 4K94C 5EC1A 3RPKA 3WNNA 1RK0A 3SDXB 2VLJE 2JF1A 2XNAA 2NY5C 5CAYB 5L9DH 2W9DH 1CDGA 4PJ5B 3QUML 4LK4A 4KMTH 5HDBF 5A2FA 4K3DL 4PJFF 1S5HB 4PJXF 3KS0J 4LMQI 4RAVA 1OTTD 4J3WA 1I8KB 4G6ML 4GXUM 4KFZC 1QRNB 3MV9A 4HCRH 3WKML 4HZLA 5ID0B 2E9JA 2NMSA 4HS3B 5IESL 2VLJD 3TN0B 3IDYB 3PV6A 3TGXA 2FIKA 4TTDD 1CK0H 1NBVH 2G75B 5EPMB 3RTQB 1PGRB 2VZ1A 4U1IA 3CD4A 4M6OH 4Q0XH 3TT1H 3HS0B 1DLFL 2DQTH 2A77H 4PREA 1CT8B 5D6DC 2MWCA 3AMLA 1OT1A 5E56A 1H5BA 3WEXB 3A0OA 5D93C 5D7LA 3GMLB 4L4JA 1D9KC 1CGSL 4GXVL 3MACL 1EZVY 4YFEA 2QHRH 5BV7L 1JK8A 4PJCB 2YD6A 2V2WA 2CR6A 4P9ML 4JZOA 1EEQA 2NX5A 5EZOH 2V6HA 4FFVD 4GJTB 2BCKB 5DJDA 3TWCL 2NCMA 5DD3L 2JCCA 5F9OL 3CIQA 4AG4L 3FHAA 3V6OE 1QBLH 1Z0NA 5CSZB 3O4OC 1U8PA 2N7BA 4PRAB 1UQSA 3ARQA 3DROB 3U6RA 4MCYB 12E8L 4PTUB 3UTQA 2Z35B 2FJGA 4LVHC 4EUPG 4IIQA 4P9HC 5EU6B 4QTHA 3UDWA 3QWQB 4ZUWA 3OJDB 1JNLL 3SGKA 3O8XD 2R8SL 1KIQB 4JM2B 2GITB 4X6CA 5GSVA 3BYTA 4HGKC 2O61A 4LHUA 1OTUD 3WD5H 2ZCKH 4NRYB 4F58L 3QQ3B 4KK8D 4NO3B 1VADB 4B7IA 3NCBB 5E6IC 4LFHG 5IT2H 1R3IL 4F80A 1IAIH 4YE4H 4Z0BL 1R5VB 4WU5B 2ESVB 1CVSC 2AJ3B 3LKQA 3HE6D 4RX4D 3CSGA 1FORH 2R23B 4KU1A 1AC6A 2DOCA 3QCUH 4DEPC 1DLHA 4MDIA 4WWKC 2D7PA 2ICWB 3MROB 4ZFFB 4GKZA 5IEKA 2AV7B 3ALPA 5K9QI 3HRZB 4H88L 1UACH 5FM5M 3T65A 2GAZB 4PJDB 2C7UB 4YHZH 1LD9B 1YEKL 3GJFB 1UJTA 1V7NH 2HVJA 1UM4H 3DWTA 4LF3A 4DJMA 4D3CH 4EI5A 4OGYL 1FZOA 2GK2A 1NCAH 5TQ0H 4FA8A 3HB3C 4U31A 1UYWH 3PGCA 5D6CA 5HI3D 5C0EB 5SV3A 4ZAKB 4UQ2B 3GMQA 1NCNA 1HXYB 5K9KB 2AJSH 4U49A 5HYJA 5I1KL 5C0GA 1JF1A 1EAJA 1KTLA 4CU6A 4NWTH 3OAZK 5DZLA 2IANA 1AO7A 1CE6B 5ILTH 3U4BL 1WBXB 1VGKB 3DRTB 2X89A 1ZVSB 3ZYJA 2VZUA 4PJGF 4LRNL 2ZOLB 1VFAA 2APBA 1C08A 2Y7QB 3GSVB 3FB5A 3MNZB 2W65A 4P0DA 5T1MA 3MO1A 5FIEA 2V2XA 4M7LH 4N8VG 3F7QA 5HVWA 3HPJA 2ZUQC 3EFFA 5DUPH 1RZIB 4S0TD 4Q97A 1A6PA 4NQCE 4GAYB 5I74B 1ADQH 1EBAA 1IGTB 4I18C 5HDQH 2L7JA 2IQAB 3OKKB 3K2UH 4R2GD 5GGTL 3QDJE 5SWZA 2VDKH 2YKLH 4KWUA 4X6FA 3V0VA 5JHLL 3QFJA 1NGPL 4LEOA 1P4BH 3SDAC 3QI9D 3FQXA 3GO1H 4M7ZB 1H15A 1YY9D 4OCWH 3SCMB 1JRHI 5JQ6H 3BW9A 2YPKB 2Y23A 1LO4H 1Q1JH 1AP2A 2J88H 1QRNE 3O3BB 3RX5A 5HI5C 4HJ0C 3P30L 3BD3A 3QDJD 1GVIA 2BNRA 2Y06L 4N8CL 1INQB 2NLJA 5L2KB 2R9HC 1PG7W 4X98B 4S2SB 4ZD3L 4TQEL 4FQHB 5BCAA 2XWTA 1K3ZA 3MRIA 5J6GB 1AHWA 1N7MH 3PWPA 3QUMA 2IBZX 2H32B 4LASL 4K3EL 2UZIH 5DVMA 5I19L 1R3KA 3DX8A 1NCBL 1IILE 5I1EH 4N0CC 2CKBB 1X4XA 4JKMA 5H2BA 2HT4D 3MR9A 2HKHH 5GRVK 1XZ0B 4Z8FL 4P3WA 5INDB 4U1KA 4PV8B 5CGYD 5I1AA 4JEGB 4KKLC 5ITBH 4JAMB 1E0OB 3MCLL 4LCCB 4P2OA 4QYOA 2XQBH 5CZVH 5DT1L 3MRCA 5C0BD 3TP4A 5KSAD 2VITB 1RUQH 4OGAC 2F19L 5GS0L 5TH2A 4B0MM 2SEBA 4I1NB 1N0XH 5EB9A 1N3NB 2NY3D 4UAOB 5E8PB 3PWJA 5I6XB 3DBXA 3GJFH 4GAFB 1KEMH 1RJLB 3QIWB 4FTVD 3SKNA 3CH8A 4F7CB 2E8ZA 4JFFD 3UMTA 3SBWC 2P8LB 4GLRH 5HHVH 4MAYB 2CK0L 1HK6A 1NL0H 3KPLB 1KOAA 4ZOEA 5E94B 1UB6B 4UIMA 2P24A 5E1HB 2Z92B 2A6DA 3HNSH 5BZWB 3QH3B 1E4XI 3E2HC 1C5DB 5DHYB 2EC9U 4YXLH 3QXVA 4RIRB 3O41A 4IBLT 5JHDE 3HHRB 1ZLWK 1G9NL 4ZPTB 1JUFA 3RZCD 3G5VB 4O2EB 4LEXH 4I0KA 1TVBA 2WBJB 3VJ6B 3QZWB 2ESVE 1G7JA 3O9WC 3S34H 2WW8A 2NY7H 5EBMA 1FNGB 3U36B 5TE4H 3QQNA 1ZMYA 4OZFH 3VFGH 4IMLB 5JHDD 2X42A 3B9EA 2D9CA 5DD1H 3U0TB 3KYAA 4OLZH 4KDVA 1HE7A 1OAQH 5I17A 3ARBD 5IR1A 3SE4C 2W0FB 4K7FB 4NBYB 3IRPX 4RAUB 4OCSL 1FH5L 3T2OA 4L3EA 3BZFB 4Q2ZB 5C07B 2ESVD 2FX7H 2MCPH 5H35B 4YDJA 5ANMA 2DQHL 1CE1L 4U0QB 3GSXA 4PJDE 4B7LA 1FLRH 2F54A 4FQXD 4M62L 2YRZA 4JFPB 2OS7A 3JVGC 2FATL 3PL6C 4MLSA 3VXNA 4YDVA 4FQ1L 1LO2L 1BBJB 1JWSA 4JDZB 4UIKH 4PR5A 1RZKH 3T04D 2WZPD 2LVCA 1WJ3A 3GIZH 5F44A 5ELIA 3PNWB 3BGFC 4PUBL 3B3IB 1F6FB 4DUXA 2C4XA 2YD3A 5IBTH 2D2OA 4MD5B 3HR6A 4H5SB 3L3KB 4F7PA 1ZXQA 5IMOA 1MFCH 4UB0H 1IVLA 2H32H 4GBXB 4I0PB 5J57B 3BDYH 4QHMA 4HS8H 4RFNC 2ERJC 2XFXA 4EKXA 2ITCA 4CU8A 4YFLI 2R1YA 2P5WA 1XCTB 2NY0C 5DD5L 3VFUA 2DN7A 4XI5D 2CKBH 5E00A 3FQRB 1LK3H 3V5KA 1QFHA 4I3SH 1W0WB 2IPTL 2D31B 4H26B 1R6VA 5JNYA 2VC2H 4XAWL 3TYFA 3MMEB 2FEDD 3DMMA 3BKCL 3BHBA 3S5LA 2VQUA 4YX2H 5JXED 2KQMA 2V5YA 4KI1A 2KH2B 3S98A 1EAPA 4TULH 5EZJA 1ZWIA 4ALAL 5MI0C 3KPSB 2EIZB 1BJ1H 1IC5H 3EJYC 4W4OA 1I8MA 2H9GA 3V4UL 3MNWB 1JIBA 2YUWA 5I75C 1FVDB 2IMMA 5MEOB 4NUGH 4ZS7H 2ORBL 1TIUA 3E3QC 2EYTA 5L2KE 4JKKA 3TO2A 3AY4A 3DVIA 5DYOA 2NXZC 1XF3A 1TCRB 4N8VB 2OYPA 2EDKA 2AK4A 1DVFA 3LMJL 3LN4A 4KJYA 4EVNB 5GGTA 2HFGL 1RHHA 2BC4B 4HX1B 3ULVH 2Z31B 4F7MB 1Q72H 2FHBA 3V2AR 4KV5E 4XVTL 2PETA 1I1AD 3B83A 3LQAH 1QPPA 1GH7A 5L2KD 5KSBB 5GJSH 2NXYD 5CZKA 4FNLL 3N50A 5LBSH 1AI1L 5EO0B 2F5AL 3D25B 5IBLD 4LRIC 1NGWA 4BELD 3E8UH 3QCVH 4KK5C 1X5FA 4OUOA 2GJZB 4R8WL 4X7SL 3T1FA 3QUYB 5E2VL 3QIUA 2ZCHH 3I85A 4NWUL 1SVZA 4FFYH 5E4EC 5GGVH 5CCKL 2R1WB 3SOBH 2Z0BA 4DGYH 1F4WH 1MY7A 1CG9B 1T5WB 1KXTB 4P4RA 3K7UA 1MJ7H 5DJ8A 2PNDA 1CI5A 3LN9A 4YDIH 4L4TB 2R69L 3NCCB 4WDIA 5TE6L 3ESVF 2AGJH 2NY6B 4XBGB 2QQKL 3RWEA 4RAHA 1SEQL 4L1DA 4OTXL 3WSQH 5EZIH 3QRGH 2PCPB 2GY5A 3AAZB 4JQIL 1JF6A 2FX8L 4L4VE 3OGOE 2W0LA 1T04A 3MJ6A 4XNYH 4QRQA 2CUMA 3MRBB 1QEWA 3QG7L 2F53E 3DX9B 1MHHA 1D5BB 3WS6A 5T5NF 1MCEA 4JO1H 5I2IA 1LO5B 1Z5LB 5J0BA 3DVGB 4U1JA 3ULVE 1XIWC 4JFXA 3ZDXE 4G7YH 1CD0A 4L4VD 4PGCA 5E99L 1BLNB 1TLKA 2YRPA 2FB4H 4J3XA 1XGUA 1A6VH 1REIA 1U8LA 3GB7B 5T33H 4KHTH 5CZXC 1FBIL 2ZUWA 5DJZA 2F53D 1YQVH 2L7UA 4OFKA 1T4KA 3CFDB 3LKRB 3MRJA 4JHAH 5FKAA 5F7LB 4UQ3A 3BRGC 3EFDL 2XXMB 1TFHA 2R15A 2Q8AH 1CBVH 2DI9A 3O4LB 3JTTA 4WTZG 3WLWC 4EXPX 5KG9B 1KXQE 3MUJA 2P5EA 2FR4A 1J5OH 3V5HB 3V4VH 1OCWH 4Y16D 1MCCA 1K85A 1CS6A 1YPZB 3VDAA 2EC8A 3CVHA 5C07E 1VSCA 1I3GL 4Z77A 4LCIL 4X9BA 4WJ5A 4PB9L 1J8KA 3NFPA 1A6AB 1HDMA 1OB1B 5I1HL 3QNXB 3FONB 2BOBB 4EN3C 3QPQD 4C59B 2RFXA 1A6UH 4KUZH 5IB3B 1FZMA 3MNVB 4RGNE 3RDTD 1WWCA 1W72L 5I73C 5C07D 2Q87A 1HSBA 5ESQA 2QR0B 4OM1H 1N4XL 3TJEH 5IJKA 4NQDA 3T09A 5I71B 4V2BA 4LPWA 3KR3L 3M17B 4NO0A 4RGND 3N85L 3PQYA 4LFHD 5KVFL 3GMNB 3V52L 3ARUA 5HVHC 2AVGA 3GMOA 4PJDF 3CFBB 3WLBB 2AJXL 3WJLC 5LXGL 2V2TB 2W0PA 2KKQA 3O6FB 4HQQL 4U6HB 1EMTH 4IIQC 5IV2B 4K8RH 3UDWC 3V6FB 1DFBL 5F6HJ 5LVEA 1FFRA 2MJWA 3ZKQD 1ZT7B 4I0PD 1Z9SA 5DMKA 2CO7B 4MMXC 3WIFA 4Q7DA 3TT3L 3BISA 5E2TH 3ULUH 2VKWA 4TVPH 2NYYD 2VZSA 2NZ9D 5CEZH 3MGOB 1HKLL 3T1WA 4P4KA 3VRLE 5TF0A 2G5BA 5T3ZH 5D7JA 2OLDA 1KCUH 2O5XL 5CP7A 2RBLA 1MCLA 3PDOA 1A22B 2AJVH 4OF7A 3GMRA 4DW2H 1FL3B 1IGJA 2R0WH 4HLZG 5A2KH 3KYNB 3MRRA 5ACMA 4GW1B 2Q3ZA 4DGVH 1K6QH 2ZG2A 4JHWL 4XRCB 2Y5TA 4W6WB 4WV1A 4YGVA 4LQFL 4TNVF 3OTTA 1QRKA 2IFFH 3M8OH 4LSRH 4LSVL 3TBTB 1CIDA 1EHXA 1ZHNA 5H37G 4E0RA 3ILQC 3SQOL 4KJWC 3CGTA 2H1PL 4RGOL 1CD1A 4DGIH 4JKWA 3MBEA 4JG0L 3HZVB 1OLZA 5FK9B 4MSWA 3FB8B 5C0CB 3IU3A 4Y4KD 1X6LA 4U1MB 5I1GH 1UB5A 3BP4B 2P8MB 5HGAA 3L5HA 1DBJH 1GZPA 4K7PH 1OT2A 5CD3B 3TIDB 1FZJA 3CSBA 1UH3A 1J05A 3CFCL 2RGSA 5HY9A 3DO7B 1ONQB 3D39A 3QQ9C 3TJHD 4TVPE 2HRLA 1R0AH 1X7QA 1OY3B 1T1ZB 3VRIA 1TCMA 4JN1L 2YD5A 1MUJB 1NKRA 4QNPE 4KV5F 5ICXB 4E5XB 2X7LA 3QUYD 5LAXA 1CFQA 3U7WL 4B53A 1JYVA 1NEUA 4PLKD 4LIQL 3MV8A 4P2RD 1NSNL 2A74A 3MOBL 2Z9TA 4TVPD 4D0DA 5CLWA 4ZUSA 3S88L 5F72S 1KC5L 1MREL 2XYCA 3VD7A 3VA2C 3RVVD 5EULV 1EUUA 3DURA 4UZGA 1ZA3A 1A1OA 1OP9A 3MLSH 2EXYD 4E41B 4MNQA 1B90A 3QCTH 3BVNA 2UYLA 1NGYB 2EDQA 2DLGA 1IC4L 3D85A 3GJFK 1K2DA 2NTSP 3IDIA 4XPAH 5J3HC 2DTSA 2I9LB 1INEH 1U8JA 4EZMA 1QFWL 4JCLA 1MCHA 2FYYA 4YPJA 3TPUA 4JFEB 4AT6B 3SQBA 3VXUA 5CJOH 3CMOH 3BT2L 3C9NA 3DNKA 2RHEA 4WUUA 4R97B 4GAGH 4S1QL 4NQEA 3CDCA 5FUCE 5JPNB 2WMPA 3JWOC 5T1LA 4Z7OE 1TTFA 4JZNB 1S9VB 1AHWC 1GZQB 1N6VA 2RR3A 5SWSA 3QO1B 5BS0A 2WAHA 3BH8B 5IB4A 1NANH 4IOFC 5EU4A 1YPZE 4MJIA 3Q6GL 3ULVF 2BMKB 2I60H 3TYGL 1CWVA 3ZDXF 1TZHA 1XF4A 4ZPVB 1U3HC 5D8JL 3AREC 3FFCD 2B39A 4ZQKB 2XQYK 5I1IL 5AYQA 2AABH 4CMMA 1MH5A 3QNYA 1ZHBA 1RIUL 1DQJA 3EYVB 4TNVK 1WICA 4J4PA 1BQLH 3GM8A 5DZOA 4IRJB 4P2OC 3WO4C 2EKJA 5CHNA 2R29L 3I6LE 1FIGL 2PO6A 3GUTA 1A6TA 1UM5L 3DVFA 1TZGH 4FQPA 1DEEA 1YJDC 2F9BT 5GJTL 3F5WA 1YN7A 4OFYD 3IDJB 3WIHH 4NZRL 1C7SA 4L8SC 3BIKA 5FKPA 4IRZH 3IKKA 1RU9L 1B4JL 5BV7C 3GNML 1T2QH 1Q0XL 1W72A 4MAUL 3NFNA 2Z4QB 1F97A 2EYRA 2YZ1A 4Q6IA 4JRXA 4LDOB 3SGDH 1JPST 4YPGB 5DLML 1UKTA 4KQ3H 1RK1A 3IAGC 4YHYC 1RJYB 2YEZA 1MAML 1K8IB 5DURD 1QR4A 2VAAA 4PGDB 4QRSA 2W92A 4J23A 3RKDC 1HOCA 1WWAX 1KB5B 3HI6H 1JGEA 2Q8BL 3VI3E 1LEGA 1NUFA 3X14A 3TM6A 5ALBH 5HGBA 4QHKJ 1NPUA 2MQ3A 4GRLD 1N5AA 1UEYA 1J0JA 3MQIA 3PGFH 1JYXA 3WUWA 4NKIH 2I5YH 3PIQA 4KUCD 4JVWA 2NY4C 3C60D 1JZ7A 1HINH 3T0VA 3FB6B 5I1DA 5IK3B 4AM0A 3B2VL 3U4AA 4G5ZL 3HZKB 5K9OA 3OAUL 4XCFL 5HYEA 4HWZA 1N64L 3P4LA 3I50H 5EZLA 4YHNA 1DANT 1JN6B 3VW3L 4XP6L 2IPKA 3MLZL 4L5FL 3VRLF 5F7NC 2BSRA 4Y0GA 1TNNA 2VL5A 5F3HB 1UXWB 5C3TA 2KDGA 2OCFD 1SJEA 1DE4A 3DGGB 2OP4H 5D93B 3QJFA 4LVEA 4YBHA 4GG6E 2QJDA 3KDMB 1D9KB 2AK1L 4FQ2L 1HYSD 5D1QC 4JFHD 3LIZL 1A7NL 1EGJA 3OKOB 5FB8A 5I1JH 1JYWA 5DUBA 2FGWL 4KGJA 5FYJH 4PGJA 5E8NA 2H8PA 3RA7L 3HAEA 1FSKC 5F70A 1GHFL 1DQMH 1CGVA 4G6FB 3STLA 1QBML 2OZ4L 4OCYL 2X4NB 3FHQA 2BSTA 2BHYA 2VSDA 3OKLB 2DMKA 1MFEL 1FC2D 3U82B 1GOHA 4Y1AE 1H0DB 4G6AD 1S7SB 4OZGB 1PVHA 2QSCL 3DMMC 1ZE3C 3C5SA 4LVHB 2Z93B 4ZODA 3ALWA 4GKNB 5IM7B 4BH7A 4HC1L 5KW9L 1ORQB 5DJ6A 2CLRA 2QQNH 5MENE 3O2VL 3RVUC 2P7TA 3PHQA 4KPHH 4Y1AD 2VOTA 3IDMB 2J8OA 2WQ8A 5A43C 3ZE1E 4OGXH 5B4MD 1MJJA 5DK2A 4GMSL 5DD0L 4GFTB 4PRNB 5LJYH 4NZTH 3S37L 3AY4C 3L3OA 5E6IB 1NDGA 1JGDB 4ZUTB 5C0IA 5MEND 3WJJC 4Y19B 1DVFC 5CILH 4HJJL 3ECBB 1F90L 4JM4L 4WFGE 4ZSOB 1N5YH 4UUJA 2BOCA 2XZCL 1T21A 5FYJE 1KG0A 3I3DA 1AFVH 3OKMB 1MIMH 4DEPB 3NACH 4MQ7A 2HFFB 4LLWA 4WWKB 1DSFH 3AXLB 3W11D 4K9EH 1MCSA 4K23L 2BNQD 1JWMB 3E0GA 4PJBA 3MLPA 4I4WA 1RULH 1I4FA 5KVDH 4ODWA 1WZKA 1RZFL 3BP6B 4M6NL 3C6SA 1CR9H 1DCLA 3RX8A 2KQNA 1WQVT 3QRFM 2BK8A 1U91B 3QIUC 4RCAA 2YA0A 3B43A 3RVXD 1XGQB 5J7CC 3KYOA 3T4YB 3WCYA 1KPRA 3LZFL 4QRRD 2D7QA 5TPWH 4Z7OF 5CP3A 1CFSA 5J06A 3P4NB 5IQ7L 4G8EB 1YPZF 1CICC 4YJZL 4Z7WA 3LH2H 3W0WD 2ZJSH 4FABL 3F7RA 3BWAA 4RNRA 3VFRB 4X5WA 1U3ZA 3DSFL 4OD3L 1NFIB 2ADGA 3VGBA 5HDOA 1I1FB 4DK3A 4NRXA 3L3IB 4WW1B 5TDPB 4Z5RB 1A1NB 1ZLSL 2RQ8A 4R90H 3L9RA 1B9ZA 4Z18A 5L2JB 3WS6C 5EO1B 2LU4A 1V3MA 1VB9A 3EYSH 3HMXH 1CXLA 3IJYB 2IWGA 1QLFB 3HZYA 4L9LA 5GS0C 5D70L 4YNYB 3BQUA 4OZHB 1GAFL 2ZUQB 4Z7VB 3P11H 3IXAA 1NCDL 4RA3A 5C9JA 2VDLH 5GIRB 4HIHB 1OPGH 3TC9A 2HJLA 4I18B 3LSOA 4XXCA 3GI8H 1IKFL 3BJ91 5C8JA 1CLOH 4PY8J 3E6FA 3SDAB 1KJ3H 1BP3B 3VCLB 3QFDB 4OD1H 2MQCA 4XH2B 3VWKC 1P1ZB 7FABL 1IFHL 1QYGL 1S9WB 2B1AH 3H3BC 1U58A 5EOQL 5EOCL 4HPOH 1G9NC 3VGFA 1VKXA 3WXWL 3BAEH 2C3VB 5EC2A 4OLWL 1HXMA 4WHTA 4JPKH 2PW1B 3RY6A 1E4WL 3VI3F 4U1LA 2XI9A 2MTPA 4KRNA 3WUZA 3B6SA 4OLEA 1HEZB 4APQD 2VDOL 2OR8A 1RZGB 3SKJL 4OT1L 3VD4A 4RISL 1RMFL 1QSFA 1UWXH 5L6YH 1AD9B 2DS4A 1F3DH 3RPIA 3J7HA 5IJKC 1QQDA 1R3JA 5C0AA 3OX8A 1ZA6A 1BOGA 1GPOL 4UMGA 2M1KA 2KPNA 4PP1C 5DEGA 3U0PA 5JIKA 3K80A 1J88A 2BSSA 3ARGD 3MOAH 2X4UB 1SY6L 2V5MA 4LLQA 2EKSA 1F4XH 5C0JB 3NTCH 1C12A 5I1LB 5F7FA 4M7JL 1MSPA 5DS8A 3HZMA 3V4PH 3VGEA 3GJEA 4E42B 4X8JB 3MRGB 3RNKA 1BD2A 1A3LL 1UZ8B 1SM3H 5DTFB 2MHAB 2J8UA 2BVQB 5B8CA 4FQJL 4NN7C 5T3XE 1RJCA 5ETUB 4OLVL 1XH3B 1EZVX 4X7EC 2FX9L 3GK8L 3K1DA 4GG6F 2VABA 1JHLH 2AJZA 3VXSB 5HI4C 3HG1D 4GAJH 5E7BA 4PRIA 1PG7X 1QVOB 3QJHB 1KCRH 3RUGB 4JY5L 4P4KC 3HMWL 3AU1A 3F6LA 3DV4A 1DQQB 5T3XD 5D7JC 1YNLL 3H3PL 2F8OA 2OZ4A 5DMGC 4XAKE 2HVKB 1S9YB 2A73A 1S5IL 4PJ9A 3E2HB 1FN4B 3BPNB 1QNZL 3MRFB 4UBDD 2HT3C 3I9GL 4LARH 4NQSB 2OQJA 2X4OB 1I7UA 3T0WA 3SGJC 4M7KH 2LQRA 4I8DA 1CL7H 4Y19E 4LLYB 1U8IB 3VFVA 4XAKD 1DJSA 3O9WB 1KJ2L 4G43A 1DBAL 3UCRA 1S3KL 4ZSOE 3EDKA 3TVMA 1QHPA 3CZJA 1N59A 3EO0B 1MRDL 2DICA 5E8DL 4ONFH 4O00A 3TCLA 2UVFA 4GRMA 2HH0L 5AWNL 3BE1L 4RDQG 5D2LB 3MBEC 4NP4L 1OGTA 1A5FL 5M94B 4Y19D 3FO9A 3ZE1F 4NHUB 3QDMB 2ADIA 1U92A 3A6BL 3EOAA 1B3JA 4XTRD 2P4AB 5KSUB 3CDYA 2HJFB 2JELH 4WWKD 1A7PL 3P4MA 5DRWA 1B0RB 3PL6B 1QR1B 1ACYL 4OBRA 1OARL 2AV1A 5AZ2H 3KXFA 2Q76A 1KLGB 3RWHA 4LHUG 4KAQH 2YOCA 4PRHB 5L0QC 2ICWI 4EOWL 4WUKH 4YHMH 3O2DL 5C0FA 1TQCC 4JO3H 4GRWH 4G9FA 3BGFB 5EOTA 4JFQB 4Y4FA 4XCYA 4BYHA 4P46A 3IDNA 2IJ0C 2GUOB 1SYSA 3MLTA 4HV8B 5DVLA 2H6PA 4NBXB 3NH7H 4OSUH 4PGBB 1UADC 5L8LB 1MCIA 3PWNA 3GSUB 1MRCL 4UDUA 1G7PB 2G9HB 2D03L 3S36X 4RFNB 5LGJB 2V7HB 3RWJA 4GLRI 4OB5H 4YHLL 2NY0B 2ZUTA 4EBQH 1NC2A 2OJEB 1V7ML 4WGVB 3INUL 5DJAB 3HNTL 1EXUB 2LFGA 1YMMD 1H9VA 2MFNA 2H3NB 3LEXB 4XNUL 4Z7VE 2CPCA 4HK0A 4PRDB 2BY2A 3UYOD 4QKXB 3HC3L 4LU5H 3LKPA 2DLIA 1HH6A 1PQZA 4P5KB 4YHPA 5IVXA 1KCLA 2OSLA 4G8GB 5CIPA 5GSRB 2DL9A 5EA0L 5MI0B 3BGMB 2X9XA 5KVEH 3FAWA 4RSVA 3RWDA 5D71H 4I3GA 1OM3L 3KLAB 1YQ2A 5F1KC 5IKCA 5I75B 4XNXL 2HKFH 3B5GA 1DUZB 2I27N 5DJXB 3MUGA 2VN4A 5JR1L 2NXZB 4GRWE 1ZEAH 5D7IB 4N90E 4F2MB 2HMID 4XVSL 1XF1A 1ZT4B 1NQBA 3NABH 3WL9A 4XPBL 4S0SD 4BQ8A 3WFDL 3AM8A 4MDJA 3OZ9L 4XPFH 4P23C 2Y25A 3MBXH 4F57L 2FBJL 4OZ4B 4ENED 4OI8A 4D0CA 2R9HD 1MIEH 3HC0B 4XMKH 3LS5H 1II4E 2X1PA 4N90D 1JPGA 2PO6C 4JRYD 1K5NB 1TZIA 3X17A 5HGHA 4FFZH 1AGDA 4JG1L 3GRWA 3M1BB 2YK1H 4XWGH 2AXJA 2YC1B 3CVIH 5E2JA 5FUOL 5E4EB 4AEIL 4F7EB 5IOPB 4FRWA 4ORGA 1FZKB 1GGIL 3U7YH 4N0CD 1A6ZB 1WC7A 3DX6B 3ME0A 4IDJL 5D1ZC 4Q6IC 4RRPA 4AENB 3VH8G 1KJVA 4WEBH 3MCG1 4QHNB 4HUWA 2VQTA 2ARWA 3HI5L 3RWFA 1A2YB 3KNBA 2NW3B 4JLRA 4QWWC 2FWOA 2E8YA 3S4SB 4B41A 1UWEH 5K9QG 5HHNA 4PRPE 2HWZL 3B2UD 5FO9A 4QRPA 3MRQB 3VXSE 5JO5A 5KJRL 1FVEA 4BQ9A 4OGAD 1UEMA 2R4RL 5F89B 5EC1B 2JE8A 3WFHA 1BHGA 1PZUB 4KZDL 2DWDB 1RK0B 4DOHB 2XNAB 1XIWB 4CN4A 4TRPL 3L7EA 3AMKA 4PRPD 2ED7A 2YD9A 4WFFE 1INDH 2Y6SD 5CWSA 1JHKH 4DVRH 5HHOA 3T2NH 4K07A 4L1HA 4RAVB 1CFTA 4TPRH 4L3CA 4MD0A 3MV9B 5T1DL 5FA3A 4HZLB 4JN2A 3N9GH 1A4KA 4JDTH 3PV6B 4P5TA 5I30H 2FIKB 2ZOKA 1MPAL 35C8H 5BJTA 2X40A 2W91A 1ND0A 4U1IB 3HE7A 5DUML 4J7RA 3MLWH 1MJ8L 4PV9A 2K1MA 4PREB 5D2LE 4PJEB 3L1OH 4YBLC 3VWJC 5CINL 2Q3AA 1NAMB 2CXKA 5EU7C 2EYSA 5IJVA 1FNSH 5D7LB 4M43H 3QDME 4U1HA 2GJ6A 4LPTA 5CJQL 5IHUH 3CXDH 3Q3GA 2ZSVA 3DTXA 1TVHA 4EN3B 4YXKH 1BIIB 4J2XA 1F4YL 1JK8B 3JWNC 1GYAA 3JTSB 1CF8H 4JZOB 5FM5O 3IVKA 3CX5K 4H0IA 5CJBA 1Y0LA 2HTLD 5DJDB 1FFNA 3IF1A 4PRHE 1DBMH 3EZJB 3QDMD 3UJIL 4OKDA 1KELH 5C08D 4QEGA 5IFJB 1I9JH 4YHIA 1X5KA 5DZNA 2VLME 1UJ3A 2IAMA 5I8KH 3TBSB 5TDOA 1U8PB 4PJAA 5HVHB 5ACZA 3UTSD 1A47A 1UQSB 4NOFA 4DZBA 1KN2L 2AJYH 4M6ML 4PRHD 3UTTB 4XC1L 4XMPH 3UTQB 2FJGB 1A1MA 3GHBH 6FABH 3P0YH 4MA7L 1J9CT 4IIQB 5B21A 3Q1SL 3TBYA 3MV7D 4QTHB 3WN5A 2N7AA 3OPZH 3O2DA 4ZUWB 2VLMD 1XT5A 3OSKA 3IETA 4MX7A 5B3NA 4PB0H 1PYWA 4X6CB 5GSVB 4HAGA 2D0HA 2O61B 4LHUB 3LKNA 2J5LC 3DUSB 4R6UA 1FAIH 3T77B 2NY0D 3TEUA 4EDXA 4NM8L 5CJXA 4N8PA 4NQUA 3QULA 3VU2A 4I2XA 3V0WH 1HHKB 1PJ9A 2BNUA 5IROA 1U36A 1BFVH 4X6DE 1CDCA 2X1WL 4D94A 1N2RA 1DLHB 3P73A 4MDIB 1FNHA 3E3QE 4GKZB 5E5RB 1R24A 5IEKB 2JJTA 5IGXH 3G5XA 4Z7VF 1KCSH 1HWHB 3T65B 1T5XA 3EJYD 1I3RA 5TFSL 3B9DA 3EO1A 5E9DD 5KOMC 3NN8B 4HIJA 4CVZA 2HVJB 4DTGL 2HTKD 1IGIL 4LF3B 4EI5B 4IDLA 4UTBH 5FYKL 1AGFA 3FFDB 2VXTL 2NXZD 3PGCB 3X12A 5D6CB 4CMHC 1KLFA 1FFPA 5HHQA 4GUPB 4JR9H 4Y2DA 4XP5L 5HYJB 5FYLL 5C0GB 1KTLB 2JB6B 2QEJA 4FQIL 4TSBH 1CLYH 4ODTL 3T0AA 4AEFA 4GRWF 2IANB 1AO7B 4PFEA 1TTGA 1NGZA 4CVXA 1NEZG 1UWXK 2YBRA 1VFAB 4YUEH 1NAMH 5K93A 4R4FL 3WNMA 1G9EA 3LAFA 1C08B 4G80B 2VZOA 3L5WB 2EH7L 4AMKH 1N6QL 1NAKH 2W65B 5T1MB 1ZVHA 3MO1B 4L9LC 2V2XB 3X11A 3VXPA 3MGAA 2VN7A 3BQUC 3HPJB 4R0LC 3UC0L 4HKXB 3IKCA 1MFAL 3EFFB 3PP4L 1UWGL 3O11B 1EHAA 1M71A 3P3YA 5DFVC 1TETH 5HYFA 1TQBC 1AXIB 1TJGH 2DAVA 4K71C 5GZNC 2V5SA 4J12A 4XXCC 3RAJH 3UZVB 1XGTB 3CCHA 3Q5YA 2GCYA 5SWZB 3D0VA 3I2CH 4HWBH 4X6FB 3V0VB 3ZDZE 4LEOB 3FQXB 4NQXA 4XPHH 5E1AA 3EIFA 3EGSA 1H15B 4KY1L 25C8H 4O02H 1AY1H 3BW9B 4JANA 4JFOA 3RY4A 3VH8B 2IC2A 4U7KA 1AP2B 4KKBD 2HT2C 4G3YL 1CLZH 1IBGH 3VFTA 5DR5H 4J6RH 3U1SH 4O58L 1XIWD 5F1OB 2YN3A 2WWMC 2XWTB 1C1EH 4CDGC 1VEMA 2FLRT 1AHWB 3RY6C 1RUAL 3FN0L 2JIXA 3RQ3A 3PWPB 3HRPA 5CZXD 3FQNA 3QUMB 2JK5B 5ISZD 4X9FA 4HT1H 4PJHA 4PJEE 4BK5A 3GIVA 3K8LA 1LO0L 4BQ6A 1Q9KB 3D69A 1R3KB 5INCA 1G7IA 4N1HB 3C6LA 1MLCA 1U3HB 1ITBB 2HLFD 4AQ1B 3RWCA 4I5BB 3AREB 1BF8A 4U1NA 5ITFA 2ADFH 3TLRA 5HPOA 1F3JA 1WWWX 2E7LA 3VG0L 1MCWW 4RZCA 3MR9B 3KJ6H 4LAQH 5SX5H 4QF1A 2XG4A 1LP9A 1SVCP 4U1KB 2X4TA 3WDIA 5I1AB 3WE6A 1CFVL 3RU8H 4X6EA 1BZQK 1J0HA 1CXIA 4P2OB 2L4OA 4QYOB 3WO4B 4D8PA 3MRCB 3QIBA 5I76A 4ZO8A 5B38A 1ZK9A 1IGML 5DRXB 3IDXL 2GW5A 4EN3D 4HHAB 5D2LF 4KK9D 2GT9A 3STBA 4QXGH 5TH2B 4BQCA 5B8CC 2A2QT 1JGVL 2SEBB 4L8SB 3PWJB 4MGXA 5AG9A 1VPOH 2RJMA 2W9EL 2CLZA 1FJ1A 3DBXB 5AD0A 1BAFL 4HKZB 2CJUH 4AQOA 3CFIC 3QDGA 3UTTE 3PXJA 4MB4A 4N9OB 4O9HH 3S37X 1KULA 5KVGH 4OI7A 2P24B 2IQ9L 2ATKA 4BA8A 4X6BA 5A16A 4YHYB 1YYML 2OL3L 3IXTB 4YQXL 1DZBA 4PJ9C 3LPGA 3UTTD 1PD6A 3EOTH 3O41B 3AS2A 1RZJL 3GKWH 5DC4B 5JIPA 4W68A 2J6EA 3IFNL 1JUFB 1O0VA 4KJPC 4NM4H 1UCBL 1R5WA 1TVBB 3QEQA 4XBEL 5DSCB 5FYJU 5J1AA 3RL2A 1U41A 1G7JB 4G6JH 4NJ9L 2Q6WA 3JV0A 1LO3L 5EBMB 4DKEH 2BJML 4YR6A 1BQUA 5LQBH 2NY4B 5M7QA 3UBXA 4HBCH 5LWYL 5I17B 1MCQA 3IS0X 5IR1B 4G6KL 4KVCH 4ESKA 4QY8A 4L3EB 1U8MA 2HLAA 4YDJB 5J1SC 4Q6YA 3EOBA 5GGSB 3MCKA 4N5UA 3GSNL 3NA9L 2F54B 2PTVA 4P2QA 1F02I 5HHXH 2VWEE 1VFBB 2WUBL 3VXQA 4QXTA 4YDVB 4K2UH 5BZDA 2E9BA 3NCMA 4W6XB 3ROLA 5EN2A 4UU9B 4PR5B 5BVPL 2A83A 4X6DF 4JY6A 3ESUF 4WEUD 3QDHA 4OZIE 1A7OL 1AXTL 5JQHC 5EWIH 1IEAB 4N5ED 3EYOA 3ILQD 4Y4FC 4P46C 4N0FA 4KJWD 4PJFA 3I6GA 5D1QB 4WO4A 1IM9A 2IANE 4X7CC 4F7PB 4M9PA 5IMOB 3QUMH 3MSPA 2D7TL 4TNWF 3DX7B 1VGEL 5C0RL 4K3DH 1PSKL 1FSKB 3KJ4C 2XFXB 2ITCB 4G6MH 2ID5A 4LGPB 2R1YB 3VFUB 3WKMH 4JFYB 3H9HA 3SDDD 5E00B 1WFUA 5IESH 1FO0L 4LOUC 5DHXB 1UG9A 3AGVA 5MHSD 2O5YH 3V5KB 4LPYA 5IVNA 4XC3L 1SHMA 4LNRB 3ZSTA 3TYFB 1RV6X 1DLFH 5HD8C 1EBPA 3DMMB 4C83A 2NR6D 3BHBB 3S5LB 5CJ5A 3SDCA 1KB5L 1EAPB 5EZJB 1ZWIB 5EUKA 4I0CC 1J8HA 1LILA 2R4SL 1CGSH 2VISA 4GXVH 1Q9WA 3MACH 1LE9A 2VIRA 3PWUA 1I8MB 3F7VA 2AXFA 2H9GB 4XB7A 5BV7H 2NY5L 1FYTB 2BFVL 5FV2A 5JTWA 5MEQA 4P9MH 1OTSD 4ONOA 2PXYD 4XVJL 1VHPA 2EICA 4HW6A 2EYTB 2EIDA 3TO2B 5IVOA 5DYOB 1T20A 1XF3B 3TWCH 2AK4B 5F1NA 1DVFB 3JUZA 3LN4B 4WGWB 5DD3H 3H42L 1ACZA 3QXTA 1RHHB 1LEIB 5J3HD 4AG4H 4F8TA 4KVNL 2CDFA 3AM8C 3PWPE 4Y4HA 2EE2A 2EH8L 2AEQL 5BVJA 4P5MA 2V17L 2OTWA 4KRPC 3FQWA 1QFUL 2CXGA 3ZDZF 1FQ9C 1CFBA 3P4OA 12E8H 1YNKL 4XZUA 3RL1A 4GKSA 1NGWB 4XXDA 3QO0B 4GW5A 3ARXA 3T1FB 4KROD 4W4NA 1OGAA 3QIUB 1JNLH 2R8SH 3CH1A 3TT1L 3TBVA 4XPGL 3ILPB 4UNTA 4X5XA 3S97C 1FFQA 2XKSA 1U3HD 3QUKA 4P4RB 5D7SL 3H0TA 4YFDB 3ARED 1AGEA 2X44D 2B20A 4WDIB 3DV6B 4F58H 1BFSA 5J13C 4HWEL 3DLQR 3RWEB 4PJEF 1R3IH 4HH9A 1CICB 3CJJA 4Z0BH 2YRLA 3TBWA 4IHOB 4OAWA 1EDQA 1YEJL 1OHQA 3I3EA 1D5MA 1XCQA 1T04B 4HIIA 4M61A 2IEPA 4QRQB 3B8YA 3C5ZD 3L3HA 3NPSC 1QEWB 4HG4J 1J0IA 2PTUA 5E8OA 5EDXA 3ZT6A 3PDGA 1L7TL 3CX5J 5EU3B 3VI4E 5I2IB 3ARDA 4NNYA 3WIIL 4H88H 4TNWK 5IW1A 2N4IA 4JFXB 4P9HL 3RGVD 4PGCB 1JF5A 2F74B 4K3HA 1XGUB 1YEKH 2CDEA 1U8LB 3SJVA 1WV7T 1T2XA 2HJKA 2WP3O 5GXBB 5D1XA 5DJZB 4M03A 4RDQF 1T4KB 3MRJB 5FF6A 4UQ3B 3TA3D 4P5TC 5GQBA 3JTTB 1UVQA 2P5EB 2FR4B 3NIGE 1W0VA 4LLDA 3HE7C 5I1KH 1MI5A 2DQGL 3VWKB 1ZGLB 4HUNB 3U4BH 5EH1A 4L3EE 1QLRA 2YN5A 4QHUA 3QUZA 4Z77B 4LRNH 2VLRA 3NFPB 4N0UB 5BRZD 3MJ8A 1OVZA 3ARRA 1EJOL 1MHEA 5C7XL 1D5IL 2NY4D 2EC9T 4FQQA 2RFXB 2WUCL 2AQ2A 1DBKL 4J3TA 3IFLL 2CDGA 3U4EB 3WFBL 3MLVL 5ESQB 4P59L 3T0ED 2QKIB 1EO8H 2VO5A 4RFOL 2J7LA 4NQDB 2UZYB 2WV3A 5GGTH 2QQQA 4JDVA 4ZOCA 2HFEA 3GSNA 5JHLH 4NO0B 1UJ3C 4LCWD 1NGPH 3MRPA 2IAMC 3PQYB 4MNGA 4DN3L 3GMOB 3SY0A 4CVWA 1SEBB 1EO5A 1NCAL 4AK1A 2XG5A 5TQ0L 1UYWL 2ZKHL 1WT5C 2V5RA 5GHWL 3P30H 5H94A 5ERWA 4HKJA 4TSAL 2Y06H 3WN5C 1PZ5A 5D1QD 3H7BA 2E6QA 2R0KL 2YPLE 2RAMA 4NN7B 4TQEH 4ZD3H 5FCSH 4C57C 1RZ8A 3MLUL 5FOJA 2VLJA 4XX1G 3ZT7A 5IQ9B 1JTOA 1RUML 4OZIF 4YGAB 1DQLL 2P42B 3WIFB 1Q94A 3IJHA 1LQSR 4LASH 1S7WB 3HKFA 5I19H 1XGYH 1DQTA 1NCBH 4P4KB 2YPLD 2G5BB 1BFOA 5D7JB 1KF9B 5IHLB 1GRWA 1HWGB 2V9TA 2IH1A 5CP7B 1HHHA 2VXQL 1FO0A 1RUKL 4GSDL 5IROC 5EBWA 4HAFA 3PDOB 4MNHA 4PYHA 1EK3A 1QKZL 3GMRB 2BVUA 4J1UA 1FYTE 3MRRB 15C8L 1TJHL 2P45B 1QP1A 2HRPL 1UCTA 4OD2A 2JJTC 3VFPA 4YGVB 1BZ9A 3MCLH 3K2UL 3E1F1 5CEYA 3DHJA 4YHKL 5DT1H 5IBUG 1Y6MR 2XKUA 3QISA 2R2CA 1YEIL 1ZHNB 2F19H 4U6TA 5FGCE 1E4KA 5GS0H 5IVZA 4E0RB 4DFIA 1FYTD 4RFEA 2ZUVA 3O2WL 1KJMA 1SBBA 4QGYA 1CD1B 4BSVA 3MBEB 3MJ7A 4AY0A 3IU3B 2XWBB 5LGHL 3DGCR 3C87A 2CK0H 5DJ2A 4DKFL 5HGAB 2VDQL 3P9LA 1GZPB 4BK4A 4Y2DC 3LQZB 1FZJB 3V6OA 3BZ4A 4NCC1 5C70A 1J05B 5D2NC 5HY9B 3NA4A 4X0KB 1JZ3A 4YAQA 3BUYA 3D39B 3O8XA 1XGPA 3SE3C 4OQ1A 3BP5A 1X7QB 2WANA 1G9NH 3VRIB 4HCRA 5L0QB 3DECA 2X7LB 5CD5C 5ICZA 5I0ZA 4PJ8D 5LAXB 1CFQB 1P4IL 4ONGL 3I6KB 2QQLL 3QIUD 4F33A 2JJSA 1KPVA 3FQTA 2XT1B 1D5ZA 5SX5K 1A4JB 3MV8B 3HE6A 4RX4A 4D0DB 4ZUSB 4F15C 3WXVH 5F93C 1FNFA 1ETZA 4EJ1C 1CICD 2EE6A 1ZA3B 2Z91A 1A1OB 2DQHH 2X2YA 1CE1H 4MJ6A 3BVNB 2UYLB 4UDTA 3D85B 2P47B 1X5JA 1K2DB 3IDIB 4M62H 3ARFD 2P8PA 3O3EA 1U8JB 3F62A 1NGXA 3BP7A 2FATH 2FYYB 3TPUB 4NN6C 3QXAA 4ODBD 1F8TL 5DWUL 4FQ1H 1LO2H 1S7QA 2PTTA 4HXBL 3VXUB 3C9NB 4K7PY 1F2QA 4WUUB 4TUJB 4NQEB 2QV2A 1J0YA 5CEXA 4PRBA 1CL7I 3F58L 3U79A 5T1LB 2VLKE 5BS0B 5SWSB 4YXLL 2WNGA 2XN9E 5IB4B 3VI4F 3RVWD 5GRWA 5EU4B 5IMLA 4WI2A 3BFOA 1NCUA 3OKDA 5JOPE 3PXHA 3T8XA 2NY1D 3C6LC 4N0UE 3CUPA 1S78C 4Y5YA 4BZ2L 2EXWD 1CXKA 3N1GC 3S96A 2VLKD 2NY7L 5F9JA 4LDEB 5DD5H 4CMMB 1MH5B 1I9RL 2XN9D 3QNYB 3VWKD 1YECL 2JJWA 3JUYA 1ZHBB 1DQJB 4P23B 1P6AB 1KEGL 2F58H 3H9SE 2IPTH 5A3IC 5ID1A 4C56D 1JI2A 3KPNA 1JNHA 1RPQA 2DJSA 5FGSA 4XAWH 5JUEL 2R56L 4NDMA 3NIGF 5CHNB 3B9KD 1IEHA 3QIBC 3BKCH 4KH2A 3G08A 4NQDE 1WBZA 1WCBB 2PO6B 4UOW0 3GUTB 4ODHL 1DEEB 2EDOA 3DETC 2G5RA 2COQA 3F5WB 4ALAH 1EVUA 3RWGB 3BIKB 1G6RH 3PQYE 5DI8A 1HHIA 1YEFH 2FD6L 2GYSA 5LCVL 3KPRD 3H9SD 4J3OC 4L8CA 4JREC 2G2RA 4R3SB 3QI9A 3V4UH 1W72B 1DBBH 2NY2C 3NFNB 1ZTXL 2NNAA 3BH9A 3PGDA 1OAYL 2EYRB 5D1ZB 1V3KA 4Q6IB 4JRXB 2ORBH 2HYMA 2B5IC 3EO9L 5EBLA 1RK1B 3NFSL 3QDJA 5BMFL 2A6JB 2YEZB 3DJ9A 3LMJH 1AGBA 1GOGA 1E4JA 2HFGH 2VAAB 2CRIA 1KIPA 5DHVA 2C3GA 3K4AA 4QRSB 5F21B 1CYGA 4KJQC 2VJXA 4PYGA 1HOCB 3RIAF 4XVTH 4XVUC 4YBQC 1T66C 5E08H 1S5HA 1JGEB 4FXGA 1LEGB 4FNLH 1S7TA 3QWOA 1AI1H 4ORZC 2XZZA 2F5AH 3VFNA 1LVEA 1N5AB 4W6YB 4ZXBD 4R8WH 1IGFH 2MPAL 4X7SH 3PIQB 2XTJD 4M48L 5E2VH 4Q9RH 2CUHA 2MNUA 4NWUH 4WFEE 5CCKH 5DQDH 3NAAL 5I1DB 3EDDA 4AM0B 4H25A 4LSTL 1KB9J 4ZFOL 1CU4L 4K55A 5K9OB 4HWZB 2R69H 4ZS6C 5TE6H 5EZLB 4YHNB 5KVMC 1YN6A 2QQKH 5DVNA 1CD9B 5C0BA 2MOVA 1SEQH 2IPKB 1OD9A 2LVEA 2QL1A 4U2ZA 5KSAA 4OTXH 1KSRA 1OAXH 2YUZA 1C5CL 4JQIH 2BSRB 1QACA 2FX8H 5GS1C 1OOAA 1KIUA 2VL5B 1QD0A 2R2HA 4YBLB 3F7YA 3MXVL 4Z7UA 3VWJB 5C6TL 5KBNC 1O7VA 4QRTA 3GMMA 4RMVA 1K9TA 4UT7L 1U8NA 1DE4B 4FTVA 3QG7H 4JFFA 3UAJD 3TZVD 4HXAL 4L8DA 3WNLA 3K1KC 3HI1A 3BX7C 1FGNL 2XWJB 1M6OA 4LGRB 5FB8B 3AVEA 5DUBB 3D39E 1AR1D 1QSVA 2OR7A 5E8NB 1YYLL 2H8PB 3OHXA 1IKNC 3HAEB 3CU1A 3RHWF 1FBIH 5IBUB 2Z35A 3UZEA 1DUYA 4U7MA 1CVRA 3LKOB 3RZCA 2H45A 3E8UL 2D4FA 3GSRA 4WENB 2BSTB 5DQ9A 1Z2KA 3ZKXC 2ICES 1XEDA 2ICEA 3BKML 3EFDH 3RFZC 3MV8E 4FFYL 1JPFB 3W39A 2D7OA 1MQKL 4PY7A 1CTNA 1E27A 2EDRA 5JHDA 3RVTC 1ODAA 3QQ3A 3C5SB 3SDCC 4CVUA 4ZUUA 4BH7B 1I3GH 3ARBA 2DJUA 2W0KA 4LCIH 4PB9H 4LSQL 4UILL 2CLRB 2LAAA 5D72H 1AD0A 5EZIL 3PHQB 4PGEA 5I1HH 3H7LA 3VXRD 1Z6JT 2X5PA 4FQXA 2J5LB 3MRDA 1QPXA 1MJJB 5DK2B 1W72H 1S9XA 3NVQA 1T22A 3L3OB 2ZP0T 4ONHB 1NDGB 5C0IB 2AV7A 5FUZL 4X4YA 2BZDA 4V1DB 1Z3GL 1N4XH 2PYEB 3RIAK 1F11A 5J4MA 3GHEL 4TYUA 5SWSE 4UUJB 1D5XA 1BM3L 1JGUL 2BOCB 3KR3H 4Y4HC 1KG0B 3N85H 4MQ7B 5KVFH 4JHBA 4CNIB 4LLWB 5DA0B 2A9NL 5DMIL 3BKYL 5LXGH 2AJXH 4PJBB 1ZV5A 4I4WB 4M93C 4HQQH 1I4FB 3QEUB 1JBJA 4ODWB 3C6SB 1CGUA 3S7GA 1HKFA 2FJFA 2MQ0A 1C8PA 2E9IA 5KS9B 1M7DA 4WHCA 5I9QB 1L0QA 1DFBH 2FSEA 3JV4A 3VFOA 3FOMA 3KYOB 1HI6B 3DRTA 3TT3H 3C8KA 3VXOA 4CMHB 1CFSB 3EKCA 1HKLH 4P23D 5JXEA 1MCRA 1ES0A 5J11C 4OZFA 2O5XH 1OP5H 2APFA 4RNRB 3BWAB 4KUZL 4X5WB 4CGTA 3OQ3B 3QHTC 5F9WC 3NCJL 2DQFA 1A7QL 3L9RB 4GAYA 4P99A 4JHWH 1YC8A 2RB8A 3FRPA 4WIQA 4CN1A 1I1CA 3ARDC 2QSQA 4AL8L 3PWVA 4LSVH 1F3RB 3HZYB 4L9LB 1BEYL 3RHWK 3FKUS 4QOKE 3BQUB 4R0LB 3ES6B 1BBDH 3GSQA 3SQOH 4KZEL 5D1ZD 3NCYP 4KMQA 2ED8A 2YPKA 4PLOB 5GGQL 2H1PH 1TQBB 4K71B 2GQHA 2HJLB 4JFDB 1I1AA 3LSOB 4JG0H 2HG5B 5C8JB 3MA9L 4CN6A 1VERA 5L2KA 4GQPH 3E6FB 1S7XA 4QOKD 2UY6A 4P48A 4AEHL 2CIKA 3D9AL 3SEPA 2BX5A 3TESA 1WF5A 3CFCH 1OQOA 1RZJC 1U58B 3LRSA 4ODSL 1VFUA 4TVPL 4X7FC 4OLXL 1VKXB 3UTPE 3FAXA 4XX1E 4JN1H 5EC2B 3W2DL 5C86A 1HXMB 4RRPG 3V5DA 4WHTB 3D2UB 4MXQC 5I66A 2DTML 3ARZA 4U1LB 4MD4A 4LIQH 2ATPA 1NSNH 4Z7QE 3MOBH 5JORA 3EYQC 3N06B 2QADC 1QSFB 3S88H 1KC5H 2P44B 3MUY1 3DSNA 1MEXL 4LCCA 1RFDL 4ZFOA 2DIBA 1T0NA 2CUIA 4LSRL 1MY5A 5HYQA 1QQDB 1R3JB 5C0AB 1ZA6B 2Z8RA 3QDAA 1BOGB 1VDGA 2VITA 3GGWB 3BXNA 4KXZI 5DEGB 3U0PB 1OSZA 4JRWA 5E8PA 4XHJC 2BSSB 1IC4H 3VWJD 1RUPL 4Z7NE 4LLQB 2EKSB 4DGIL 2DD8L 4L4VA 1QFWH 5DS8B 1CDHA 3HZMB 3GJEB 5I1GL 5HGDA 3EYFA 4LBEA 3RNKB 3BT2H 4MJ5A 2F53A 1UB6A 1BD2B 1OTTC 4K7PL 4S1QH 5DFTA 5B8CB 1DQDL 2GHWB 2VDRL 1RZ7L 3LN5A 3QH3A 3I02A 4GXUN 2VNCA 2VABB 1EV2E 1B2WL 3TV3L 3S3PA 2AJZB 4RBPH 5IP4A 3IYLW 3Q6GH 4Y16A 4PRIB 5CP3H 3TYGH 4O2EA 4PTTA 4DQOL 3UP1A 5D8JH 3AU1B 3DV4B 3QSKB 1N26A 3O6KL 3ZKMC 1JTPA 2IADA 4X7TB 3QUXD 5I1IH 1FVCA 2A73B 4PJ9B 3HC4L 5HHMB 3CC5B 4IMLA 1RVFL 2FHFA 5C09E 1RIUH 4N0RA 1MCNA 5F7EL 5HJ3B 4EUPA 5JW3L 4RWYL 1C5BL 2OQJB 4JY4A 1I7UB 3RDTA 4DUWA 4FFVC 5C07A 1NJ9A 4V1DE 3VFVB 5H35A 2PYEE 2R29H 4M6AA 1FIGH 4G43B 5HVGB 1UM5H 4HZAA 2UUDH 5GJTH 5C09D 3O6ML 1BJMA 1N59B 4NZRH 2XTLA 3JWOL 3TCLB 4GRMB 2DMBA 1ZVYA 1RU9H 1B4JH 1XR9B 1Y18A 3GNMH 1HQRB 5F7WC 1EFXD 1BBJA 1LGVA 1OGTB 1Q0XH 1M4KA 3FO9B 4V1DD 5DDHA 4MAUH 2PYED 1J0KA 1L9MA 2EEAA 2VAJA 3BI9X 2ADIB 5KS9E 1U92B 4UI2A 1WK0A 3EOAB 3PNWA 5J8OA 3CPLA 5DLMH 1QO3A 4JPVL 5FA4A 3P4MB 5DRWB 4H5SA 1KTRL 5JW4Q 3O8XC 3TO4D 3KLHD 2AV1B 4LLMA 2Q76B 3RWHB 3X3FL 2OTUA 3NCEB 4HFUL 1OTUC 3PABA 2Q8BH 5TE7L 5C0FB 4G9FB 3QHZL 5EOTB 3DOSA 1RJZB 2D7MA 4Y4FB 3KPMB 3PHSA 4XCYB 1VESA 4P46B 3IDNB 2B8OT 1IZKA 1SYSB 3MLTB 3RNQA 3O0RL 1RIHL 1YJDL 3HE6C 4M7LT 1FFOA 4HULB 4UDUB 3KJ4B 5I15L 1MWAL 1AKJD 3B2VH 3RWJB 5F1IA 1UT9A 4ZMAT 4H8WL 4G5ZH 3OAUH 1NC2B 4XCFH 3RJDA 4HUUA 1N64H 1KT2A 4M1GL 3KHQA 2EIZA 1D3CA 3VW3H 4YIQB 3Q0HA 1CCZA 4HMEA 5GISL 3E6HA 4NJAL 4XP6H 3W9DA 3MLZH 4L5FH 5B39A 2Q20A 4MQSB 3QZWG 3LKPB 5FEBA 1PEWA 1HH6B 1PQZB 4YHPB 4JFDE 2VLLB 5IVXB 2OSLB 4FXKA 4OKVA 5CIPB 3UPRA 1G0DA 4N8VA 2DLHA 4GQ9L 2IG2L 5HI3C 3BQUD 4Y4KA 3ZTJG 4LQ1A 2FZ3A 1BX2A 2AK1H 4XP1L 3RWDB 4FQ2H 3LB6C 2DI7A 5IKCB 5DFVD 3LIZH 1A7NH 3BSZL 4JFDD 2FGWH 3HI6L 4LSUL 1UC6A 4YO0A 2X05A 4CW1B 3BDBA 3RA7H 3MUGB 4U6YA 4Y5YC 1DP0A 2X4PB 2O26U 5J9PA 1GHFH 3VD3A 2BRRL 3WL9B 2GY7B 1QBMH 2OZ4H 4OCYH 1Y6KR 3JWDL 2YR3A 4MDJB 5GS3A 3QUYA 3LEVL 3KYMA 4MQXD 5GRUL 4KRPB 4D0CB 5J6HA 3FO0L 1X6NA 1LNUA 1JHTA 4KTDL 4P2RA 3O3UN 1I7ZA 2MMXA 2QSCH 2YXMA 1JPGB 4J8RA 1MLBA 5I8OL 3D2UD 4HC1H 2OXHA 1T1WA 1TZIB 5HGHB 5BQ7A 5KW9H 4HGWA 5DJ0A 1IT9L 4TSCL 3O2VH 1X5XA 2DYPB 4Q9CA 4PP2B 1Z9OA 4JPWL 3AAZA 1I75A 2DM7A 4ORGB 4PLJD 2ZCLL 3QI9C 3HUJA 1YY9C 2Z8SA 4L9DA 1WC7B 3ZYOA 5HYSA 5JOFA 4GMSH 5DD0H 5J13B 1BD2E 1D5BA 5DEFB 3RWFB 3KNBB 4Z7QF 1LO5A 1Z5LA 1SQ2N 4A6YL 4JLRB 2FWOB 1F90H 3F7PC 4HJJH 4JM4H 1WZ1L 4OIIL 1ZGLM 5HHNB 1EH9A 2XZCH 5FO9B 2DDQL 5JO5B 3NPSB 3IFPA 1FVEB 3GBML 5CSGA 4MVBD 1IE5A 5I8EA 4K23H 3AS3A 4Z7NF 3WFHB 4UT6L 3ULSB 3L3GA 4LHQB 1RZFH 4M6NH 1X4ZA 4U3CA 3FFCA 5HHME 4H0GA 5SWQB 1GGBL 2IPUK 2HT4C 1BECA 5CWSB 1OAUL 3HPLA 5F7UA 5HHOB 4UNVA 3B5TA 5KZCB 1CFTB 5F7YC 4L3CB 1YEEL 4MD0B 2VH5L 4HUVB 3LZFH 5FA3B 4JO4L 1IEBA 1ZHKA 3N1MC 5CGYC 3VXME 5FDYA 4JPIA 4R96A 1A4KB 2VDNL 3SE8H 5HHMD 5IQ7H 4P5TB 2ZOKB 5M95B 2Y4SA 3QNXA 5KSAC 1U9KA 3HE7B 4WCYL 4FABH 3SDXE 5IB3A 4OFYA 1YMHA 4IRSD 5FHBL 2NY3C 4PV9B 4OD3H 4PJ5E 3VXMD 1PX3A 2EYSB 1ZLSH 4NQCD 1WITA 2M8XA 1JPSL 4U1HB 4IJ3C 1KJ2B 2ZUUA 3H9ZA 3Q3GB 3VFSB 3DTXB 4P3CL 1TVHB 2W9LA 5ADPL 4TOYL 5GGUA 5D70H 2GSGB 4PJ5D 2BHUA 2FDBP 4HUMB 1GAFH 3IVKB 1Y0LB 1EA9C 4AH2A 2DB8A 4X4XA 2QBWA 3IF1B 3ZKND 3MFFB 3HFML 4O2CA 5ICYB 3RBGA 1QRND 4G9FE 1PBYA 1F4AA 3RZCC 3P0VL 1LHZA 5MEPB 3TN0D 4YHIB 3ZL4L 1L0YA 1PY9A 1DANU 1UJ3B 4OUUA 2EDXA 2IAMB 1RD6A 2GTZB 3S35L 1T3FA 5TDOB 4PJAB 4GRLA 5ACZB 3RTQD 5KS9F 4DZBB 7FABH 3NGBC 3WDHA 1IFHH 4PJCE 4ZYKA 1QYGH 4X9HA 1A1MB 5EOQH 3C60A 4G8FA 5EOCH 3V9FA 5BW7A 3TBYB 3ARBC 3MGOA 3WN5B 4LDLB 3WXWH 4RQQA 3LS4L 2XKNB 3IETB 4MX7B 4OLWH 4LL9A 1OP5K 3Q6FA 1PYWB 3MGTA 1E4WH 3LKNB 3BO8A 4FQXC 5TDNA 5JZ7D 4I3RL 5IVXE 2VDOH 2BSED 3RIFK 5FECB 3REWA 4OT1H 3SKJH 4NNXA 4EDXB 4RISH 1RMFH 1MWAA 1CXFA 4POYA 2VXSL 3QULB 4Z0XA 4I2XB 2CGRL 4BZ1L 3HTLX 2BNUB 3WIHA 5EU6E 2OJZL 5CUSL 4LPUA 1N2RB 3V8OA 1H3PL 1I7TA 2EDWA 5FDWA 1SY6H 2VDLL 4S1DC 4W81A 4PPTA 2BVOA 3BPNC 5DK0A 2P49B 4WTWA 4LLUB 2F15A 3CXHK 1NMBL 2X4SA 4M7JH 3CVHL 4POUB 3DUUA 2Y07L 1SBSL 5IEHA 1I3RB 5EU6D 4GG6A 1A3LH 1BVLA 1KJ3L 2J8HA 5T3XL 5CD3A 1QLEL 3TIDA 3WHE0 4FQJH 4HIJB 4CVZB 4XI5C 4OLVH 4JM2D 1S7RA 1AGFB 1U8HA 1E28A 2FX9H 1NDMA 3GK8H 3MREB 3X12B 1X5GA 1WTLA 5EO9A 4LCYA 1T1ZA 5AYUL 1FFPB 5HHQB 4XGZA 4E5XA 2FEDC 4JY5H 1P5VA 1TNMA 1A0QL 3HMWH 3ZT5A 4JZJA 1PFCA 3UTZA 4Y2DB 3T3ME 3QQ4A 1JGLH 1YNLH 3H3PH 2BVTA 3LPFA 1JPTL 5DK3A 1XFPA 5D2NB 1QNZH 4Y1AA 1JZ5A 1JZ4A 5DRZA 1M7IA 1NGZB 1OAKL 3KHOA 4CVXB 3LPWA 2R2EA 2YBRB 2G60L 3I9GH 4GS7C 1BOYA 2AEPL 3D18A 3R06A 1NLDH 4FZEL 2DYPD 5IF0A 3X11B 1KJ2H 1DBAH 5MENA 1JVKA 3VXPB 1S3KH 4PBXA 5CBEA 3X13B 3IKCB 4XCCL 4NBZB 1MRDH 3FMGL 5E8DH 4OCNC 4F15B 2DM3A 1M71B 2HH0H 3VGAC 2W1NA 1KNOA 5AWNH 4KK6D 4AT6A 2DKMA 4G9DA 2ARJA 3S3SA 1I1AC 4NP4H 2VDPL 1A5FH 2GCYB 4NKOA 1DL7L 3D0VB 5TGBA 6CGTA 2NXYC 1ZLVH 4ZAKD 2BNQA 3B9VA 2FO4A 4JKPL 1QBBA 4NQXB 3A6BH 3DHMA 5IBLC 4A6YA 3EGSB 2A0LD 1S9VA 1QSZA 1GGCL 1G7HA 2B7DT 4JANB 1A7PH 3C09C 1WVZA 3HNVL 4N1CA 2V7NA 3IU4L 4NN6B 1ACYH 4RBPK 3CX2A 1A7BA 2D4DA 3OF6D 1OARH 4OFDA 5F7HA 3BPLC 5IWLA 1JWUB 4ZPVA 1I9IL 3VFTB 3VDBA 1JCKA 1A6WL 4QRRA 3FTGA 4ZQKA 3PDDA 1PKQA 1TVDA 4EOWH 1U8OA 2JIXB 4DWHA 4LSPL 3FQNB 1JTTA 1R3HA 4NO2A 3I3BA 4PJHB 3W0WA 3GIVB 1FNLA 3D69B 2OM5A 3LDBC 5INCB 3C6LB 1MLCB 3A6OA 1HHJB 4M7KL 1MRCH 2D03H 4U1NB 5ITFB 5KN5A 1NCWH 4YHLH 3SKMB 1F3JB 2UUDK 5E70A 8CGTA 2AAVA 1PG7L 1V7MH 3IDJA 3INUH 3HNTH 4RMUA 4QF1B 3ZMRA 4FQLL 4KKAC 1LP9B 4KQ4L 4XNUH 2X4TB 5GPRA 3GZKA 3WE6B 1GC1L 5FHAL 3SCMD 3HC3H 3EDFA 4FQCL 4DN4L 1LDSA 3QIBB 5I76B 3NZ8A 5B38B 3SDXF 1ZGLP 4YPGA 2PKDA 4GKOA 2GT9B 5EA0H 1JNNL 4NZUL 3AB0C 2CLZB 1FJ1B 5AD0B 4PJAE 4TUOA 4JREB 1F42A 3QDGB 1S8DA 5SX4I 1OM3H 4HEME 4F9PC 1MNUL 3FT2A 1I8LA 2NY2B 4RMRA 4XNXH 4Y16C 2DL2A 2GTWA 3DIFA 3ZTJH 1B0WA 2GJJA 4QO1A 3ABZA 2ATKB 2B5IB 1J0ZA 3QG6A 4X6BB 3CLFL 5JR1H 5A16B 2AS5M 1FG9C 4U1SA 3F6IA 2LU7A 3IGAA 4XVSH 1HH9A 3ETBF 5EUOA 3U48A 4AIZB 1Q0YL 2VZVA 4X9GA 4X83A 3WFDH 3OZ9H 4Y8DC 5C71A 5GZOC 3QPQC 2FBJH 2GSIA 1EEYA 3FB6A 4M8QA 5IK3A 3RDTC 1R5WB 4APQA 4GG8A 1P2CA 3RL2B 5J1AB 1MFDL 4I2XE 4PJCF 3TNNA 4YR6B 1MHCA 4JG1H 3MOQA 3D3VB 1U93A 3UBXB 5FUOH 3OR7A 4AEIH 4RGNC 3QIWD 3OXSA 4NO5A 1GGIH 3ARGA 4QY8B 1U8MB 2HLAB 4IDJH 3LY6A 2B1HL 3EOBB 4MAYD 3MCKB 2CRMA 2BXYA 4WI7A 3V6ZA 5IVXF 3EOYG 3S36L 2X4QB 1G7MA 5E95B 3L5JA 3G6AB 3MUZ1 3ULVD 4UOJA 3VXQB 4QXTB 3OKOA 2NTFA 5BZDB 3BKJL 5GS1B 4OCRL 2HWZH 1Z9MA 4WHDA 1BMGA 4FG6D 5EN2B 3QB7C 4GOSA 1PKOA 5KJRH 2A83B 1WISA 4U6VL 4GW4A 4LKXB 2R4RH 3HG1A 2WBJD 5EORL 3EYOB 3N1PC 4JM2F 3PWLA 2NZ9C 2J4WL 5LKNA 1H5BC 4AJ0A 4PJFB 3I6GB 4KZDH 4L8BA 1IM9B 5D2NE 3UO1L 4TRPH 2JB5L 3UYRL 2IBGA 5I1CL 3BN3B 2CLVA 2GK0A 5T1DH 5IM7A 2X70B 4BSJA 1X5AA 3H9HB 1YEDA 4XBPA 2PR4L 2YK1L 1P7KA 3ZKXB 1OQXA 4H0HB 4OQTL 1CDUA 3IDMA 3G04A 4NZJA 5DUMH 4I13B 1IAMA 3CDGA 4P3DA 3WFCL 1MJ8H 3T3MF 3UXFA 1A9EA 1DTUA 1UM6L 1W2KT 1B6DA 5CINH 3SDCB 2ZSWB 1Q38A 1JGDA 5EUKB 3SPVA 4L29B 4M9OA 4Y19A 1J8HB 1FHGA 2R0ZL 4KTEL 4Y4KC 3ECBA 3OV6A 4KMLB 2VISB 5CJQH 1Q9WB 3AUVA 3LEYL 4XCEA 1LE9B 2VIRB 1X5HA 3CFKA 3PWUB 3SE9L 3EUUA 3F7VB 2AXFB 1F4YH 5MEQB 3L3DA 3SGKC 5TQ2L 5BXFA 3C2AL 2WWKO 4WWKA 2VUYA 3AXLA 1NC4B 4GBXD 2EO1A 4ZUVA 4QTIL 1T20B 3IS1X 3TJHC 1K8DA 5DO2C 3UJIH 5BOPA 5F1NB 5F9DC 1JMXA 2A38A 1SMAA 5E4IA 1V3JA 2Z8WC 5E5UB 2CDFB 3B5HA 1EJ6A 1T83A 4Y4HB 1BQHG 1M05A 1FCCA 1CGWA 5BVJB 1CLCA 4P5MB 4YDLC 5C0NC 1FL5B 3KPSE 4PJHE 1HHGA 4F3FB 3FQWB 4YWGL 4PLKC 4TPRL 5EIIA 1KN2H 3P4OB 4M6MH 4M93B 4XZUB 1AIFB 4HDIA 4WWID 4DFHA 4MA7H 4XXDB 5FM4A 3KVQA 4K7PX 3Q1SH 4P49A 4GW5B 3RVVC 4HD9A 2BDNL 5F96H 1OGAB 4I9WE 5JW4N 2BVPA 3KPSD 2DQCL 4UV7L 2EXYC 4WHYG 2AJUL 2BHZA 5D9SB 3TBVB 1J12A 5FCUL 4HBQA 5DGRA 2DQEL 4MXVE 3L1OL 1X4YA 1YMMA 4I48A 3SDYL 1EGJL 1S78D 3H0TB 1AGEB 4WW1A 1NBQA 1BZ7B 3IFOA 1FNSL 3MRHA 5D96C 4EI5C 4MB5A 3MA7A 2PF6A 1NUNB 4XP4L 3MZTA 3QEHB 5KSBE 4I9WD 4NM8H 4XPTL 3TBWB 5J11B 1QLFA 3P9MB 5A3ID 1MCWM 1D5MB 2Z31D 4HK3J 4ODVL 1U95A 4HIIB 4M61B 4Z7VA 5F9WB 1MCPL 5LGKA 8FABB 3CLEL 4LGSB 3OG4B 2RIKA 1CDBA 4HIHA 5E8OB 1DDHA 3LQMA 1GSMA 3ARDB 4HLJA 4NNYB 3ULUE 4K8RD 3KG5A 3QXDA 4L4TE 5IW1B 5CEZE 5FUCC 1R3LA 2O5ZL 1FV1A 3K4ZA 5TFSH 1I7RA 3A6CL 5T3ZE 2FH8A 3G6JB 2CDEB 5T5FL 3SJVB 3PE9A 4DTGH 1IGIH 5D1XB 5DD6B 5FYKH 2ENSA 3MRKB 3P0YL 4ETYA 3PV7A 4ODXA 2VXTH 4KDWA 4PJAF 5D4QA 3ULUD 3DYPA 1FRGL 4L4TD 5FF6B 4LP4A 5CEZD 2NY6D 2C3VA 2YZ8A 1E6OL 5T3ZD 4NC1C 5C0DA 2OL3B 1VEOA 3D3VE 4JRYA 4XP5H 5FYLH 1MI5B 5IMKA 3U0WL 4Y2OA 4FQIH 2B2XL 2Y36L 4YBQD 4XNQA 3KPQA 1HEZA 3EYUL 2Q7YA 1QLRB 1RZGA 4ZTOH 1L0XA 4EXKA 4QHUB 3QUZB 4A2MA 1NLBL 4ZNCD 2VLRB 1WFOA 3MJ8B 4R4FH 4ZDHA 2EH7H 3D3VD 1MHEB 1N6QH 4O2FA 3CK0L 4FQQB 4D9LL 4MCZA 4MS8D 4PLNC 4OCMC 3O4LE 3WFEL 3UC0H 1CDYA 2CDGB 1MFAH 3PP4H 1UWGH 3EW3B 2QADB 5IB5A 3V79C 2QSVA 4NGHH 3U9UA 3FO1B 2KL6A 2KZ1B 4KRMB 4WY7L 4JDVB 1UZ8A 1IAIM 3GSNB 2MHAA 1L6XA 3J8F7 3CXHJ 3MRPB 2WBWB 3O4LD 5IMMA 4MNGB 3TFKD 4GRLC 4KY1H 4Z6AT 5I16A 5FYKE 4PRPA 1B88A 3C60C 4YXHL 3ZHLA 4G3YH 5BW7C 5H94B 5ERWB 4HKJB 1PZ5B 2NPLX 4IMKA 2W60A 4O58H 3H7BB 1IM9D 4MZ3A 1RZ8B 5FYLE 2VLJB 5FYKD 3GSOA 1RUAH 3FN0H 5TJWK 4RMWA 2YPVL 1Q94B 4WNQA 5ECJE 5K9JL 5K33A 1LO0H 1C7TA 2OR9L 2MCG1 2O93L 2ADJA 1XF5A 5E2WL 5CGMA 1J8HE 1BFOB 1AQKL 1U8IA 4H8WC 4YK4C 4XNMA 5FYLD 5KTEL 3REVA 5CBAA 3I6LD 1F00I 1NGQL 2IH1B 4S1RL 1B0GA 1HHHB 1FO0B 3UZQA 5EBWB 1F2XK 2C1OA 4MNHB 1S7VA 3VG0H 4Q9QL 1A9BA 4OQTA 3W82A 5ADOL 5CLTA 1HYSC 5J56B 4XHQA 3FOLA 3C08L 4NKQB 2AXHA 5D2LA 1KENL 1XGRB 3QAZC 1CFVH 3VFPB 3O6FD 1BZ9B 4POZC 5CEYB 1CDJA 1ZLVK 3VMNA 3EAKA 1IGMH 4MA1C 3QDMA 3IDXH 2PUQT 4FFWD 5IVZB 2DQUL 1JGVH 2YSSA 25C8L 4H20L 5C08A 1KJMB 2W9EH 1FNAA 1NC4D 1BAFH 4OLYL 4L3AA 4AIOA 4BSVB 3KYKL 3MJ7B 5IUSA 5F88A 2VDML 1YUHA 4LSSL 4G6AC 3UTSA 4PRHA 3MFGB 5F71A 4UTAH 3P9LB 2IQ9H 4JZJC 4HIXL 2AKRB 4HUKB 4JFQA 1DR9A 3MPCA 3MV7A 4WI8A 4WW2A 1YYMH 2OL3H 2ZWLT 4ZO9A 3ZHDA 2P43B 3JWDC 4YQXH 3KPTA 4FP8L 1D6VH 3BUYB 3O8XB 4YAQB 1XGPB 1AC0A 3WBDA 1RZJH 1X5IA 5T1KB 3IFNH 4ETQA 3FO2A 5B4MC 1WIUA 3GSUA 1KACB 1QFWI 3GBNL 1UCBH 2APVA 5ICZB 4PJHF 4HPYL 4XBEH 1BQHB 4F33B 5DMYA 4ELMA 5I18L 5C0CE 3FQTB 1NMCC 4NJ9H 4AIXA 1ED3A 1LO3H 1D5ZB 3MRLB 4J3VA 2BJMH 3HE6B 3VMOA 1F6AA 4MA3A 1ETZB 1T7YA 4E9LA 5LWYH 4G6KH 3GI9L 2Z91B 5C0CD 4MXVF 3GMPA 4MJ6B 1UA6L 5FOBA 3ORJA 3GSNH 1ZLUH 2IGFL 4U33A 4PG9A 4UDTB 2VE6A 3NA9H 2X41A 3G6JE 3SJVE 2P8PB 3O3EB 1FG2A 3KLAA 4HJGA 4X6DA 2GEEA 1NGXB 5KSBF 3BP7B 2WUBH 32C2B 3QXAB 2DLFL 5DJYA 2UWEA 5E9DA 1S7QB 2PTTB 5IWLC 2FH6A 2Q86A 5AUMA 1ZAGA 5BVPH 3I75A 4WVRA 5CEXB 4PRBB 4X9IA 1A7OH 1MCBA 4JO2L 1AXTH 5JW4R 2P48B 2K3TA 4WTXA 1MI5E 4E41E 4ZFZA 3B8SA 3R0NA 1CXEA 2E27L 4PJIA 3H3KA 3ULUF 4WI5A 5IMLB 2D3VA 4H1LG 3OKDB 2D7TH 2H2SD 2KZWA 4W4OC 4QNPF 1PSKH 3CUPB 5E03A 4Y5YB 1HSAA 5J89A 1OSPL 4JFEE 3S96B 5BO1L 4MB3A 1K5NA 3NCYS 4E41D 2QSTA 3BEVA 1WAAA 1HQ4A 1FO0H 2F5BL 5LQBL 3S35X 3L3JA 3LCYA 4XNZC 1F45A 4OM0L 4N9GB 5FV1L 4F7EA 4XC3H 1VFMA 5ID1B 1NCCL 4OGZA 2LTQC 3KPNB 1JNHB 4EDWH 1IMHC 3QYCA 4JFED 5ENWB 1GGYA 2D0FA 3T2QA 4XCNB 3G08B 4LLAA 1WBZB 1U8QA 5AZEL 1KB5H 43C9A 5CSBA 5DI8B 4R2GB 4V2CB 1HHIB 1T0MA 2R4SH 3GSWA 4WFGD 4K94H 4L8CB 1NFDA 2G2RB 2VSCA 3QI9B 1I8LC 3FJTA 5FYJD 4M1CC 2NY5H 3GDBA 2BFVH 1MVUA 3BH9B 3PGDB 1AQDA 5FFLA 4XVJH 2ZUSA 1GJIA 4WU7A 4G42A 5EBLB 3OR6A 4XHJD 3QA3A 3QDJB 4ISVA 2DWDA 1AGBB 3H42H 2NW2A 1ZANL 1XIWA 1KIPB 1IGYA 5DHVB 3BPCA 4KVNH 4NN5C 5E2UL 3Q5OA 2EH8H 2AEQH 1YEGL 2ZG1A 3CFEB 5IB1B 2V17H 3MYJA 1QFUH 5ISZA 1UENA 3F65A 4FXGB 2HN7A 3FN9A 4APQC 5F7DA 4IRJD 4O5LL 1S7TB 4N0YL 3QWOB 1YNKH 1YDPA 4FOMA 4HIEA 5DXWA 3VFNB 4JJ5A 5EBGA 2IF7A 3UJJL 4EI6A 2O5YL 2XA8L 3H6JA 3OKEA 3VG9C 3JXAA 3T2PA 4XPGH 3ARGC 4H25B 4PJEA 5D7SH 4RMTA 1L7IH 4CUCA 4QRUA 1NAMA 3ZKMD 4HWEH 1YN6B 4WHYH 1GL4B 1XR8A 4UT9H 1I1RA 3BN9D 5C0BB 4M5YL 1ZKAA 1MCOL 4J3SA 5KSAB 2AEIT 4EN3A 1BIIA 1YEJH 3ZO0A 2OK0L 4C4KT 3JTSA 2CMRL 2NY3B 4NKDA 2R2HB 5IFHL 3F7YB 4Z7UB 5DC9B 4QRTB 3GMMB 1U8NB 4FTVB 2CRYA 3UJTL 4LPVA 1I8IA 4JFFB 4Z95L 1BF2A 5DMJB 1J1OL 1BVKA