3MMEA

Structure and functional dissection of pg16, an antibody with broad and potent neutralization of hiv-1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
237
structure length
235
Chain Sequence
QEQLVESGGGVVQPGGSLRLSCLASGFTFHKYGMHWVRQAPGKGLEWVALISDDGMRKYHSDSMWGRVTISRDNSKNTLYLQFSSLKVEDTAMFFCAREAGGPIWHDDVKYYDFNDGYYNYHYMDVWGKGTTVTVSSASTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PG16 HEAVY CHAIN FAB
publication title Crystal structure of PG16 and chimeric dissection with somatically related PG9: structure-function analysis of two quaternary-specific antibodies that effectively neutralize HIV-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 235
sequence length 237
chains with identical sequence C, H
ec nomenclature
pdb deposition date 2010-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mmeA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mmeA01
1IZJA 3G08A 5IEHB 1UGNA 4XCNB 5H37H 5F9OL 4NKQB 5JNYA 1S7WB 4ZQKB 3T65B 2NY2B 4Y5XC 2P8MA 3FRUA 1S9YA 3PGDA 3SKMB 2VZ3A 4LLVB 1LO3L 1T7YA 2ARJQ 1F11A 5J1AA 4LEXL 3CFIC 2W0LA 4U6YB 5TQ2H 3LQAC 3VXPA 3BHBA 4CMHC 4DVBA 3L3HB 3PIQA 4H5SA 1UWGH 1I1RA 1AO7B 4LSDA 2I07A 4DCQB 1AGCB 2ZSWA 4LDLB 3DECA 4RMUA 3P73B 1MCWW 1U8HA 3MRPA 4LP4A 1O5DT 4XNYH 1FCCA 1XIWB 5MEOA 3MNVB 3HUJA 1HXYA 4NZRL 5IWLA 2EDNA 1A4KA 2DM7A 2ZZUT 5C2UB 1RVFH 1IAIL 3OL2A 4G8IA 4E42B 4Y4FB 1K3IA 4RMWA 4I48A 3OAUL 5L2KE 1WZ1H 3EYFB 4ZOBA 1YUHA 3FOLB 4KK5D 1JV5B 5GRYA 4YPJA 5BZDA 1J8HE 1QKZL 2FBOJ 3MFFA 5I66A 3GEWB 3GBMH 1QPXA 3VFWB 4O2EB 4M7ZC 5IJVA 3OKMB 4QCIA 2X1QA 3T1FA 1AGDA 1K5NA 4I0PB 1ED3A 5INCB 1YN7B 4GRMB 1JF1B 3P9WB 2YKLH 3BP7A 2DQGL 2VTFA 1Q9WA 4HFWB 3CC5A 1ZA3B 3REWA 4X5XA 1MVUB 2APFA 1GRWA 4D9LL 2DAVA 3T4AA 2DWEB 4NSKB 3C2AH 4DZ8B 3PABB 1QG3A 4Y19E 5HI5D 2OL3B 3TH2T 5J7CC 2P8PB 2P24A 1BQSA 3UC0H 3PNWB 5C0BD 5TDPB 1EMTH 1RIUL 4HWUA 2X09A 3IDXH 3OHXB 3CCHA 1HYRC 2YUWA 3KPOA 3D3VA 4UI2A 4MNGB 2B7DT 4JPVL 1A4JA 4XPGH 5ANMA 3VI3E 4K94L 1TPXB 1WFNA 3G6DH 5GRJL 3RWIA 5JOPD 3EYUH 3QEHA 3BXNB 4OJFL 1MCSA 4ETYA 3DUUB 3D18B 2X40A 3GSQB 3RKDC 3MRKA 4ZG1A 5H2BA 1I7UA 1N64H 2HFTA 3S88H 3WIIL 2DQJL 1DEDA 1I7TA 3GIZH 3D9AL 2NXZB 4PY8J 5FYJU 5CD3A 4IOSD 4F9LC 4JRXA 3BW9A 4XCEB 3O2VL 2BCKA 2G5BB 2LAAA 3FQTA 1LE5B 2N4IA 5EUOA 3SDCD 1LEIB 3X3GH 4JO4L 4F7EA 2IH3B 5L7XL 3IDGA 4L3EB 4Z0XA 5IW1A 4Z77B 4PJXE 5CBEB 5M7QA 3EYSL 4CRPA 2NTFB 3MLRL 3OJDB 4Z7WE 3ZE0E 4P5TC 3TBVA 3DXAA 4EN3A 1MFDL 3DI2B 3MACH 4HGMA 4L9DA 4WEBH 5DD5L 3DUHA 1F97A 1DL7H 4E41B 2DLTA 1JWUA 4PG2A 3V0WH 3KPLA 4PRPE 4U6XA 3WFZA 5DDHA 4RNRA 1WITA 1FNSL 2GCYB 3U2SB 5HHOA 2H26A 5E4EB 1TVBA 4GH7B 1RPQA 1JRHL 3BQUD 5TFSL 8FABA 1BZ9A 5B3JE 3H2WA 4XWGH 3DX9B 2YPVH 2QQLH 3UYRL 3V4UL 3FHAA 1ZHBA 4RBPH 1CFSB 4JGJA 3T0BA 1I3GL 4BUHA 1S5HB 3EDDA 3HG1E 1BVLA 4NQUA 1AC0A 5ICYB 2AK4B 3QPXH 3HR6A 1XFPA 2C4XA 3SE4A 2XN9E 4PG9A 1GCFA 1N0LA 3V8CA 1QBMH 4RISL 3CJJA 3QDGB 3I75B 2A38A 3MA7B 5EU4A 5F8QC 5D7SL 3MCKB 1EBAA 1G1CA 1J1OL 1UWEH 1I8IB 3L1OL 4OZGB 5HDOA 1QEWB 2VXQL 1ZXQA 2W92A 4L8CB 2V5SA 3KXFA 3ZL4H 1CGWA 4R90L 2FZ3B 2XYCA 4Y0GA 1QO3B 1ADQH 3QUYC 3MLPA 3NH7H 3CX2A 1HINH 2I24N 5KS9F 3BDXA 1BF8A 1G0XA 1W8NA 2OM5A 3LKSA 5IBUB 3HI6L 3O3BB 4OZHB 3WDJA 1WUNT 2UUDK 1Z9OA 5ECJE 4EQ3A 4YFEA 3VFTB 1AQDA 1SYSA 2D7PA 2VQUA 1OAKH 1S9WA 3HNVL 4XXDA 4PJBF 2ITDB 3WN5C 4HCRH 4LCWA 4DN3H 4XPBL 3TO2B 3JUZA 2BVOB 2PO6D 3GMOA 1U95A 4NKOB 1T22A 4LSPL 2BHZA 3RPIA 1XF5A 1I1FA 3MLSH 1OLLA 3KPRD 1YEKL 3UZVB 3U1SH 3NTCL 1ADQA 3PF2A 4KZDL 1T89A 3N0PB 5MEND 3HB3C 3TVMD 3VXSD 1SJVA 4CAGA 4HXAH 3TV3H 1JPFB 1S7UA 5DEZA 4LIQH 3C60B 4NQEB 4UV7H 5JDSA 4UT9H 4KTEH 4PLOB 1FDLH 1CLYH 3MV9D 4OM0L 3FT4A 1B90A 4B7IA 2BHYA 3DMMC 2P5EE 3FFCA 4YO0B 1FZJB 3RNQB 3QDME 3V4VH 4QTHB 5E56A 3RRQA 1X4YA 3JWDH 5DUBB 3ZYOA 1D5IH 3GSWA 1SYVA 3L9RB 3RGVA 1FPTH 3O41A 4FZ8L 4LCCC 1NBVH 5IB2B 4WGVB 3MV7A 4JPWL 3NIGE 4OLEA 2HJFA 1O7VA 2O93L 4PJGB 4ONGL 3DARA 3F5WA 3UTZB 4YFDB 3ARBA 1YMMA 1A1MB 3C5ZA 2IPTL 3D69A 3HMXA 4TVPD 3TO4A 3EO9L 2CO7B 3QUYB 4P2YA 1FBIH 1G6RB 3MBEC 2VDPH 4OB5H 4WUUD 2J12B 1GPOH 3V6FB 2QQKH 4JZJC 3T0WA 1I1AD 3AAZA 1IGMH 1RSFA 5F96H 4QXGH 1XGQB 1H9VA 5D96C 4M3JA 4QOKD 4X98A 2DBLL 3IDJA 1EFQA 4U1HB 4V1DB 3WN5B 2FHCA 4OCMC 3VG0L 3MV8E 5C8JA 3RL1A 2AK1L 5AWNH 2VJXA 3KPRB 4JRYD 1ES0A 2W9DH 4M6NH 1ZK9A 4AM0A 4X6FB 1XR9A 2KH2B 1OF2A 4J6RL 1LGVA 4IRSC 4JFOA 4NT6B 3WFEL 5HHNB 1OQOA 4ETQB 4F7CB 3GMPB 2BXZA 3F58L 4L4VA 1K85A 4GKNA 3S36X 4ZMAT 4JFDE 3C6LD 4ZQKA 3NIDF 3SKJH 1OAUL 4LLVA 4NUJB 2GYSA 5IW6B 3I9GH 1R6VA 1K8DB 1IEHA 2DIBA 1E4XI 2H3NB 5T3ZH 5DC9B 3SO3C 5IMLB 2OLDA 4C83B 1PW3A 2CLVB 2EDBA 3L3HA 2ATPB 4LP5A 3DMMB 1AO7A 2V9RA 1AGCA 5IESL 5I75C 3O6MH 2KUTA 2DQDH 2GJ6B 2FO4B 4HZLB 3P73A 3GMMB 4FNLH 3C5SB 4LCCB 4TOYL 3ZSTA 4RFNC 2NY7H 4HWZA 3WIFB 1EJOL 1JHLH 2LTQB 4BSVB 1A6ZA 3IXTB 1AKJA 3L3KB 4MNQD 5AZ2H 5IBUG 4LOUC 1ZHLB 2I5YL 2YD6A 4QTIL 4JFHD 4GRLC 1WCBB 1J18A 1A22B 3EYFA 4JZJB 4U1KA 4ZPVB 3O8XA 1JV5A 5DJYB 3SDXE 3GSXB 1WAAE 2VXVL 4HK0B 3IETB 4NO3B 3VFWA 3LQAH 25C8L 3OKMA 1KPRA 5SX4I 1N8ZB 1VB9A 2DMKA 1JF1A 2QJDA 5IROA 3NFPB 4DGIL 4HFWA 2YRLA 1ZA3A 1FNGB 3Q6FB 3GDBA 1MVUA 4JFYB 1JGEB 3STZB 2DWEA 3FL7A 4NSKA 1U3YA 1KJVB 1QSFE 4GRWF 4DZ8A 2ICWJ 3A67L 3SJVA 1SY6H 1XGYH 4OT1L 5DGQA 2P8PA 5EOQH 4U3HA 3PNWA 2B20A 3WXVH 2EDDA 4UT6L 4LPVA 4JPIA 3OHXA 1TJHH 2HH0H 4Y5XA 1G7JB 5I2IB 4I18C 3DVGA 4G6JL 4YC2C 3C6SB 3DWTA 1MFNA 4OIBA 4ZO6A 1RJLB 5DEGA 4IIQC 2PUQT 1S7QB 4AJ0A 3U4AA 3SO3B 2AJZB 4EIZC 3ARYA 1OGAB 3BXNA 4P2QE 1FVDB 4DGVL 1KYOK 2ICWB 1OB1B 3MRIB 3DUUA 4MD4B 5L6YL 4NN7C 3GSQA 3CK0L 1K4DB 3QWRA 4FTVB 4J8RB 1RUPL 5I1DB 3VDBA 3BGAA 1T2QH 3SDDD 4AEHL 4JKLA 3T0EC 4L4TE 1P4IL 1SY6A 4JQIH 5F3HB 1A1OB 3WLBA 3QEQD 3VXQB 3SOBL 2AEQL 2Z8SA 1NAKL 3QO0B 2NCMA 4YIQA 4P59L 3VJ6B 1I9RL 5DRXB 3BZ4B 6FABH 1KULA 4H88H 3EDJA 3O9WC 1LE5A 1MHEB 3RBGA 3GMQB 3QWOA 4GRLB 1LEIA 1AJ7L 4MCZB 5C08D 1IRAY 2J2ZA 1U91B 2H2SC 3ZE1E 1DBJH 4ZSOE 3DOSA 1JGDB 5I19H 4RMSA 3RIAK 5T5NF 2N56A 2YPLE 2NTFA 4UQ2A 3PDGA 1RUML 3OJDA 2YWYA 3ARQA 1WC7A 2FB4H 1ND0B 4YHLH 1Y18A 4C56D 2F15A 2EIBA 4J3UA 3L7FB 1SMOA 3PWJA 4FRWA 4E41A 3B2VL 3OG6B 4MWFB 5DHYB 3RWEB 1ACZA 1TCRA 1YEHH 4PJAB 3OXSB 5KW9L 1KLUB 4ORGB 2VKXA 4BQBA 1UQSB 3TPUB 1FRGH 1YNLL 3QIWC 4QRSB 2EICA 1N6QL 3VG9C 2D7OA 4DWHA 4I2XE 4I18B 5EU6E 1Q9OA 3TBTB 4YC2B 1BECA 3DX9A 2W91A 3MRLB 2OTPA 4OZIE 4NRYA 3GMNA 5GGTH 1CFSA 4PS4H 3QG6B 3CSYA 4YXLH 4HBQA 3VWKD 1S5HA 3VFPB 4EI5D 4HC1L 4NN7B 3ROLA 2VRAA 4HH9B 3OAYK 3MA7A 1NJ9B 4YHOL 4M6ML 1I8IA 1KFAL 3MRNB 3HE7C 3T0EB 1NCBL 4PB0L 4W4OC 1KXQE 4UILL 4ZFOA 3RWHA 4F9LA 2FZ3A 3L5WB 3NABH 1U6AL 2BY3A 1OGTB 1IAKB 1UM6L 1QO3A 4HDIA 4I13B 1TENA 4R3SB 3VD9A 2ZCHL 1BBJB 1GGIH 1C5CH 2PNDA 3GSNL 5IGXH 3QQ9C 4JCMA 1IGCL 3O4LD 3JWOL 5GGTA 1VGKA 3O3BA 2B1AL 4K8RD 1HHHB 1NEZB 5D2NC 2ITDA 4P5TA 4RDQF 3WS3A 2HVJB 4IMKC 5I76B 3VFSA 5DO2D 4Z7UB 2BVOA 4X7CC 5I74C 1RZGA 1YZZA 2FL5A 4XMLL 1CXLA 4H8WC 4GJTB 3TBWA 5JHLH 2WWKT 5J57B 1IE5A 3HHRB 4FQ2H 4UUJB 1YPZF 4HF5L 4CVZB 1TZGL 3QIWB 4Z0BH 4NDMB 4G42B 2RHEA 3VG9B 5LXGL 2BXYA 1JGLH 1G6RH 2WP3O 5F72S 1JPFA 3SGDI 4GG6B 1BREA 4AEEA 4NQXA 1DP0A 1UM5H 5CLWA 5EIQA 4WNQB 1MHCB 4BQ9A 1CFQA 5FDYA 2R0LL 3MJ7A 3C08L 3MLZL 3FO0H 4YO0A 5D9SB 1FAIL 1FZJA 4QRUA 4UTAH 2OSLB 4QTHA 3CVIL 4G80B 3LKNB 5DUBA 1T1XA 4Q74A 3L9RA 5EOTB 1YA5A 4MB4A 3ZLQC 1XH3A 1X6LA 2BFVH 1P53A 5IB2A 3HE7B 2E8ZA 3V7MA 4PJGA 2FLBT 1JNHB 3UTZA 1M71A 2OCFD 2ARWA 4WUKH 4APQA 3KLSA 4R2GC 3QUYA 4CKVX 3EOAB 5GS3A 3N9GH 1TFHA 1G6RA 4WFHE 4Y4KC 4HK3J 3V6FA 4Z8FL 4K7PH 2R2EB 3T2QA 2BNRA 3RWFB 4PB9L 4ELMB 3VGFA 2EC9U 5FYKD 1KCRH 2JK5B 4NO2B 2AV7B 2X41A 1XGQA 5CINH 5KVDH 1X5LA 5D2NB 4U1HA 3WN5A 3BRFA 5CGMA 1CFTB 1S9VB 5E8PB 5E7BA 5ALCL 4LBEB 4NNXB 1RZKC 2FCBA 1QFWM 3PL6C 4MZ2A 5C09B 3N50A 3DURB 1LO2H 4KKAD 4UB0H 5HHNA 5FGRA 4D8PA 4F7CA 3GMPA 4D94A 2NXYC 1UYWH 3F12B 3Q2CA 4XP4H 1AQKL 3QNZA 4JDVB 3B5GA 5DZLA 1RFDH 5HYEA 3C9NB 5CP3A 4NUJA 1I85C 3B8YA 2IAMD 3IFNL 1E6OH 3OPZL 4NKIH 1INDH 1K8DA 1YC8A 4JRXD 3JTSB 1A7RL 1MJJA 4JG0L 2H3NA 3V5HB 5GJSH 1DQDL 5IMLA 4P3CL 4YHKL 4C83A 3S37X 1RK1A 4R26L 2IFFH 4OSUL 2ZCKH 3DMMA 2Z4QB 4DFHA 3V0VB 3NCFB 3CLFH 1DTUA 2PR4L 2AQ3A 3TYFA 4F7TA 3GMMA 2JJTC 2MOVA 1RULL 3I50L 1AGFB 4LCCA 5ISZB 4LKCB 3CFJA 2MCG1 5D7JD 4R6UA 2QR0A 4BSVA 1AD0A 3DXAD 4NFBA 4EN3D 3IXTA 4W70A 1CGTA 2FECI 5TF1L 1ZVYA 1K8IB 3I6LE 2VXUL 1KC5H 5MI0C 1TJGL 5I15L 4QGYA 1ZHLA 1CDUA 5E8NB 3MBEA 3OG4B 4FP8L 5I1IH 1NEZG 3GI8H 5JIHA 1XGUB 4JZJA 2FX9L 4LSTL 4OD3H 4ZPVA 5BV7L 3TNNB 4FQCL 1IQWH 5DJYA 4Y16D 2DIJA 5HDBF 5HHOD 4HK0A 5M95B 3IETA 4NO3A 4CDHA 5HDQL 3QA3B 4KGLA 1KJMB 1NC2B 5DLML 3ISWA 4JHBA 3U4BL 3HZMA 5SWQB 1FNGA 1UZ6E 3C8KB 4KHTH 3PUCA 4H0IA 4S1SH 3STZA 1YDPA 1TZHB 2DYPD 4IRSA 1GL4B 2IAMB 4LLQB 5IQ7L 1MHPH 1MRCL 4OQTH 2NXYB 3LS4L 4RRPG 2XIDA 4HAFA 1JTTA 5BOPA 2Z92A 1G7JA 3MQIA 5C6TH 4QNPE 3C6SA 2R15A 4M7LL 1RJLA 4JR9H 3FB5B 5DWUH 4QHUB 4LLDB 2AJZA 2DI9A 1BD2E 2ICWA 4H25A 3MRIA 3NVQA 4MD4A 4G8GE 2C3VB 4JFZH 3IB4A 1YN6B 1YYMH 3K8MA 4K3EL 1HE7A 3TGXA 3ULSB 3OZ9L 3Q5OA 3UTTD 4I4WA 5E9DB 4XNQB 3VFGH 3BVNB 1V3LA 3CH8A 1A1OA 2D0GA 3VXQA 3VFOB 3QO0A 4OQTA 5MI0B 1T3FB 3TWCL 4WU7B 5DRXA 5T5FL 1E6JL 2EC9T 1CLOL 5C0AD 4FFZL 1MHEA 2R8SH 3IDMA 3GMQA 4EOWH 4W6WB 2BHUA 4NQDD 4MCZA 3O6KL 4ZFFB 4LDOB 2ZOLB 4KUZH 1MPAH 4PRNB 5EZLB 1G7MA 1K9TA 3ZHLA 4HAGA 4HV8A 3NZHH 2IG2L 2AEPH 2AV1B 2YRPA 3EHBD 4TSBH 3IDNA 4Q0XL 1EAJA 2LE9A 4MWFA 3RWEA 3SKUD 3H9SA 4HIXH 4EQ2A 3OXSA 4PTUB 1KLUA 1N7ML 3FFCD 4KXZH 3F65A 5EZOH 3RIFF 5I1EH 4OCSH 2DI7A 1OM3H 1UQSA 3MRCB 4QRSA 4BSWA 1LK2A 4OGYL 3KPSE 4PV9B 1ZTXL 5C07A 3MX0A 3O81A 5D5MB 4I18A 3MV7D 1OPGH 3MRLA 4LNRB 3D0VB 3WXWL 3CDFA 3NCYP 3ARBD 4R96B 1YMMD 2HJKB 5C0RL 4IIQA 1HIMH 2V2TA 3IS1X 3HI5H 4HUNB 5EIIA 2UYLB 3QRGH 2YHGA 4L8BB 4LFHD 1AHWC 4YHZL 5CLTA 2BNQB 2F5AH 3LEYL 1MELA 3S96B 1F6AB 5KSBA 1NJ9A 1J1PL 3T0EA 4OBRA 5DVOA 4NBXB 4XPAH 2E7BA 4C58B 2Z8RA 3L5WA 1PG7W 3U4EA 4ZTOL 1TZIB 3O9WA 1S9XB 3AS2A 2EDYA 4J3OC 5HYJD 1X4ZA 5DR5H 3WNPA 5GS2D 5LGHL 5GZOC 1S8DB 2VDQH 1BJ8A 1CDHA 3RUGE 3V95A 2ATKB 3MRGA 4WDIA 1NBZB 5IK3A 5KG9B 4J3SA 1C08B 2J3SA 1R24A 3UTSB 4ALAH 4L4VD 1LQSR 1AXSA 1EDQA 3MNWB 1NEZA 4RQQA 4BA8A 4LASH 2MQ3A 5GGVY 3P77B 2BOCB 4NP4L 1U8PB 3FOMB 3FT2B 5KSVB 1KN4L 5I76A 2X4UB 4ZNEE 4CN6A 1RUAH 4P4RB 1FNHA 5DURD 5FYLH 3G6JF 4JN2B 4OFPA 1MEXL 2HRPL 2DDQH 5LGJB 3AREC 2UWEF 1U8QB 2VQ1B 3QULB 4HPYL 3DRQA 4MJ4A 1CD1B 4NDMA 2F53E 4DKFL 3GIVB 4LLMB 4O4YL 2FGZA 4YDLB 4XZUB 5IIEB 3DYOA 5JXAL 3LN4A 3MUZ1 3W82A 5T1DH 4FQPA 1UCBH 5JHDB 2ADFH 2UZYB 4HGWB 3VXRB 2YUZA 2NPLX 4RRPA 1AKJD 1DEEA 1A3LH 3CZJA 3RU8H 3KR3L 4ODXB 1MHCA 2VLRB 5I8KH 5IVXE 2J6EH 4L8SA 4KUCD 1IC4H 2BSTB 2YZ1A 2OSLA 1WK0A 1U58A 5FV2A 3G5XA 4G80A 3JWNC 3O8XD 2MJWA 4LAQH 3ZKMC 1ULVA 4N0UE 4QRPB 2J8HA 3K7UA 4ZFGL 1CXIA 1KYOJ 1TJIH 4XI5D 3LS5L 3HE7A 2QADB 5DFTA 5HYJB 1IJ9A 4W4OA 3WD5H 3CUPB 3K46A 4H8WH 4LPUA 2H2PC 1JNHA 1DQLL 1PEWA 3MRMB 2Y6SC 5TE4H 4JFFB 1P6AB 3EOAA 4LCUB 5CJ8A 3WFCL 5FO9B 3MUJA 3VWJC 3SHSA 2P8LB 4ZUTB 3BP4A 2R2EA 2PYEE 4FABH 1QVOA 4ONHB 4RGOL 4G6KL 4ELMA 1EHLH 4HJJL 2D4FA 4NO2A 2P48B 4PJHB 5HGBA 2J6EA 3EYOA 4GAJL 1FNEB 1BZ7A 1DVFC 4JKKA 4PRID 1WICA 5D2NA 4FZEL 1CFTA 1S9VA 5E8PA 3QUML 1O7SA 1K2DB 3VXOB 4CDGC 4F7MB 1A5FH 3BN9C 4KQ3H 4LVHC 2R0KH 2VDNL 2LABA 1E4WH 5C09A 4LSSL 4M93C 4YX2L 5KS9E 5KAQG 2DTMH 3TCLB 1D9KA 2BRQA 3RGHA 3QXAB 3F12A 3UTPD 3LEXB 1A6AB 4WY7L 4JQVC 2ZKHH 3O3EB 1QRKA 1CD8A 1JHKL 3DHJA 4KRMB 2FSEB 2YZ8A 4GQ9H 3TNMB 1H0DA 4PJBE 3O2DA 3PQYE 2YS4A 4D0BB 3OBAA 1OARL 4QRTB 1FJ1A 5EOCL 3S5LB 1WGOA 3WSQL 1BQUA 3V0VA 4JFEB 4XPHH 2C3WA 2KL6A 4X6CB 4PGDB 1MCKA 1FGNH 4RIRA 1AGFA 4AK1A 2UZXB 4Y4HC 3H7BA 1RZKH 1A6PA 5ISZA 4LKCA 1IM3B 2J7LA 1P84K 3P0GB 5CKGA 2R2CA 1MAJA 4GOSA 2EEDA 5DJDA 1K8IA 4PGZA 1NGQH 1T0MB 4YJZL 5D7LD 1F58H 4QRRE 2UVFA 2Y1VA 4YR6A 3VWJB 4Y4KA 3UJJL 2CMRH 4FQJL 3WFBH 4KRNA 1Q94B 1QLRA 4KKNA 2EDJA 2UUDH 2VDKH 5C92A 4JM4H 3D85B 2HLAB 4AIXA 4XAKE 2R23B 2L7UA 3PP4L 3QA3A 1N5YL 1ZEAL 1GIGH 5HVFB 1KJMA 1NC2A 4WI9A 1NCAH 3P4OA 4PJCB 4V2BA 1ORSA 4KJYB 3ZHDA 4YQXL 1T1ZB 1JFQL 4FG6D 2BK8A 5SWQA 1SBSH 2AJSH 2ZCLL 4U1GC 5SWZE 3DNKA 1F3JB 5JZ7C 2HT4D 3PL6A 3VGBA 3WIHH 1TZHA 4M93B 5L2KA 4S1DC 4LLQA 1WCQA 4OUOA 4MZ3A 3VXME 1J8HA 1WVZA 2IANA 5GGSY 3FO1A 4X83A 2Z8VC 1I1YA 3V52L 1FV1A 4U1LB 3KGRA 5K93A 3BD5A 3Q1SH 4XTRC 1I85A 3CFCH 5IHZB 5CEZH 1GAFH 3PHQA 1A14L 3S3JA 4HKJB 3BEVB 4QHUA 2XG4A 4KK9D 2NY6C 4LLDA 5L2JB 5KJRH 4M61A 5JOFB 1G9ML 4UNTA 5HYQB 3CX5K 2GHWB 2C3VA 3QI9D 2HP4A 1J0JA 1AI1L 4XVSH 1YN6A 2BSRA 3WEXA 3ULSA 4TUJB 3WO4C 1T04B 2JJTA 1XMWA 5E9DA 3PWUA 4XX1E 4Y4HB 3WIHA 4YAQB 3BVNA 5B4MC 2QSCL 2W60B 3M1BA 5EBWB 4P5TD 4KTDH 3NIDE 3VFOA 4WHCA 1E4JA 1MCHA 4XP5L 1MCOH 4WU7A 1I3RA 2APTA 5DF0A 2P5WE 4OIAA 5CJBA 5BZWB 4NQCB 4M1CD 1OL0A 5EO1B 4ZFFA 3CU7A 3FT3B 1T4KB 2ZOLA 4F33B 5C0CB 1JYWA 5EZLA 4M7JH 4JDZB 3ZKQD 4U0RC 2FGWL 3LCYA 3I02B 4LSRL 2AV1A 2C4FT 5JR1L 2FR4B 3MGOA 4CN4A 1C7TA 2XFXB 2D7TL 4XVJL 4MJ2A 2YA2A 4PJ9C 2J8UB 5KBNC 1L7TH 5E70A 4NUGL 2D0FA 4U1GB 2ZUVA 4YPGB 2R2BA 3V6ZB 4YE4H 4N1EA 4DVRH 4PTUA 3TP4A 4OAWB 3S37L 2VLJE 4R4BA 3KHQA 4LSVL 4XPTH 3C09C 3VXTA 1LK3L 4QF1B 4OZGF 3UTQB 1BQHB 3MRCA 2D31B 4PJXA 1GC1L 3HTLX 3PWNB 4PV9A 3BIKB 3S5LG 1BBDH 1S7XB 2WUCH 2FBJL 2QL1A 3NCYS 2NX5E 4JRYE 3HZYB 2JELH 1F8TH 1R3JB 4LNRA 3D0VA 2Q1EA 2HJKA 3ULUC 4APQD 2NY6B 4QT5B 1EK3A 5FKAA 3W81A 1KPUB 1MCCA 1CICD 5BRZB 4RX4A 4OZHF 3MRHB 1FSKC 1CN4A 2EZ0D 5EZJB 4KKBC 3PWVA 4RGNC 4Y1AD 4GRWE 2BNRD 2BNQA 2UZIL 5GRVK 4UBDD 5E0QA 3F7PC 3UJIH 3WO4B 1EH9A 5IB1A 4KV5F 4M3KB 1MRDL 1FIGH 4HD9A 3MLUL 3GZKA 3QH3B 5IBTL 4NGHL 4NWTH 3I3EA 2MFNA 2X4OB 3MJGX 3QHFH 3GMLB 4QXWA 3DETC 5HHMD 1RURH 4M1GL 5KSAD 2Q86B 4KH2A 5C86A 3GKWH 3HG1A 4AIOA 3FTGA 4XCFH 3RVWC 1MJ7H 4PP2B 2DLEA 2RFXA 1H3PH 1NBZA 4OLXH 5KG9A 1P4BL 1C08A 2N7AA 2QLVB 3UTSA 4GXUN 5CGYD 1NC4B 2DQHL 5HGDB 3MNWA 2LU4A 3DRTB 3HB3D 5A1AA 4U0RB 1T20A 3KYMB 2AGJL 2R1WB 3P77A 4Q9RH 3FOMA 3FT2A 5KSVA 4LU5L 4GAYB 2X4UA 1VERA 3NN8B 4MS8D 5L8KB 2FRGP 5IFHH 4GKSB 4PJ9B 2E6QA 3TYGH 3ULVD 1KCKA 3L3IB 5LGJA 5C3TA 4U0QB 4MXVF 1CLZL 1U8QA 3Q0HA 2WWMD 4I77L 5I1GL 3IDIB 1DBMH 4PJGF 1MCEA 5T3XL 4LLMA 3P30H 4D0CA 1GZPB 1OQXA 1RZJC 1Q9KB 3B9EA 4XB7A 3G5YB 3MLWH 4U3XA 5IHUH 2GQHA 3VXRA 1VEPA 5EUKB 3UROR 5J12B 3R06A 2BC4B 1N59A 1HSBB 4RA0C 3MBED 2D03H 1FSKB 5TQ2L 2BSTA 5ID0B 3HZVB 4RGNB 1AHWA 3ZO0A 3ZDYF 2Y07H 4QHNB 1UWGL 3QFJA 4OFKA 4RFEB 5HHMB 3P0YH 1ZLVK 3CUPA 3C87A 4LGRB 3B9KC 1DBBH 4OGXH 3MRMA 4XNYL 3NCEB 4NYLB 4JFFA 5FV1L 4UZGA 2GITB 4CVXB 3K8LA 3VH8B 1UCTA 4LCUA 5FO9A 1UENA 2P8LA 4ZUTA 3OJVC 4G9FA 1S7VB 3VRLE 1CWVA 2DI8A 5BVPL 2FIKB 4MXQC 2JCCE 4IRSD 1RVFL 3VFVB 4F80A 4XWOD 3ELAT 1X5FA 3QIBC 4TQEH 3VMOA 5B38B 1B4JH 4PJHA 2QV2A 4S1QH 1WZ1L 1R3KB 4OF6A 2CIIB 2Z8WC 3T3ME 1BQLH 3W5MA 4WTWA 5D93B 3GBML 3BFOA 3DX8B 3TT1H 3NACH 3VXUE 2DM4A 3BUYB 4F7MA 5HD8C 3WFHB 2YKLL 3MCG1 4HIEA 1KJ3H 1NCNA 3AREA 1IC5H 5A2LH 3QISA 3CVHB 4UQ3B 1I1CA 2CLZA 3C2AL 3LEXA 3KYKH 1A6AA 4LQFH 5FAAA 5TDOB 1F13A 5ID1A 3O3EA 3U9PH 1EEZA 3DUSA 3WHXB 1PQZA 3UC0L 1HN1A 1BX2B 3Q6GH 1EMTL 3TIEB 3IDXL 4D0BA 4QRTA 3GSVB 4PJDF 2KZWA 4GXVH 1G7HA 3OAYH 5C2BH 3G6DL 4AH2A 4JFEA 3EYUL 4JFQB 1KIPB 3T04D 4IDLA 5EFIB 1KACB 1YPZE 5CJ5A 1W72B 2CK2A 2VSDA 5BMFH 1J9CT 1IM3A 2IMNA 5I6XC 2CDGB 1N64L 3B9KB 1MJ8H 3S88L 5INDA 1JI2A 3GIZL 1IARB 1T0MA 2F54B 3OXRA 3BGFC 5DA0B 4XNXH 3T08A 4Z7VF 3VWJA 3H9SD 4ODSH 1Q94A 3AFLA 4A2MA 3LSOA 1OLZA 3QIBB 3D85A 3QQ4B 2HLAA 3X3GL 32C2B 1EVUA 3VW3H 4GMSH 2R23A 1PY4A 1RZIB 1DVFA 1J8KA 5C07D 3HFMH 5DJ2B 5JOEA 4ZUUA 4PJCA 2VLKE 4KJYA 5C6PB 1QNZH 1OTUD 4U2YA 2P45B 4IJ3C 2X4PA 2EDHA 3T77B 5M94B 3E8UH 4MA7H 3D39D 3EFFB 4Q2ZA 5DUMH 3BO8A 3MACL 4WEBL 3NPSC 1N6VA 1DL7L 2MHAA 2D7QA 2VR5A 3V0WL 5EC1B 1FFPB 3K2UH 2YC1B 2CO6B 4FFVC 2VABB 2V7NA 4DW2H 1KJ2H 3CXDH 4JQVA 1EUUA 1EZVX 4JQXC 2VAJA 4NPYB 5IOPA 4K23H 1FLTX 5IHZA 2VOTA 3ABZA 4L3CA 3BEVA 1WTLA 3KDMB 1ZGLA 3RVTD 4XWGL 2YPVL 2QQLL 1KCSH 3QNYB 2Q6WA 3SQOH 1QSFA 4JJ5A 4LRIA 4P5KB 3QPXL 1T04A 1Q0YH 5T3XE 3VH8G 4Y4HA 3MODH 1ZVSA 1QBML 3HUJE 1U8IB 2W60A 5EBWA 4JEGB 1UWEL 4LLWA 1KLFA 2OTUA 3DLQR 3MTRA 4PJAF 4R0LC 1KJ2A 4R97C 5B38G 3ZL4L 3BGFB 4NQCA 5BZWA 1UH2A 4EBQH 5DMGD 2I9TB 5EO1A 3ZKND 3MJ6A 2PETA 1ADQL 4GMTH 3FT3A 1A9EA 1T4KA 3NH7L 2R2HB 3PWPB 4F33A 5C0CA 2C3GA 1HINL 4MA1C 3V5KA 4YHNB 4CGTA 2X10A 4YGAB 2A77H 1CXFA 5K9OA 1JVKA 5DRWB 3L7EB 4N1CA 4P2RB 3I02A 5I16B 4OLUH 4JCLA 3K80A 3FB7B 2FR4A 1OAKL 4IJ3B 2XFXA 1RUKH 2J8UA 3OAZK 3KG5A 2APBA 4HCRL 4EDWL 3T0AA 5ESQB 1Y6KR 5F97E 4HKXB 3V6ZA 4DN3L 3NPSB 1MCPH 1T7XA 4OAWA 4WV1C 5J89A 3MLXH 1MRFH 1T2JA 1JWSB 2HLFD 4QF1A 4RWYH 4URTB 3PGCB 3MYJB 1QQDB 2AXFB 4PRHB 1HKLH 2FJFB 3MLSL 3PWNA 4G8FB 3ESUF 3D3VE 4M03A 3BIKA 4JKWA 1KB9K 3BWAB 5FHAH 3U1SL 1N2RA 1S7XA 2C7UB 1QSEB 1A0QH 3HZYA 4XP9H 5J1SC 4HXAL 3IDYC 4MNHA 3TV3L 4QT5A 5ADPH 1AFVH 1KPUA 4LIQL 4UV7L 5BRZA 4UT9L 1HDMB 4KTEL 5F6IC 4H20H 4PJ7F 4KI5D 1CLYL 1DCLA 1HH9B 5EZJA 1MI5D 2FLRT 4YGVB 1P5VA 3QQ9D 1U2CA 4FXGB 5J6HA 4DUVA 2OMNA 4MAYC 5A2FA 5SV4A 3QAZC 3QUXD 3V4VL 3WDIA 4ENED 3JWDL 1D5IL 4Z7UF 5DJXB 4HIHA 1FPTL 2A1WH 2DWDB 1NBVL 4EI6B 3U7YH 4R0LB 2DKSA 5EUOE 3IDUA 5FYJH 3F6LA 5IW3A 3JV5A 1P84J 3UO1H 1PAMA 1CDIA 3WE6A 1PJ9A 5BXFB 4PP2A 2WINB 4GSDH 1FBIL 4D9QE 2VDPL 4OB5L 4R7NB 4GG6F 3NCCB 1GPOL 1D9KD 1XF3B 2QQKL 3ULUH 3TESA 1LNUB 5HGDA 4B53A 3DXAE 1R5VB 3KYMA 1IGML 2R1WA 4C55A 4BELD 5ICXB 2YD4A 1DBKH 4QXGL 1F2QA 5F96L 3TN0D 2BZDA 1FZOB 3MLTA 5D2LB 1TQBC 1E4XH 5CSBA 4XCYA 4GKSA 1DBAH 4PJ9A 2YUXA 1NDGB 1F45A 2DRUA 2BSSB 3UBXI 1KENH 3H0TB 5E00B 5AWNL 3L3IA 4NM8H 4AG4H 4JZNB 5KVGH 2EH8H 4WV1B 4XMKL 2W9DL 4M6NL 1HQ4B 3SKOB 3LHPH 1CYGA 4M62H 5J0BA 1I9JH 3OKEB 1MLCB 3IDIA 3F7YA 1QYGH 1K4CB 1Q9KA 1Q38A 3K3QA 2ED8A 5GHWH 4U1SA 2CSPA 5GS0C 4K9EC 3BESR 5H35A 5EUKA 2ZG1A 1HH6A 2BOBB 1G9EA 3SKJL 1HSBA 4WFFE 5L0QC 3IDYB 4AEFA 4R2GD 3I9GL 3UMTA 1S5IH 2HFFB 1V5JA 4Y4KD 5IBLC 3CMGA 4DQOH 3CNKA 4NRZA 2ZJSH 5T3ZL 3HZVA 2OZ4H 1EA9C 3OKOB 3VGHA 3U82B 1PGRB 3QZWB 4NCC1 4GXUM 4MAYB 5C3LD 1FVEB 1VEMA 5TE7H 3CX5J 1T1YA 4RFEA 4MQ7B 5SWSB 5K9KB 1JMZA 3O6ML 5SX4H 3KXFE 2DQDL 3BPNC 4FNLL 2CDEB 1QR4A 5GS1C 2NY7L 4JO3H 2GITA 1JHLL 2RIKA 3CVHH 3RY6C 4X6DF 3VH8A 1BIHA 3WLWC 2R9HC 4ZDHB 1EEQA 2DLFH 3OKLB 3R0NA 1RZJH 5AZ2L 3BD3A 1ODAA 2FIKA 3PL6D 2EDQA 5L2KD 5HTSA 4M7LT 5F88A 2H1PH 1J8HD 1JN6B 3KPMB 2IAND 1A1NB 1R3KA 5DQDH 5CMAB 2CIIA 4HUVB 2VISA 4LCWE 4OCYH 2BJMH 1UZ8B 3NA4A 2OZ4A 1FL3A 2AQ2A 1EV2E 3LQAL 3DX8A 1TQBB 3MUHL 4CVUA 2YMXH 5I8OH 3BUYA 5E6IC 4A6YB 5FECB 1MCWM 2AABH 3GUTA 1W72H 4GW1B 4Z7QE 1IQDA 4RGMC 3L3DB 3HNTH 4KQ4H 3CH1B 4FFWD 5TDOA 1KT2B 1SY6L 1XGYL 2E9BA 3WS6C 5E5RB 1PD6A 3WHXA 4JM2B 3W9EB 5EOQL 3AUVA 1CK0H 2YSSA 2R1YB 3WXVL 2CXGA 1BX2A 5F70A 1TJHL 2HH0L 5J13B 1WISA 2OTWB 3LQMA 4KU1A 2IADA 5L0QB 4U1IA 4MMXC 3GSVA 4XB8A 1V3KA 4L9LB 1QFUH 2WIMA 4X8JB 3CU1A 3C2SA 3EOTH 4ODWB 3SN6N 2UWEE 4OV5B 5DXWA 3O11B 3DJ9A 5EFIA 1QSZA 1AGEB 3MO1B 4QWWC 2NY3C 1D3CA 1JIBA 1JNLH 3HA0A 1NANI 1BVKA 1YMME 2CDGA 3BPNB 3B9KA 5J1TC 1T2QL 1CE6A 4PJ5B 2A6IA 5GS1B 4IMLA 3G5ZB 5DFVD 2EDXA 4OD2B 4JQIL 2CH8A 4LIQE 4OM1H 1XCTB 3UCRA 2BVPB 5FKPA 6FABL 4IS6B 3MNZB 4H88L 2Y06H 3E6HA 3JBG7 4DOHE 5T33H 1XF4B 3QIBA 3QQ4A 32C2A 2NLJB 3MMEB 1G7PA 4DAGH 1GOGA 1DBJL 4MB5A 3VFRB 5DJ2A 5I19L 5FM8A 4YFLF 4NO0D 1DDHB 1JGVH 3T77A 2FB4L 4Y19B 1U3HC 4YHLL 3EFFA 2EYTB 4LLAA 2X4RB 4X99B 4MVBC 3LRSB 4PRPD 1CIUA 4KRPD 3W9DB 5ILTH 1YEIH 4IRJC 5FA4B 3EDKA 1FFPA 5CEYB 2YC1A 4HC1A 1YMHB 4RGMB 3D2UA 1YEHL 2VABA 3SGEI 1XR8A 1BP3B 1ZV5A 3BYTA 1RUQH 4ODBD 5HI4C 4OI8A 5DJZB 4ZFOL 1NGZB 3QDHA 1FRGL 4NPYA 5LWYH 1W0WA 3B4NA 4HWNA 2MMXA 1H8OA 3EJJX 3MROB 4ODVH 1PX4A 3KDMA 3QZWG 5A16A 5ICZB 4KK8C 1AO7E 3UZEA 2P1YA 3QNYA 2FH6A 5C7XH 1EXUA 5GGTL 3RIFK 4PR5B 4PS4L 3HG1D 1ZSDB 4YXLL 2XN9D 1DQQB 3MGAA 1U8MB 2NY3B 2WBJC 1U42A 4BYHA 1YJDH 3DYPA 5CFHA 4I8DA 3EYVA 1KV3A 1T5XB 4JHAH 2Z31C 5JO5A 2UVEA 1U9KA 1CR9H 3NABL 2KKQA 3ARDC 2M8XA 2D0HA 3U0PA 1GZQA 2A0LC 5T3ZE 1KTLA 5D5MF 3PWPA 1GGIL 1C5CL 4YHNA 4KJPC 3X11A 5IGXL 3CIQA 2CUMA 5KAQF 3SGDH 3K0WA 1A7BA 5HI3C 4TYUA 4P2RA 1OP5K 5CIPB 4JJHA 1L0XA 2HJLB 3JVGA 5GZND 2X9YA 4HPOH 5HYSA 4WCYH 3BE1H 1U3HB 1WBZA 5IHBA 3BOVA 2IPKB 4HKXA 3IAGC 3SJVE 4FQXC 4N0FA 4JFPA 1JWSA 3CAFA 4IRJB 3RZCC 1ZKAA 2F8XC 5JUEH 2PYFB 3MYJA 4S1RH 5JHLL 2WIIB 1FVCB 4G8FA 3HR5B 4MMZC 1JBJA 2BVTA 3BWAA 4FQ2L 4JQXA 3VMPA 2C7UA 4MNGE 1LEKB 4HS6B 4RAVA 4Z0BL 1FFOA 4YXHH 4NZDA 1FP5A 3ZMRA 1JGLL 1G6RL 2X2YA 1BPVA 5IFJB 2ITCB 4EDXB 1UM5L 1EHAA 3F6IA 4G9FD 5FO7B 5JTWA 1HH9A 4JDTH 4YGVA 5IMOB 2Q3ZA 3QDMD 4FXGA 5A40E 4NHUB 3FO0L 4P2OC 4UTAL 2WBJB 4MCYA 5BW7C 4KMLB 3FZUD 3RL2B 4Q9CA 2DWDA 2VITB 3GRWH 2HTKC 2NY0B 4UOW0 2BFVL 2OQJB 2JIXA 4OCRH 2PF6A 4R0LA 1Q72H 2YD7A 2DQFB 3ARDB 4WUKL 2EIDA 4L3EE 3ARED 5BXFA 5GGRA 2V2XB 2G60H 2WINA 1MH5B 3N9GL 4HHAA 2C1PA 4NZUH 4G43B 1SHMA 1NH6A 4K7PL 4TULH 1L4IA 3MC0A 2AKRB 1R5VA 3U46B 1HHJB 2AXJA 3EO1A 1KCRL 5ICXA 4BK4A 4R8WH 5CINL 4PRDB 1MCJA 5KVDL 2DLHA 3STLA 4AEIH 2E9WA 4E41E 5J06A 4FS0A 5IEKA 3MV8D 5CZXC 5F93C 2NY1C 1NDGA 5I73C 3PP3K 5DQ9B 3CFEB 3FQXB 3I3DA 3H0TA 3EO0B 3ARFD 5E00A 2KBGA 4FQXB 4JZNA 1JYNA 4N8VB 3MJ9H 4GAFB 1HQ4A 3RZCB 2O5ZH 2ZUSA 5KZCD 4GO6B 2E7MA 2DL2A 1LO2L 4OGZA 5JW3H 1K4CA 4UB0L 5GSVA 4O5LH 4JFDD 3IJHB 1UYWL 1W8OA 5LAXB 4XP4L 3CFDA 1RFDL 2BOBA 2P5EB 2Y6SD 3DPBA 1YEFH 3OR7B 4OFYA 2HKFH 1BFSA 1E6OL 4A2LA 2EDTA 4NKIL 1INDL 5GRUH 3QDGE 1JPTL 4P4KD 5GJSL 5IKCB 3OKOA 4Q97A 2IH1B 2IFFL 2ZCKL 3GJEB 4OZGE 2I60H 4A6YH 5K9KA 2F53A 3CLFL 2C1OB 1DVFD 3OB8A 3MJ9A 4RAUA 5F9JB 3RI5F 2CDEA 4NNYB 4YZFF 1AGBB 2E6PA 2VO5A 3M07A 2XZQH 5F1IB 1MLBB 1KC5L 3EFDH 4UIMB 1BWMA 4QHMB 4OZHE 5GS0H 2X44D 4K9EH 1TTGA 5I1IL 3FQNB 3RIAF 3GI8L 1JN6A 4OD3L 4BQ6A 1F42A 5CMAA 1IQWL 3B3IB 4HIJB 1XGPA 1XEDA 2ICEA 5F8RC 1FG2A 4KKLC 1OAXH 5CWSB 5J6GB 4A6YA 3IFLH 2NY1B 5FECA 5GISH 5I73B 4X6CF 4P46C 1C5DB 5HXMA 1SVCP 2F74B 3LKPB 1N4XH 2XWJA 3H9HA 4KHTL 1INQB 4S1SL 3S36H 3UZQA 1QSFD 3L3DA 1B3JA 5F1OB 3CH1A 1RJYB 1Q0XH 1J88A 3KPPA 4WO4C 4NQEE 2FYYB 3W9EA 1HYSD 1MHPL 2VWEC 4OQTL 1PYWA 3CD4A 2R1YA 4W6XB 3PG2A 3DBXB 4GLRI 4PBVC 1KB9J 3RX8A 1KCLA 5C6TL 4TTGA 1ZANH 1ZHNB 4X8JA 1DQMH 4JR9L 5E2WH 1FNLA 1XF2B 1A6UH 4P2QD 3HI1B 5DWUL 3DSFH 5J9PA 1G7LB 4M6OH 5DD6B 1EFXA 3QNXB 3O11A 1FC1A 1AGEA 3MO1A 2YN3A 2DQUH 1LO4H 4JFZL 1OT2A 4PJGE 1JNNH 3LB6D 2XTJC 1YYML 3U9UB 3RTQC 3EZ8A 4L4TD 1IM9B 1OCWL 4ZD3H 5I71C 3IKCA 4PJ5A 3VFGL 4CMMB 5GS1A 3G5ZA 4OD2A 2F8OA 3RY6A 5JPMA 1LP9B 2PXYC 2LQRA 3CSGA 3VD7A 2BNRE 1BLNB 3LEVH 4IS6A 3MNZA 1LILA 2DLGA 5CD5C 2R8SL 1XF4A 5L8JB 4S1DD 1G0YR 4EOWL 1A47A 3Q5YA 4MQXD 2WMPA 2NLJA 4M8VA 3ZDYE 5C71A 3MMEA 1Q9LB 4POYA 2GUOA 4GFTB 4DZBB 3VFRA 2YPLD 4KUZL 1MPAL 4NNPH 4ZO8A 4N8VG 1AD9B 4G6FD 3V8OA 3WNLA 5F9WB 1DDHA 3NZHL 5E6IA 1FN4A 2AEPL 3ILQC 1ETZA 4OI9A 3RWJA 4P46B 4TSBL 2X4RA 4OF3A 3LRSA 4YXKH 3MCLH 2WK2A 5FA4A 4WWKD 5CEYA 5B39B 4QGTA 4HIXL 5EZOL 5TH2A 3WS6A 4D9RE 5DJZA 4PJFB 4WO4B 1NGZA 5I1EL 4OCSL 4JKPH 3MXWH 5FUCC 1OM3L 1KCVH 1OTTD 3HRPA 4K7FB 4U1JB 5EU6D 1UEMA 3MROA 2GI7A 3WUZA 1A7PH 1CQKA 4PP1D 1KTRL 3UAJD 5ICZA 5HGGS 3B9AA 1OPGL 5EO9B 2J4WH 4JVPA 1XAUA 2X5PA 3HPJA 1HIML 2GJ6E 5CIPH 1ZSDA 3VE0B 1JYVA 1DQQA 3HI5L 3QRGL 2XA3A 1U8MA 1CXKA 1ZLVH 3H3BC 2BX5A 3TZVC 4FQQB 2F5AL 3RTQB 1GHFH 2YXMA 3QIUC 1QR1B 1MAKA 3OSKA 5I71B 1F4XH 4ZSOB 1UJTA 2PXYB 3MJ8B 3QXUA 4UU9A 5MERB 2CDFA 3JXAA 4KK6C 4LGPB 3EUUA 3E2HB 5C0IB 3IVKA 5MEPB 4ZAKC 5ACZB 3BKCH 4NC1E 5GGSB 2VDQL 3BH8A 2BY0A 4QHLB 3O6FC 3L95A 1P4LB 1EHNA 5T1LB 1NUFA 4ALAL 1U8OB 4YHIB 5F9OH 4LASL 4DKAA 3ULUD 4M43H 1U3HA 1BJ1J 2IPKA 3LZFH 1RUAL 2K7QA 3KPNB 1TETH 5FYLL 3S97C 1NKOA 3RX5A 4IRJA 3U36B 4X9BA 4I2XB 1T66C 2GIYA 1UH4A 2DDQL 3FRPA 1U3JA 3P4MA 4OZIB 4HS6A 2A83B 1LEKA 1CQYA 4LMQI 3RNKB 4GW5B 2EDFA 1OGAE 5T1DL 1UCBL 3M8OH 2ADFL 3W11D 5FXCH 3DETD 2HMIC 2ITCA 4EDXA 1KNOB 2Z35B 3G04B 1WIOA 5F1NA 1BJMA 1A3LL 3RU8L 4JO1H 4HSQA 5I8KL 5C0EA 4FTVE 2O5XH 5IMOA 2J6EL 3AXLA 3QUZB 5L88H 3BZFB 4NHUA 1I8KB 1IC4L 5F7MC 2WBJA 5KSUA 2AXGB 5MHSD 1N5AB 3LKOB 1E28B 4LAQL 3TZVB 3TA3C 2GSGB 4P49A 4PJEF 3RL2A 4JB9H 1IGIH 3QIUB 1TJIL 3RBSA 3D25A 5FUZH 4LSQH 1DUZB 2NX5A 1IKFH 2Z31A 1TVDA 1JNJA 2AI0H 3MUGB 3WD5L 4H8WL 5D7IB 4XHJC 4W81A 5DZNA 1JGUH 5IV2B 3K81A 3ARDA 4ZXBB 2APXA 5TE4L 4WFHD 5DMIH 1WLHA 3BGMA 3HC0B 1A7OH 4ZAKB 3SCMA 5D1ZD 4G43A 4PGJA 4M4PA 2DS4A 2EDWA 4FABL 3O6FB 5DJ6A 1R3IL 1MY5A 2AJUH 2AKRA 3LV3A 4PY7B 5JW4N 1EHLL 1HHJA 5I1AB 4UTBL 1YEDA 4PRDA 1Q1JH 3HZKA 4WEMB 2X42A 1MCDA 1QBLH 5IR1B 2WW8A 5B39G 3H9SE 5DC0A 5DQ9A 3FQXA 3KYNB 3EO0A 4FQXA 5GGVH 4HUWB 3P11H 5I1LB 1A5FL 4KQ3L 2R0KL 2XWBB 1QRNA 3ZYZA 1UKTA 1E4WL 2D2OA 4RMTA 3VRJB 1KN2H 2DTML 2QHRH 3IJHA 2FEDC 4KROD 5IMMB 5LAXA 3PDOB 2FD6H 5C70A 4WI2A 2ZKHL 3KVQA 3MZGB 3OR7A 2RR3A 2WLZA 5IT2H 4GQ9L 3U0WH 5T1KB 2JF1A 3B9VA 1M7IA 5IKCA 1OWWA 1N26A 1BEYH 3GJEA 3T0EE 4P2OA 1V3MA 5FOBB 4XPHL 5BW7A 1MUJA 2ESVA 2C1OA 5JIKA 4UNVA 4LARH 5IVZB 3TA3B 3MLYH 4BJLA 1FGNL 3OKYA 4YFLI 2YA0A 2BVYA 2OJZH 1RZKL 2VL5B 3RDTD 5HVWA 3QQ3B 1RY7B 5F1IA 4LHUG 5HD8D 3TJEH 4EVNB 3DV4A 4D0DB 4Q6IC 5JMOC 1NGQL 1P9MC 4QHMA 3X13B 1F58L 1QHPA 5AD0A 3ARWA 3KAAA 1CDYA 4TSAH 2CMRL 3D2UD 4HJGB 4DFIA 1VADB 3WFBL 2XRAH 5GJTH 5H94A 3EW3B 4NBZB 5IB5B 1ZT1B 2VDKL 3KLAB 4JM4L 4Y2DC 1CVRA 1A9BA 3OAZH 2P4AB 3V2AR 1GIGL 1UA6H 5CWSA 1A6WH 5J6GA 5E1AB 4DEPC 4U7MA 4M02A 1TLKA 1C5DA 1NMBH 2F74A 2B0SH 1BOGA 3HKFA 1SBSL 2AJSL 4WTXA 5KTEH 4PGEB 4R7DB 4G6MH 3WIHL 4WI5A 2CPCA 1RJYA 2FYYA 2NW3B 4FQ1H 1PKOA 1NAMB 1A6TA 4FQHB 2ZG3A 5EBMA 4HFUH 2NW2A 3K8KA 3Q1SL 4Z9KB 4B41A 3CFCL 1JZ8A 4MJIA 5CEZL 1J86A 1GAFL 4X4MA 3O3UN 1MFAH 1QLFB 5FYLE 5IB3A 5KJRL 4G8GD 3QNXA 5J4MA 5CEXB 3CDCA 4L5FH 4NZTH 4WJ5B 2XXMB 1Z5LA 5DMKA 1FYTA 2X6MA 4Y5VB 4JAMB 4XVSL 3G9VA 4IHOA 2HRLA 2ILLA 3TFKC 1ZAGA 1IM9A 1NCDH 2JJSC 3T09A 4CMMA 5KOVC 3INUH 7FABH 2X89D 4DK3A 4Z5RA 1HHKB 5CP7B 1KOAA 1LP9A 1YY9C 4KTDL 1MCOL 4Q6IB 1H3XA 1BLNA 4ELME 1SM3H 5CUSH 4LLUA 4M8QB 2YPKA 4HKBB 3MXVH 4FFVD 3GMRB 2CIKA 3O3AB 5D2NE 1DUYB 1YPZA 2CR3A 5GSRA 1WT5A 2R0ZH 1Z9MA 2OR8A 4M7JL 3DYMA 3FB8A 1RMFH 4PTTB 3QCVH 3D48R 5LKNA 4DEPB 4Y4FC 5HVHC 5C09E 1JUFB 4HUMB 4P46A 5DD1H 5IM7B 3SDAD 1PVHA 1L7TL 1H5BB 3W0WB 5B39A 3U0TB 1OY3B 4YE4L 2Y5TA 3Q5TA 4DVRL 5EDXA 1RHFA 4XPTL 5DI8B 4XBPB 4OUUA 2EE9A 4I0PC 5D1XC 4K7FA 4U1JA 5D1QC 3DX6B 1BD2B 1M6OB 4OLWH 12E8H 2JIXD 4HG4K 2A6JB 1BBDL 3V6BR 1CBVH 2WUCL 4O9HH 4TUKH 2X4QB 5IB4B 3UPRB 1IAOA 2ADJB 5EO9A 2JELL 2ZP0T 1JZ5A 1F8TL 3AY4A 5DD0H 1ONQB 4B7LA 1CGUA 3ZT5A 1A2YA 1RV6X 4H1LB 4PLJD 3ILPB 1KBGH 3J7HA 5F3BB 4KDTC 1H3TA 3NAAH 5ISZE 2IFGA 3RVUC 3ZKXC 2APVA 1C5BH 3TH4T 2BMKB 3O3DA 3VDAA 1CFVH 2LV4A 3RTQA 2P47B 3IAPA 3UJIL 2YEZB 2YD2A 3U83A 1DN2A 1QR1A 1MREH 1FIGL 1J0HA 4I0KA 1TPXC 5C9KA 3AB0B 4X0KA 2X70B 2F19H 1T7ZA 3HE6B 4NWTL 2PXYA 3MJ8A 5MERA 4UOJA 3QHFL 1GH7A 1KG0A 1E27B 5E7FA 5C0IA 4M6AA 3AU1B 1I4FB 1RURL 4Y2OA 5MEPA 5HHXH 4NJ9H 2P49B 3X3FH 4G6AC 5BS0B 3GKWL 4LHUA 1BJ1H 4QHLA 4XCFL 2HG5B 1MJ7L 2NXZC 4BK5A 1X5GA 4G5ZH 1H3PL 4MA3B 4OLXL 1RZ7H 5CHNA 5T1LA 1U8OA 3HC4H 2ZUWA 4P23A 1SEBA 2ERJC 4N5ED 3MR9B 5DK2B 4Q9RL 5E99H 3RWCB 4OFYD 5HVHB 4NWUH 4LCIH 3ZTJG 4MD0B 5IFHL 1U8KA 3KPNA 3KPSB 3QWQB 3BKYH 5E94A 3JZ7A 1P7QA 3U36A 4NKMB 2HTLC 5GGUB 2IANE 4KMTH 3TYGL 2AJYH 3UBXB 5FUOH 5TE6L 1XT5A 3V0AC 1CGSH 3N85H 4XNUH 2F53D 5D1XB 4KPHH 3BEWB 1UFUA 2WUBH 1DBML 5D1QB 2Z91A 4F8QA 3RNKA 3P30L 4E5XB 4KKCD 5A3ID 4YDKH 3MLWL 5IHUL 1KNOA 3G04A 4MXWH 3J8F7 3ROOB 1RIHH 3LMJH 1KIUA 2XZCH 3U79A 4UV4H 3WFDH 2IQAB 3BZFA 4MDIB 3VGAC 5E9DE 5E4EC 2D03L 1MIMH 3ZKXB 1L9NA 5D71H 5D2LF 3LKOA 1I9EA 3QJFB 2Y07L 3TZVA 2GSGA 4JGMA 2VXVH 3QIUA 5F6HI 1DUZA 5TPWH 3P0YL 3MUGA 2PTTA 5D7IA 4ODUB 1DBBL 1F4YH 3CDGB 4OGXL 5CEZE 5IV2A 3N06B 4ZPTA 1OHQA 4HBCH 4DGIH 4KVNH 2ENYA 2XWTB 1N6UA 4ZAKA 2PYED 4AT6B 1RK0B 1U2HA 1JZ4A 1B0WA 4KI5F 3O6FA 4YNYA 4PY7A 1KIQB 2EXYD 4M9OA 4TNWK 4X7EC 4XPFH 1D5MB 4TQEL 1B4JL 2VN7A 1CU4H 4S1QL 1S7TA 4S2SB 2ERJB 1FG9C 4X9FA 3UPCA 2N1KA 1BQLL 4Q9BA 3KYNA 3WKMH 5I8EB 3TT1L 3NACL 2ORBH 4HUWA 5AYUH 1GVIA 2XWBA 3RA7H 1NGYB 5DJ8A 1KJ3L 1EFXD 3VU2A 4CW1A 5D5ME 1IC5L 3VRJA 3TIDB 43CAB 2XNAB 3GSUB 2C26A 5FB8B 5JW4Q 4LQFL 3KYKL 3PDOA 3NFSH 4H1LG 3U9PL 1W2KT 4BQCA 3UX9B 3PQYD 5C0BB 3Q6GL 5T1KA 4N0UB 2R9HD 3SY0A 1CTOA 4G7YH 4P59H 2HFGH 4KHXH 4Z76B 2BNQE 5E8OA 2VQTA 3O45A 2VIRB 2UY6A 1PSKH 4GXVL 4P2CG 5DJCB 3VGAB 3VXNB 5C2BL 5FOBA 5IVZA 3TA3A 3C60C 3LN9A 3ARUA 3GB7B 5BMFL 2VL5A 5EC2B 3QQ3A 4YDIH 3K4ZA 4MJ6B 5E6ID 5IQ9B 4S10A 1MJ8L 3KPQA 2VZTA 4ZUWB 3ZTJH 3S34H 4QRRD 2CD0A 3X13A 2VL4A 5AEAA 4XNXL 3UTSE 1NAMH 5CZVH 4JM2F 1ZT7B 4HJGA 5K59E 1VADA 4ODSL 3BKMH 1OP5H 1ZT1A 3ZE2E 3KLAA 1QFWI 3SDCB 4XAKD 5A43C 2CKBB 4RAHA 1B0GB 2HKHH 3B5TA 4OFVA 1EUTA 3VW3L 4GMSL 5ACMA 4LF3B 3HFML 4NM4H 4WGWB 3UBXG 5E1AA 4BSJA 1UM4H 3BZEB 1QNZL 1KXVC 5JIPA 2W9EH 5SWZD 3E8UL 4MA7L 3QDJA 4PGEA 5DUML 1IEBB 2FWOB 4R7DA 3O6LH 4UDTA 4WIQA 4X7FC 1AH1A 2Y36H 4BZ1H 3VXMD 1KUMA 2B4CC 2G75B 3K2UL 2NW3A 3VXRE 3JTTB 2ZNWA 2F5BH 4DW2L 1NAMA 4XP6H 4FQHA 1KJ2L 3CXDL 5IF0B 4CU7A 5HHVH 1LHZA 4ZO7A 3VD5A 4OLYH 2I25N 5IG7B 4K23L 4LLYB 1YNKH 3TVMC 4YDVB 3BQUB 4HQQH 3W5NA 5CJOH 4KZEH 5ETUB 2BVEA 2PW2B 1QLFA 4K7PY 5HGAB 4QRPE 2R0WH 3OV6A 3QFJE 1KCSL 2HWZH 2AEIT 1ZLWK 4WJ5A 5CEXA 2QHLA 1FZMA 1IGJB 3SQOL 5D6DC 5FGCE 3KLHD 2QKIA 4JAMA 3FONA 3FQWB 1XGRB 5IUSA 4QRRB 1Q0YL 4JFFE 3R1GH 4Y8DC 3MODL 4NKDB 3DVNB 3GSOB 4HT1H 1P7KB 2W1NA 5E1HB 3PV7A 4G9FE 1VFMA 2EC8A 2W0FB 4HCRA 2ICCA 1U92A 2P5WD 3CPLB 3FCTB 4Q6IA 2X4TB 5I17B 4MVBD 1P9MA 3G6JA 4PJHE 1OTSD 4EBQL 4HKBA 4HW6A 2UWEA 3GMRA 1BFOB 3JV0A 4GMTL 1DUYA 4POUB 5AZEH 2LTQC 5HI4D 4DUXA 4Y2DA 2X4NA 4GKZB 1R3HA 1DLHB 1I1AC 1IGYB 2A77L 2IEPA 2R1XB 2Q8AH 4H1LH 3PP3H 3F7VB 4OLUL 1OAQH 1GGBH 4HS8H 4KK8D 4Y89A 1EO8H 1DANT 1RUKL 1B6DA 2WQRA 4OI7A 3NZ8B 1FORH 1T6WA 2VLJD 4BQ8A 3W0WA 3U0TA 3FKUS 2PO6B 1MCPL 1KLGA 4NC1C 3MLXL 1MRFL 4XBPA 4RWYL 3RWGA 3IGAA 1WWWX 2YOCA 4HWEH 1HKLL 1M6OA 4K3JH 1EBPA 2NX5D 5FHAL 2Z31D 3FQRB 3MREB 1L0YA 1A0QL 5MENB 3B6SA 3C6LC 4Z7WF 3TVMB 1ONQA 3BX7C 1D5BB 3DIFB 4JFEE 4KAQH 4XP9L 3VXSB 4GG8B 3P0VH 4X6CE 2OXHA 4H1LA 5ADPL 1AFVL 5GXBB 3ILPA 5EULV 2HVKB 5FCSH 4JO2H 5IEHA 3SCMD 4MDJB 4H20L 4XCNA 5F3BA 3NA9H 5EIVA 3MV9B 1LE9B 1S7WA 2B2XH 3T65A 4HUXB 4IDJH 4WI8A 3SKMA 4OIIH 1CGVA 1TVHB 3OKDB 4HULB 3GI9H 5DRNB 2K3TA 2YEZA 5CAYB 2RBLA 2JJSA 3GK8H 3CZFB 4MQTB 4U6YA 1RQ5A 1EAPB 3E3QC 3CDYA 4K3GA 1NCCH 3ZSSA 4X4YB 5B3JF 4FQIH 3U7YL 2MTPA 2VDLH 4DCQA 3QCUL 1NLBH 1WWAX 2XT1B 1VDGA 5FYJL 3AU1A 1I4FA 4KC3B 4FFYH 1QFOA 5BS0A 1QRND 2PKDA 1SQ2N 2Q20A 3UO1L 4OLVH 5BVJB 3GGWB 1MJUH 1BOYA 1C16B 1PKQB 4N0CC 2HG5A 4PJCE 4RZCB 1XIWA 4X6EB 3MNVA 4GSDL 4MA3A 4WUUB 1B2WH 2FH8A 3ULUL 1I1AB 3V79C 5T1MB 1X6NA 2OL3H 3MR9A 1VACB 5DK2A 1AP2B 1DBKL 1F90L 4IM8A 4E42A 4Y4FA 3RWCA 4QOKB 4ONOA 4XVUD 2OI9C 3REVB 4N8CH 1E4XL 4XRCB 3FOLA 1DBAL 4MYWB 1T1WB 2B5IC 4NKMA 4ODHH 5GGUA 4PJDB 1KENL 2BERA 4AG4L 4NM8L 3UBXA 4HKZB 5C0ND 1L7IH 5KVGL 3BP6B 5D70H 4JRYB 2EH8L 1HILB 4O2EA 4PJ8D 4CADB 4P2OD 3LHPL 5IP4A 1JWMB 4M62L 4I0PA 4O02H 5D1XA 3BEWA 3IKKA 5INCA 1YN7A 3H3PH 4GRMA 1ZS8B 1QYGL 4YUEH 3O2WH 5MP6H 5GHWL 4E5XA 3L3OB 1G84A 3FMGH 3DTXB 3IF1B 2YBRB 4P9HC 1I7ZB 2EE3A 2G9HB 3C6LB 4OTXH 1WBXB 4GBXD 1VFBB 3PABA 3KS0J 4WW1B 5TF1H 5FF6B 3IT8D 3ROOA 2OL3A 2ZOKB 1R5WB 4Z7VB 1S5IL 2IQAA 1X7QB 5TDPA 3QXTA 4DQOL 2ZJSL 1FFNB 2OZ4L 3ZZ1A 3QJFA 4XNMB 3TF7C 4JANB 4TTDD 1ZA6B 3T3PF 2XKNB 5TE7L 4MNGA 1FH5H 4V2CB 3EJZD 4NQCE 4ODUA 4ZTPH 2QSQA 2HT2D 4OBSA 1EVTC 2A73B 2NY5C 5DLMH 5GIRB 5FIEA 3SDDC 3D18A 4JO3L 3ALXA 3CVHL 2V9QA 2GK2A 5C0CE 4AT6A 1W0VB 1YEJH 2DLFL 4MNQB 1RZ8B 1RZJL 5JA8B 5EU5B 1P6FA 1KIQA 2WLYA 1WZLA 4OD1H 2H1PL 3RI5K 1JJUA 4S2SA 5DQDL 5DTFB 2J8UE 4XCEA 4OCYL 2G5BA 2BJML 2VR4A 4ZYKB 3FQUB 2OX5A 1KTKE 1A6VL 5HVGB 3VXUD 3NIGF 4MJID 2OI9B 1HHGB 2OMBA 5CSZB 2ADIB 4X7SH 3QEUB 2YMXL 5FHBH 2IH3A 5I8OL 4NOFA 2B5IB 4L3EA 2AABL 4Z77A 1W72L 5CBEA 5FM5M 4ORZC 1NANH 1KXTB 1FYTD 43CAA 3GSUA 4ACPA 3RJDA 3HNTL 4KQ4L 3TJHC 4OZ4B 2DJ4A 2XKUA 4U6TA 3G6AB 2GY5A 1M4KA 3VGEA 5BRZE 4NHCH 1CK0L 5C0BA 2R4RH 4NRXB 3PV6B 1HEZB 1KGCE 4HG4J 2CKBH 2GCYA 4ZS6D 3U2SA 43C9B 1QFUL 3AS1A 2ARJB 4M5ZH 3TCXA 1TIUA 3WDHA 3T0XA 3VWKC 2Q7NA 3OGCB 2OS7A 1DSFH 4EI5C 1X5HA 4U2ZA 3IJSB 5BOZG 1JNLL 2FJGB 3Q48A 1R5IB 5F9AC 2HFEB 3BPOB 4MJ6A 3SDDB 5ICYA 2AK4A 4ZUWA 3ETBF 3EOYG 2CXKA 2VUOA 5I0DA 1J5OH 5C0GB 1M7DB 5KVFH 4P57B 3QDGA 3QEQB 3I75A 1C7SA 3PWLB 4OM1L 3SGEH 3RVVC 5F7KC 3SE8H 3MCKA 2A9MH 5ERWB 4OZGA 3SKNB 2GEEA 5IJKC 2Y06L 1QEWA 4ZOEA 2RJMA 5T33L 2VAAB 4L8CA 1RJCA 2CKBA 2X1XR 1B0GA 5C08B 1QSVA 1HZHH 4DAGL 2VLKD 5LBSH 1NFKA 4LF3A 2DQEH 3TT3L 4K8RC 3TEUA 2Q8BH 3ARGD 2H41A 5F7UA 1A7QH 1JGVL 3QO1B 5AG8A 2YUVA 2WAHA 2V5TA 4C56B 5FYJE 1GGYA 4OZHA 1IEBA 1Y0LB 5DO2C 4PJ7B 1UACH 4NCDA 5ALBH 3VFTA 3FFDB 5ILTL 1YEIL 4DTGH 5F7NC 2G75A 3DV6B 2VXSH 1FLRH 2XTJD 3JTTA 1P2CB 1LP9F 3SDXF 3TO2A 3ULUE 3T0VA 1RUQL 5FFLA 2WQ8A 5IF0A 3NBNA 1WAAF 3MBXH 5EG6C 3VA2C 1T5WB 2X9XA 4NKOA 1D5ZB 4LLYA 5LWYL 1Z9SA 1MCNA 4ODVL 4RGNE 1BFVH 3S6CA 3B5HA 2XZAH 3TM6A 1NMAH 1OSPH 2FHBA 1AIFB 5C7XL 3IU3B 5JW4R 2YD8A 4LHUD 1UC6A 2P7TB 3VWKB 3FQWA 5T3XD 1F3RB 1XGRA 3C60A 4NQEA 3RVXC 4EI5B 3R0MA 4N90E 1S78C 2NYYD 4P23D 4NKDA 3DVNA 3GSOA 1YJDL 4JE4B 3BIBX 1P7KA 4OGAD 1MHHB 4HH8A 2W0FA 3T0DA 4JHAL 3FCTA 4POZD 2X4TA 5EZIH 2B4CH 3RNQA 4J1UB 4W68A 4JVWA 1P7QD 2H45A 4PJFF 1CR9L 2OP4H 5MHSE 2NY4D 2VLKB 3G5VB 1BFOA 3AC0A 1MQ8A 5C0FB 1J12A 1TXKA 4BFBD 3L3GB 5EPMB 2XPGB 1DLHA 1IGYA 3TBSB 1A1MA 2R1XA 3O4LB 2HT3D 5CSGA 5GGQH 5AG9A 2IF7A 2DQTH 1OP9A 2NNAB 2X1OA 4OZFB 4HPOL 5JNYB 4JY6B 2L4OA 4WCYL 2P8MB 2HN7B 3FRUB 2LAGB 3BE1L 3E6FB 4R4NC 2AEWA 1UJ3C 3BHBB 4V1DA 1JP5A 5JUEL 3D3VD 4WFGE 4ZFGH 2WBKA 1TQCC 4S1RL 3V6OC 2IQ9H 3KPRA 3RHWF 2J5LC 3MREA 2V17H 1IT9H 4YXHL 2XY2A 5MENA 4TVPH 4X6FA 1NKRA 3TVMA 3MRPB 3DIFA 1D5BA 1VGEH 4GG8A 4NT6A 4X6DB 3DI3B 2IAMC 3V5DB 4ETQA 2HVKA 2F8VA 4ZUSB 3MV9A 5D6DA 5E2TH 4JDTL 3EYQC 1TVHA 5IW6A 2FHFA 5L8LB 3S35H 5DRNA 2DM3A 4I48B 3CZFA 3QXWA 1TNMA 3JV6B 5BZDB 1EAPA 1FO0B 3MFFB 3SE3C 5I1KH 2CLVA 3GRWL 4LSUH 2ATPA 2BY1A 2L0DA 4X4YA 4OCRL 1CDJA 3QPQC 3Q3GB 5D7JC 1Q72L 4QCIB 1ZHKB 3T1FB 1K5NB 1F3DJ 1ED3B 3C8HA 3EJYC 2GJ6A 3BDBA 2FO4A 4OZIF 4HZLA 4CJ0A 1U0QA 3BP7B 3C5SA 4D9QD 1C16A 1PKQA 1Q9WB 3HPLB 1BHGA 3CC5B 4RZCA 1TNNA 2GT9B 2G60L 3REWB 3WIFA 4X5XB 5DJAB 4NZUL 2BDNH 3D6GA 1VCAA 4BUGA 3IRZA 4HZAA 1QD0A 4O58H 4TULL 2ED9A 3EDEA 1I1AA 5T1MA 4D3CH 3L3KA 4Y16C 1UXSB 1AP2A 3BIAX 4R8WL 2N7BA 4AEIL 4QOKA 1WCBA 3REVA 2FNBA 3CCHB 5ESVB 3KPOB 2DD8H 2HYMA 1T1WA 3GSXA 4PJDA 2GKIA 3I85A 3OWEA 1ACYH 5ANMB 3LKRB 3BP6A 4N0YH 1HILA 1UJ3B 3MJ9L 4CADA 2O5ZL 4KDWA 4C4KT 4R4FH 3KS0H 1N8ZA 5D7IF 2BP3A 1TQCB 3KHOA 1ZS8A 5JW3L 3NFPA 1RD6A 3Q6FA 3L3OA 4O5LL 5HHPB 2J5LB 3DTXA 4JFYA 1JGEA 3IF1A 4O51B 2FX8H 3HMWH 1BGXH 3PGFH 1I7ZA 5H2BB 2FECL 2G9HA 4U4BA 4WFFD 3C6LA 2DQIH 4AMKH 4K07A 1KJVA 2F58H 4O2CB 1JPSH 1VFBA 4WW1A 5FF6A 1YEFL 2ZOKA 4S0TD 3RAJH 1YQ2A 4Z7VA 2HKFL 4BH8B 9CGTA 1X7QA 4JRXB 3BW9B 5GRUL 1FFNA 2BCKB 5I2IA 4IOFC 4XNMA 5LCVH 1MFCL 4JANA 5EUOB 3KXFD 2I60L 4HK3N 4GAGH 4A6YL 2DJUA 4F7EB 1WZKA 4OCWH 1S7QA 3IDGB 4XCCH 5IW1B 1OGAA 2A73A 1FVDA 1OB1A 3A6BH 5D7JB 3PWPE 1K4DA 2XZQL 4J23A 3DXAB 4EN3B 1MCQA 1XGTB 4FTVA 4J8RA 2AVGA 5I1DA 3EFDL 2CK0H 2KQNA 4P2RE 3GKZA 4JPKH 4P9HH 4K9EL 4P9MH 5GS0L 4U6XB 4GUPB 5F3HA 4OZFG 2E3VA 2AJVH 4LCWD 2PN5A 3VJ6A 4GLRH 3BZ4A 4PYGA 3MUY1 4Y16B 1T83C 3GBNH 2AQ1A 3WV0A 5HHOB 4KJQD 4NN6C 2H26B 2PCPB 4GRLA 4L1HA 2EDEA 1HHGA 1OAXL 1MFEH 2ADIA 3QEUA 1MFBH 1U91A 8FABB 3IFLL 4TSCH 5GISL 1JGDA 4HS3B 4PRHE 1H8NA 3EHBC 3T8XB 3FN0H 3LPGA 1N4XL 1JTPA 1MCFA 4CU6A 1ZHBB 3S36L 2NY5H 4X5WB 1ND0A 3LQZB 1K6QH 2DYPB 2W59A 1Q0XL 4PG9B 3L7FA 4IEFB 1PG7H 5DHYA 1IC1A 4NRXA 2EE6A 2CLRB 3SBWC 4JHWH 1HEZA 4PJAA 3QQNA 4ORGA 3GHBH 4TRPH 3K74B 1Y6NR 4UIKH 2QQNH 1ZANL 3TPUA 3RGVD 1NSNH 1DQML 3FB6B 5E2WL 2ARJA 4UINH 1A6UL 5GRVL 4YDLC 1A8JH 3DSFL 1GYAA 3QYCA 3N1PC 4M6OL 1QBAA 3TBTA 1T6VN 1RJZB 4Y2DD 5E6YA 2JTDA 3MOQA 2DQUL 1LO4L 3C5ZD 3IU4H 1JNNL 3LKSB 3QG6A 1R5IA 3TO4D 3UTTB 5I1HH 4Z95H 2ZUQC 2XA8L 4ZD3L 3VFPA 1AQDB 1SYSB 3BH9B 1S9WB 4XVJH 1FNFA 1M7DA 4XXDB 4ZOCA 4P57A 3QEQA 4HH9A 3PWLA 5KOMC 3F7RA 1V3JA 1ORQB 4PYHA 1Z0NA 4F37F 2DL9A 2R56H 2W0PA 5ERWA 3LEVL 5CS7A 3MRNA 5C0AB 3SKNA 3GM8A 1U95B 2QADC 2QBWA 3SEPA 5JDJA 4M7KH 3MRFB 4NQDB 1XF5B 1OGTA 1IAKA 4M48H 4U7KA 1FZKB 3VFMB 4D2NA 1VFUA 4NNPL 4R3SA 5I1CH 4NN6B 1BBJA 5EU3B 1R0AH 2KPNA 4C56A 2EYRB 3QCTH 2J88H 1Y0LA 3R4DA 4PJ7A 1YEEH 5DHXB 1HHHA 4YXKL 4LNVA 3MCLL 1CL7I 3FT4B 2NY2D 2EXWD 2HVJA 2ID5A 5F7LB 3FFCB 1JL8A 4JY5H 4Z7UA 1XF1A 1G7QB 4YHMH 5B8CC 4JKPL 1SYVB 3MXWL 2B1HH 1KCVL 1D5ZA 1YY8B 4HGKC 4F57H 1A7PL 1WEJH 1AO7D 3MV7B 4WI7A 1RZFH 2HJFB 2VLME 4L8DB 4UUJA 3ALPA 4K71C 4CVZA 5E8DH 2J4WL 3QIWA 3ARBB 5SWSE 1YMMB 2V9TA 4AENB 4X9IA 3IU3A 3D69B 1URLA 3ZYJA 4G42A 4K8RH 3QDAA 4GG6A 1XIWD 4OZFH 4EI5A 4LKXB 1D6EB 3O8XC 4TNVK 4NCC2 4WNQA 4XI5C 1MHHA 3BPLC 2ZUQB 3G9AB 4XH2B 4Y4FD 5D9SA 5EBGA 1F4XL 1NBQA 2EO9A 3K4AA 4J1UA 3IDJB 3LKNA 5EOTA 1I8MB 5C8JB 3THMH 5T3ZD 3G5VA 5EWIH 4L3AA 1T80A 5IJKA 1ES0B 3L5XH 4IOIB 3A6CH 3LRHA 5C0FA 3BKCL 3L3GA 1XR9B 1MF2H 2XPGA 5EPMA 3DSNA 3TBSA 2H32B 2NZ9D 1NGWB 3O4LA 3QB7C 1A21A 4L4VB 5AAMA 4GKNB 3FJTA 2GJZB 3AMKA 2NNAA 4J7RA 1CZ8H 4OZFA 5BO1H 4JY6A 2ZUTA 4ONFH 4WWID 4PGBB 2HN7A 3SJVD 3RWFA 4M43L 4Q7DA 4E0RB 2JK5A 3E6FA 1IAII 2AV7A 2YWZA 3LZFL 4EXPX 5DURB 3S98A 1TETL 3ZDXF 1FO0H 3RVUD 2DBJA 3VMNA 1J1XH 5DYOB 4IMKA 3P4NB 1HK6A 1UKSA 4FHBD 3UP1A 1G1YA 4UMGA 3DX7B 4LBEA 1O0VA 3BDYH 5B8CB 4LVEA 4NNXA 2AW2A 2EEBA 4QHKI 1EJ6A 2C4FU 2Q87A 5F6HJ 4HWZB 3DURA 4MHHI 4X6DA 1PLGL 3M8OL 3V5DA 1DJSA 4K71B 3QWRD 5JXEC 3ZTNH 1A6ZB 3OX8B 1L9MA 1AKJB 2WM0A 5FYKH 4G6AD 4JDVA 4ZUSA 5BVPH 4JO1L 4F3FB 2O5XL 3C9NA 1ZGLP 1B88A 1BAFH 1KELH 2NXZD 4J3VA 5L88L 2MPAH 4PJ5E 1F3DH 4U1KB 3O8XB 2AXHA 3JTSA 5I8CB 3JV6A 1ZT4B 3V5HA 1FO0A 1WWBX 4QRQB 4JB9L 1IGIL 4XBGB 3BPLB 5FUZL 2Z4QA 4LSQL 1IKFL 1VPOH 2AI0L 3AMLA 3Q3GA 4LRNH 1KPRB 1ZHKA 4YEFA 1JGUL 4UAOC 4L3ED 2HTLD 1JF6A 5DMIL 3HPLA 1MCIA 3BD4A 1MWAB 1A7OL 2GT9A 1T03L 5DJAA 3DVFA 5F7EH 3SJVB 2AJUL 3QXVA 1X5IA 5E8NA 2DMCA 1UXSA 3NIFF 4WHYG 4E41D 4BFEA 1NDMB 1Q1JL 4PRIB 3IFPB 1XGUA 4JPIB 1QBLL 5KVEH 2OR9H 3TNNA 4Y5XB 5DMJB 5FGBC 5ESVA 3DVGB 1LD9B 4FG6C 4XBEH 3LKRA 5GGVL 5DEGB 3FAWA 1UJ3A 3P11L 2RAMA 4CMHB 1HXMB 35C8H 2HT4C 4X80H 1REIA 2YD5A 3RUGF 3V6OA 1KN2L 3QRFM 3C8KA 2QHRL 5HHPA 5BJTB 3I6KB 4O51A 2FD6L 1NUDA 2FATH 2L7JA 4L1DA 4O2CA 2AK4D 1BZQK 1FE8H 1ZLWH 2IAMA 5IT2L 1NFDB 3WLBB 4LFHG 4LPXA 4PJIB 3TH3T 4BH8A 3RKDD 3U0WL 3QDGD 4OKDA 3VD3A 4YIQB 1HSAB 4KK9C 3E1F1 2RGSA 4QXTB 1PFCA 1BEYL 3QWOB 4L4JA 1G7IB 1IFHH 3QI9C 2GSIB 3FB5A 5HDLA 2I26N 1CFNB 1JRHI 4LARL 3MLYL 2XI9A 1SEQH 2BVQB 3SE3A 5HY9B 4ZS7L 1MQKH 1FNAA 2OJZL 4UQ2B 4M7ZB 1CFBA 5D7JA 2X4SB 1WC7B 1S3KH 1DLFH 4WHDA 3PJSB 4JLRB 1Y18B 3TJEL 1XGTA 4UAOB 4NZJA 1KEMH 5IVXF 3PWJB 5D7LB 4XNQA 3K1KC 4M1CC 2XICA 5JA9A 4GUPA 5JLZB 4F2MB 1TCRB 4TSAL 3AS0A 5FM4A 3GHEH 2V5RA 2XRAL 5GJTL 1D6VH 1T3FA 3EDFA 4Y16A 1F6LL 1UWXK 2PCPA 5AUMB 1AR1C 4GW4B 2YD1A 1UA6L 1A6WL 1Q9OB 2VC2H 2JJWA 1C8PA 4HS3A 3ZDZF 3T8XA 4PRNA 1NMBL 2VDMH 2B0SL 4NRYB 3GMNB 5KTEL 3CSYB 4LVOC 4X5WA 2E27H 3LQZA 4G6ML 4KY1H 3P4LA 2DYPA 3C60D 4NQED 1UH3A 3NCJH 4N9GB 3ROLB 2QSTA 4MAUH 4NIKB 2LFGA 4FQ1L 3VI4F 5I1JH 3B83A 2CLRA 4NFDA 4HFUL 4ISVB 5CILH 1WF5A 4RMRA 5ELIA 4ZFOB 3RWHB 4G3YH 3I84A 3FB6A 1U8JB 2Q7YB 4PIRF 4APQC 1MFAL 1LDPH 4MD5B 1CICC 4HDIB 5D5MA 5HPOA 1JZ7A 4OF5A 2VERN 1SJEB 1RJZA 4L5FL 4NZTL 1I3VA 2EZ0C 5J12C 3QI9B 4FOMA 5DT1H 4R96A 2M2DA 4UBDC 1VGKB 4WHYH 3UTTA 3QUYD 3ARZA 1NCDL 2UYLA 3BH9A 3B8SA 4L8BA 3I2CL 3INUL 7FABL 5J3HC 2YA1A 5DK3A 1ROWA 4P5TB 3WS3B 4EDWH 1ORQA 2W07A 1J0KA 1FL6B 4TUOB 3S96A 1F6AA 3VFSB 3LAFA 1AXTH 4KJWC 1SM3L 5CUSL 5C0AA 1AY1H 4Z7NF 1RZGB 3NGBC 1U8LB 5KSAC 3CLEH 2FL5B 5DVMA 3MXVL 1NL0H 3H42H 4V1DD 3TBWB 3MRFA 4NQDA 2Y25A 3T3PE 1FZKA 4LPTA 1TZIA 1T83A 1S9XA 3VFMA 2R0ZL 5CGYC 2MKWA 1H3WM 4HMDA 1S8DA 3QUKB 3HMXH 3MV01 1RMFL 4YWGL 1EEYB 1Z0MA 5EU3A 3QCVL 4YBQC 1QRNE 2ATKA 4KGJA 2EYRA 4LL9A 2VE6B 3P9LB 5D6CB 5DD1L 4MS8C 4NQXB 5F7HA 4Z18A 5SX5K 3ULVC 1VKXB 4LVOB 2BOCA 4BM7A 1CFQB 4ODTH 5E2VH 3MJ7B 4D9RD 1U8PA 5D93C 3BI9X 4QRUB 4P4RA 2WWMC 3A0OA 1JI1A 1G7QA 3WHE0 1WSST 4PJEB 1PX3A 1T1XB 1T0PB 1YY8A 4JN2A 1XH3B 3SBWA 4OLWL 12E8L 3DMMD 4MSWB 2VQ1A 5GS2H 3QULA 1CBVL 4L8DA 4O9HL 4TUKL 2Q76B 2H32H 1M71B 2GJ6D 5DD0L 1CD1A 4AENA 5ACLA 1A3QA 2ESVE 3GIVA 4APQB 4XZUA 4LQ1A 5IIEA 1CICB 5JW5B 5JHDA 1KBGL 4JREC 2OJEB 1Z3GH 3UYOD 4C54A 4JHZA 4HGWA 3OJ2C 3NAAL 3F62A 4Y1AB 4LKXA 1D6EA 1C5BL 2BNRB 1CFVL 1QLEH 4ODXA 2VLRA 1FQ9C 4JN1H 3ORJA 2C3XA 1MREL 4XH2A 1YYLH 5EORH 2F19L 1G9NC 3MOBH 1I8MA 3N1GC 4QRPA 1SMAA 3BAEH 5J56B 3MOAH 4XMKH 3RY5A 1NCTA 4IOIA 3NGBB 5HYJA 5KSAB 5HHXL 2IALB 4NJ9L 5E08H 3X3FL 4N5UA 2H32A 1NGWA 4XWOC 4G5ZL 4D8PB 1RZ7L 3HC4L 2GJZA 5DQJB 3QNZB 3V9FA 3GNMH 4KTYA 1IC7H 4HMCA 4PGBA 4ONHA 4UDUB 5E99L 4E0RA 3BKJH 4HWBH 4NWUL 4LCIL 1FL5B 5FM5O 1FNEA 2A2QT 3BKYL 1MJJB 4KMTL 1RK1B 5DYOA 2AJYL 2VH5H 3P4NA 5FUOL 3QEGH 2UY7A 3DX7A