3MMZA

Crystal structure of putative had family hydrolase from streptomyces avermitilis ma-4680
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
163
structure length
163
Chain Sequence
b'SLGALPTAEDIDAVVLDFDGTQTDDRVLIDSDGREFVSVHRGDGLGIAALRKSGLTMLILSTEQNPVVAARARKLKIPVLHGIDRKDLALKQWCEEQGIAPERVLYVGNDVNDLPCFALVGWPVAVASAHDVVRGAARAVTTVPGGDGAIREIASWILGPSLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative HAD family hydrolase
molecule tags Hydrolase
source organism Streptomyces avermitilis
publication title Structural basis for the divergence of substrate specificity and biological function within HAD phosphatases in lipopolysaccharide and sialic acid biosynthesis.
pubmed doi rcsb
total genus 50
structure length 163
sequence length 163
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3mmzA00
1ZD2P 2JAOA 4I9FA 5AW0A 1XVIA 1WR8A 3DAOA 3EF0A 3OCZA 4C4TA 2FDRA 4DW8A 1N9KA 2W11A 3QGMA 1Z4JA 1Z4QA 3U7HB 5AKZA 2CN1A 2YMMA 1FEZA 2YBDA 2BDUA 2CFRA 2I33A 2ZBGA 4RESA 3WKBA 3SKYA 3OCVA 3ET4A 4GIBA 4L6AA 3ZVNA 1U2TA 5AIAA 3GYGA 5ALKA 2ZG6A 1J8DA 1RMTA 2FPXA 3E8MA 5AK6A 4BX2A 5AKHA 3SF0A 4XQ0A 3ED5A 2HOQA 2IOFA 5AKEA 5AKIA 3QUBA 1YS9A 4KX5A 5ALMA 4NFLA 4XPZA 4YIKA 4UASA 4BNDA 3PDWA 5AKGA 5A3QA 5ALRA 3QYPA 2AH5A 4HAIA 4F72A 3OCYA 4KNVA 2P69A 2D2VA 2VKQA 1U7PA 3DDHA 4OFZA 1L8LA 3NANA 3WK5A 4O8CA 4ZEXA 2OYCA 5AVYA 5ALOA 4AP9A 5AVUA 2HHLA 1K1EA 5AW5A 4AS2A 1QQ5A 2GMWA 2I54A 2R8XA 2AGVA 3I6BA 4NWIA 1Z5UA 5ALNA 3MC1A 1X42A 3ESQA 3ZVMA 2C8KA 3ZX4A 1ZOLA 3AR2A 1RPZA 1RLMA 3M9LA 5AHXA 2EAUA 4BKMA 4Y2PA 5AI5A 3ZWDA 1U7OA 2MSNA 2WF8A 2R8ZA 2ZBDA 1N8NA 3UMCA 1L7NA 3M1YA 1WVIA 3K1ZA 2BY4A 4BX3A 1KYTA 3I76A 3ET5A 3NIWA 4HGPA 2R8YA 1RMYA 5AK5A 1T5TA 3BA6A 3KOOA 2OA0A 3RF6A 1TJ5A 1TE2A 5ALTA 4B6JA 5ALFA 3WK4A 4BEWA 4XOUA 1RKUA 3OCUA 3NRJA 3DNPA 3OPXA 4UATA 2MU1A 4OD0A 3FPBA 1F5SA 4ZEWA 4UMEA 3IJ5A 3OCXA 2ODAA 2NO5A 3ZVLA 2P9JA 1RDFA 4CNQA 1RKVA 4Y2QA 3WK7A 1TJ4A 2RB5A 2IA5A 3OCWA 4KNWA 1O08A 3WKDA 3A3YA 4MWOA 5A3RA 1L6RA 3E58A 3L8EA 5AW9A 2ZOSA 5ALLA 1TJ3A 3HLTA 2GHTA 4FE3A 3KBBA 1Z4LA 2IOFK 3R4CA 1RRCA 5ALGA 4NV0A 5AI6A 1RQNA 3UMBA 4NABA 3P96A 5ALJA 1NF2A 4BEVA 3AR5A 4F71A 4L6CA 3ESRA 1SWWA 2I55A 3W5CA 4YCMA 2HDOA 3QUQA 5FP0A 2FEAA 3TLMA 5AVQA 3WGUA 1SU4A 1CQZA 4Y2RA 1NNLA 2WM8A 1AQ6A 2FUEA 3U7EB 2FUCA 4UM7A 2C9MA 5ALWA 2B0CA 2DQSA 4E88A 2ZXEA 3IRUA 4EENA 2W4MA 4UMFA 2PQ0A 4BYGA 3PGLA 2G08A 3KD3A 3AR4A 1ZJJA 4OCZA 4HGRA 3R9KA 3FZQA 5AW1A 2B82A 3L0CA 4Y3UA 2EARA 4J03A 3QNMA 2O9JA 2ZBFA 2G09A 1XP5A 4DCCA 5AW7A 2WF5A 5ALSA 3EPRA 2FPWA 3ZI4A 1L7MA 2FI1A 4EELA 4JB3A 5JJBA 2YMQA 5T41A 2C88A 3QU7A 2CFTA 4UU1A 3WKAA 2HF7A 1T9ZA 4Y2JA 2QYHA 4EZEA 3PGVA 1RLOA 3FVVA 3ZU6A 4IG4A 4BBJA 3ZTWA 4ZEVA 2JAUA 3QX7A 3ZUPA 3W5BA 4HGNA 5ALHA 4J2TA 1PW5A 4HGOA 3ZW7A 5ALEA 5ALYA 2I6XA 3RFUA 3CZ4A 2Q5EA 1Z5GA 5IT4A 2HEGA 2B8JA 3D6JA 1L8OA 2Q4RA 3N07A 3WKEA 3S6JA 3SD7A 3U26A 3ZX5A 2HI0A 4Y2YA 5ALUA 2GFHA 5AM2A 4Y2SA 3QU9A 3NASA 4I9GA 1ZRNA 5AI9A 2HX1A 1LTQA 1VFPA 4XE5A 2HO4A 3AR8A 5AICA 3J7TA 2Q4TA 4UAUA 1VJ5A 2ZBEA 2OM6A 2YMLA 5AI4A 1ZRMA 5ALQA 1YDFA 4EX6A 5AKLA 4KX3A 1WPGA 4IFTA 3KZXA 3L8HA 4Y2VA 2CFSA 4MUMA 5AVVA 1YJ5A 3B8EA 3HYCA 1VJRA 1S8OA 4DFDA 2FPUA 5ALVA 3ZWKA 4Y2XA 5AVZA 4UARA 4CF3A 2JARA 1RMQA 2GHQA 5AVTA 1NRWA 1Z4KA 4EEKA 2W43A 1Z4PX 3U19A 1Z4IA 1RLTA 4CF5A 4L57A 2IYEA 1Z4NA 4C4RA 2G80A 4CE6A 1QYIA 4QQFA 4FFDA 4AS3A 3L8FA 4FYPA 3L0YA 5AKJA 2I7DA 2WF9A 3N1UA 2B1RA 3CNHA 5AVWA 2YMPA 4Y2TA 3QU2A 3SHQA 1TA0A 3WGVA 2YY6A 2AUTA 3I28A 5ALDA 5AVXA 1LVHA 3MMZA 2WF6A 4NAVA 3B9RA 3KDPA 3IB6A 3E81A 1S2OA 4BX0A 3A1EA 3L7YA 3N8GA 3L0BA 5AM1A 3SMVA 3BWVA 2FPRA 2JGAA 2RARA 2HSZA 4QJBA 4YGYA 2P11A 5AM4A 4H1WA 2RAVA 1T5SA 4UAVA 2G07A 2YFYA 3E84A 1ZS9A 1YNSA 2PKEA 5ALXA 2YJ3A 5AKKA 5AKYA 2YJ6A 3ONNA 3I1YA 2P27A 2YJ4A 1CR6A 3FPSA 3W5DA 2WF7A 4GXTA 2C4NA 1YMQA 1L7OA 3N28A 2IOHA 4DWOA 1L7PA 3U7GA 1Y8AA 1Z88A 4HYTA 2WHEA 3KC2A 3MPOA 3UMGA 2O2XA 5AESA 4UMVA 4UU0A 5ALPA 3W5AA 1RKQA 3L1UA 1O03A 2QLTA 5AVRA 2G1AA 3U7FB 2B30A 3L8GA 2EATA 4UW9A 3FGOA 3EWIA 3N5KA 5A3SA 5AW6A 1EK1A 5AM5A 1J97A 3AR9A 5AKXA 1RC8A 3SKXA 3UM9A 1SWVA 5ALZA 4G9BA 3AR6A 2PR7A 3MN1A 3WK6A 4BNDB 1QQ6A 4KN8A 4JDPA 1ZD4A 1YV9A 4UM5A 5IS2A 2C8LA 5AW3A 2YN4A 2BDEA 1ZD3A 3F9RA 3VAYA 3A1CA 3WKCA 5AI0A 3QLEA 4PNHA 5AK4A 1QQ7A 1XPJA 2AMYA 5ALIA 2WFAA 1MH9A 1Q91A 3FM9A 3PCTA 2X4DA 4YH1A 3QU4A 3SLRA 4OHFA 2R8EA 3QU5A 4EX7A 1U02A 2OBBA 2G06A 5E0OA 3QXGA 5AI8A 2NO4A 3NAMA 4HGQA 3QUCA 2HF2A 5AW4A 1JUDA 3QUTA 3AR7A 3U13A 5AM3A 1IWOA 1WZCA 1U2SA 1ZD5A 5AVSA 1Z4MA 3AR3A 3NALA 3L1VA 3NUQA 4KYTA 2FPSA 2YJ5A 4G63A 2JAWA 3ZTYA 3EF1A 3L5KA 4RETA 3WK9A 1QH9A 5AIBA 5AM0A 1RQLA 2B8EA 5AW8A 2I34A 3A1DA 3B9BA 4UMDA 3WK8A 1Z4OA 2B1QA 2G0AA 2GO7A 3DV9A 4Y2UA 3R09A 4YIHA 2RBKA 3OTQA 4YCNA 5IT0A 1EK2A 5AK3A 5AW2A 2HCFA 4YCLA 2NYVA 1Q92A 4CF4A 4C4SA
chains in the Genus database with same CATH superfamily
4ZPJA 5EE0A 1IBLB 2O8EA 3RM3A 2R1TA 3A0UA 2NU8B 3KKPA 4WUVA 2W11A 3LTNC 5K9ZA 1H2HA 1MENA 3QGMA 3VR1A 3ZE6A 3AUAA 1Z4QA 4D8XA 3W5HA 1AS2A 5AXDA 2G70A 4YY3B 3CBGA 4HNAB 1Z26A 2Z1MA 1CNFA 4O08A 1HOXA 1A4XA 1O5OA 2ZWAA 1XLUA 2KPOA 3D3NA 3GFBA 4JNKA 3TEMA 3WE7A 1CQWA 1L1RA 4LC9A 3CXUA 3SIXA 4F4UA 4F84A 3BGWA 1GGJA 3AVTA 1M2VB 1TKBA 3TNFA 3EPJA 3KG2A 3ET4A 1XZKA 2BW0A 4G23A 4V1CI 2RH5A 1FJ2A 1N0VC 1T4GA 1Y5RA 3BEDA 5GINE 4DB4A 2ZG6A 1EAYA 4FE4A 4RIGA 5AK6A 1WQ4A 1YJQA 3RARA 1Z8HA 3DXZA 1ECGA 1OGIA 2PGOA 2IOFA 2XUGA 3N58A 4NCIA 5F9HA 4RVUA 1C1DA 1DCFA 4MKHA 3COWA 1G2IA 5LOVB 4BLSA 4GT1A 1JJ7A 2BJWA 4O29A 5H02A 5JC1A 3LIIA 1WRBA 1QLJA 2QTVA 3PDHA 5INTA 5KUTA 3RFFA 2H1LA 1F4PA 1O5IA 2IXAA 5CD1A 1OBOA 5FJIA 5DXJA 3SZMA 2A1UB 4F9EA 5IPFA 5HE9A 3ZR4B 2PEYA 3OWOA 2V98A 4OL9A 3FPAA 1E4EA 3JD1A 3VO2A 4BKOA 2HL6A 4NZYA 4G37A 3ROQA 2ECKA 3EIOA 2C4UA 2RAPA 2HA5A 3CEHA 3K96A 3A32A 4OFZA 1NXWA 1V16A 3NANA 4LECA 4M1OA 4KREA 3E8SA 1EFPA 1QZUA 3BH7A 3D3JA 4ZI7F 1J33A 4S1OA 4XDGA 2C2ZA 1XRLA 1G19A 3E53A 3HC7A 1VKHA 1T35A 4HRYA 1KEPA 2GEJA 2D4AA 2I54A 1QGED 2PJUA 2R7AA 1F8GA 1I4DD 1NY5A 3EIFA 3V4LA 3G2QA 1X42A 3PWZA 3TLJA 3D2LA 4Z9YA 1HYQA 1O9GA 2WHYA 1OAOC 2R6DA 3HB7A 1P60A 3M5DA 3PVZA 3U3OA 3RSOA 3KUUA 1SEPA 2C54A 1H6DA 4HL6A 2YJNA 2VUTA 3ENVA 3HJBA 4YJFB 5AHXA 1UEJA 2EAUA 4EVIA 3KAPA 1EBUA 1QGUB 3CWQA 4GBJA 1BE0A 2XB4A 1BA3A 1M2FA 3L8CA 5AK0A 3SEFA 1BA2A 2FMXA 2QROA 2XYHA 2FX2A 4MJ3A 1JYFA 4YDHB 3TQTA 4MPJA 3UGTA 4M1WA 2IJGX 1ZGGA 2FQXA 4PC3A 3U7IA 4JX9A 1UDBA 2AX3A 4CMGA 1ADCA 4BASA 5G4KB 5AVJA 1C3XA 4XIIA 2O2ZA 2A14A 5JECA 3ETHA 1P4AA 4XFKA 3OFSA 3NIWA 3A6HA 3D0QA 3C8UA 4M36A 2NV0A 4ZVPA 3L1JA 5ES4B 3HJRA 4JSRA 5H3CA 1GNLA 1RXVA 1KIAA 2VDJA 2FJUA 2XRZA 1NP7A 3ZQKA 3LNCA 1E99A 4Z1MD 2WD7B 2Y71A 3VV2A 1JILA 1US8B 4O63O 5CVVA 2M6RA 2PK3A 4RKYA 5LZ2A 2D6FA 2BMVA 3C3AA 4B4KA 3WYNA 3TZLA 3L8MA 4TSKA 1K86A 2PQ6A 2PWYA 3A6JA 4C30A 3WMWA 1Z18A 1LBQA 2HJWA 4LNAA 1TUBA 1ZSYA 2TECE 1F7UA 4I1YA 3H5RA 3U1BA 2H1CA 4LCJA 5KMGB 1S8FA 5LUAA 4LVUA 3WSWA 1ORDA 1PLLA 1IRIA 2QPLA 2VPYA 1NTRA 1ZC3A 4EABA 1OH8A 1CHDA 4HX2A 3T1NA 1O6BA 4TYPA 2OAP1 3QVKA 3SYRA 1Q0RA 3NDPA 2YWBA 2MSLA 3AVXA 4QELA 1GR0A 2AQ8A 1IQPA 5A2QA 4EL0A 3MOGA 3O4FA 3PYMA 2VDNB 3KR1A 2OYRA 4HQ0A 3MMXA 4WNAB 3GO4A 3N8IA 1JFSA 4G4IA 2M9MA 1CUGA 4J29A 3SSMA 3BSSA 4TZKA 1YONA 3STUA 2ERCA 2BSAA 3TKAA 4CM3A 3ROPA 4RGBA 4U2EA 2GARA 3IGFA 4JN6B 3CLSC 4KUGA 3O4VA 1QE3A 1QYDA 4DREA 1Q1ZA 2VZLA 1X7XB 3QLUA 2PZBA 4L6CA 5LLTA 3SR3A 3EFOA 1P4GA 1YB4A 3KZOA 5EKDA 2CUNA 2NNWB 1VKRA 3AX6A 3LL7A 4RFSA 5DN6A 2HDOA 3PDIB 4IKOA 5LXTB 2PCJA 3BL5A 1ICEA 1D8AA 1TZJA 4RH3A 3GR6A 5CA1F 1NDQA 5AVQA 3WGUA 2H07A 4R7ZA 4KYVA 1NVKA 1UWLA 2EJCA 2R11A 3CRZA 1J21A 3U7EB 1A8QA 1Y82A 1OJ7A 1ZHHA 2G76A 3T7IA 5BUQA 3HACA 1BN6A 3LYUA 3F6SA 2AMJA 1KVRA 1TQHA 2QZ4A 5DTIA 1TZCA 1SCAA 2SKEA 3VPHA 1UKBA 2OZLA 2A1IA 3B3GA 5DRYA 3ZDFA 1EFRA 2E82A 5BP7A 1AU9A 3RIGA 5K3BA 4PZCA 1EEXB 1PUXA 3H16A 1UC9A 3B5JA 4C7OA 1FFYA 2H4FA 5JS1A 3GX1A 3PE4A 4IS2A 3A9WA 5AW1A 1IUOA 3WNCA 3OESA 4DLBA 3K8ZA 4UHHA 5LYJA 1PIWA 2J3JA 2Z2IA 3LCCA 2NU9B 1YK0A 3GF4A 3OHMA 4LAFA 4QT4A 1EA7A 3PQFA 1MOPA 4NMHA 1MB9A 4CR8A 2WP0A 1ANKA 2PD3A 5LB2A 1KYWA 1R8QA 2DC1A 3UMRA 4F45A 4HUQA 3SQWA 5KB3A 1TYDE 2I6GA 3N8NA 3EPRA 3LYAA 4DCOA 1Z0DA 2QJOA 4Q1BA 1ZBQA 1HRDA 1KI8A 1XEWX 2OHOA 2OR3A 2UZAA 5EZYB 3EGDA 2QM3A 3RO7A 1KRWA 1EDOA 3MGBA 2JLSA 1GU0A 2RHJA 2I4OA 3H05A 3OOEA 2DEUA 5CDFA 3FF4A 3VU0A 1A2QA 1OF1A 1MO3A 1G5HA 3DMHA 3WLRA 5EIHA 3ZDRA 1H22A 3OZCA 1YB2A 1N6HA 2XNDD 3BWBA 3DMDA 3CINA 3FVVA 4CCWA 4NU0A 1PL7A 2H18A 2ZZKA 3WYCA 3ZVKA 1BX1A 4LUCA 4MW6A 4R1SA 3ML1A 4XR4A 3GLFA 4N03A 1P5ZB 4O2BB 5JI2E 3Q72A 4QBGB 1K97A 2FFQA 2Q4DA 2V59A 3PC3A 2GAIA 2CE2X 2HA2A 2INGX 5DM60 2OB1A 2X7XA 4BWGA 2F8SA 1ZSVA 2X41A 4YCAA 4X1KA 4ZI5A 2XR1A 2ORYA 2O5RA 3NOQA 2L69A 3DYBA 1MJ5A 1QHGA 2BMAA 2K5UA 5GV8A 1CT9A 1SU6A 1Y8RB 3A9TA 3FPCA 3RFTA 4C4OA 1R8SA 4O4JA 3B2EA 1M1UA 1QFZA 2JB9A 2PWZA 3FPJA 5GZ3A 3G2OA 3SNHA 2QRZA 2ZQYA 5JD4A 4C4AA 2OY0A 1IMJA 1CVIA 1N6PA 2J5RA 2N1MA 4MUJA 1EWQA 4FD2A 4ZP1A 4K03A 1I33A 1XCJA 3JYLA 1Z3IX 2HZBA 1BDMA 2ZRDA 5AM2A 3LCJA 5FWXB 4HLNA 1DVRA 1JDPA 4GKVA 4HH1A 4BCDA 1N78A 1Q3KA 2BI4A 4I9GA 4CUZA 5K0SA 5JQGB 5DU2A 1P4SA 4N7RA 3OLQA 3M6MD 1IHOA 1GUAA 2PVCA 3C8DA 3F67A 1WP4A 4RFLA 1I0ZA 4U9HS 1LTQA 4NNPA 4DYHA 1C2TA 3M4NA 4R1MA 4BQOA 4EJMA 3K70D 4R1PA 2FW8A 5EQFA 3PE6A 4P31A 1APBA 1U5BB 2YV1A 1OAAA 2ZBEA 1HFWA 3H17A 3PITA 4F6RA 5KYKA 2NV6A 1B0PA 4BBZA 1XCOA 1MO6A 2C7RA 1P7WA 1C7ZA 1T8SA 4N6OA 5AI4A 2DLNA 2FKNA 2OD9A 2WUDA 1A9SA 1U80A 3GD5A 2RB4A 3FGPA 3KHTA 4JHXA 3VX3A 3L6OO 4PANA 1Z0SA 1V5EA 2XHZA 1QJ4A 4R0VA 5T4EA 1KVTA 3RIHA 5LU8A 1CJCA 4EAAA 5TPWA 2ZSEA 5JO0A 1NQOA 1UZNA 2W6QA 3FNIA 1KI6A 4TWRA 3K70C 5KQMA 4ECAA 2BEVB 3RTCA 4JELA 2XCTB 3EVNA 3OSUA 4LWOA 3S8YA 2O06A 4W6ZA 2P2ZA 4J0FA 3NIDB 3WADA 4AVYA 4HGYA 2CK3D 3PFHA 4KUHA 4WJZA 4WLNA 3UGKA 5CXQA 1SHLA 3TAUA 2A67A 2O6HA 3FCEA 4XYGA 2O2IA 2FOIA 4L57A 1XPUA 1Z4NA 2A5LA 4GWLA 3V7WA 4YPOA 3ZCSA 5JBNA 4RPHA 1GPJA 5JMOA 4WBSA 1BDHA 1HZZC 1FNNA 2D3TA 4LYYA 1WP9A 4P5EA 2P5UA 3FFWA 2ZKIA 3T5BA 5B2EA 2YNMA 3PC8C 1JR3A 1Z5ZA 3ZV5A 4G0PA 1EUCB 2J4CA 3NOXA 3U1TA 3LC0A 1SK8A 2BHNA 4P3OA 1VG9B 2JHAA 4MVJE 1EIZA 4HTFB 4N9QA 1YA6A 2QAIA 4B43A 4XWYA 2QVGA 4LRUA 3RVQA 4TRMA 3F3KA 2RHOA 2E4UA 2VRCD 3QBEA 3DQQA 3VKHA 2H9IA 1IWBB 3FFAA 2BEUA 4G0VA 1U90A 3ZKAA 3U9TA 1UANA 5K3DA 5AM1A 1AUOA 4MYCA 2CJFA 2I4MA 4DIUA 2JCXA 2PS3A 4FDLA 2DH6A 5DNWA 4GNRA 3I72A 4J0HA 1G6HA 4AZSA 2J46A 3A7EA 1Q1BA 4OXRA 3PNVA 3LPCA 3THSA 2OP0A 3EXHC 2DUMA 4CI9A 5CG2A 5KOJA 2PX2A 2XT0A 4J1TC 1AO0A 3M6XA 2Q3FA 1G66A 4M21A 1I0IA 2V6IA 2ENUA 3V1TC 2FPOA 4MUBA 1T0JB 4ALNA 1RWWA 3IT0A 3VR4H 3JWGA 3KKLA 1JDTA 1EG2A 1Z6QA 5C53B 2AG1A 4ZOLA 1E1QA 1M8KA 2D0IA 3KUKA 3ZQ6A 2OILA 2P2YA 3K1YA 3OE7A 2EOAA 4QGSA 2PKQO 3AOGA 2QM8A 3KSZO 5E4FA 2A30A 2O50A 5SZIA 2I4RA 3E3AA 1CR6A 4DLZA 4PO3X 1U6IA 4RE5A 5LN1A 5CBPA 1FP2A 4AUKA 1QYXA 4L5BA 1LPSA 4P0TA 2AI3A 4J9UE 1RM3A 2QSYA 3B20A 4M98A 4GR5A 5ANRB 3ND6A 2H4ZA 4YHBA 3PWTA 2QSUA 3VNRA 3WLSA 1EFTA 1MEOA 1EP9A 3ME5A 4LNUA 4JGGA 2DB3A 1F2UB 2DQKA 3AV0B 1L5FA 1ZK2A 3D3WA 1X1CA 3GA5A 1XDDA 3P9KA 3TRDA 4BNYA 5KVAA 1DNPA 4TUYA 1UBHS 2WT4A 2UVQA 1H8ED 3P2EA 4EF6A 2WNHA 1GRVA 3UJAA 1ONSA 2CBXA 3H5WA 1DUIA 3ZLUA 4BZPA 4KFUA 2C9YA 5HQTA 1KKUA 4REQA 3WIEA 4RTRA 3EVZA 3AVQA 4GI5A 2X0DA 1U1IA 3OHSX 2ZSKA 4GM0A 1PD0A 4UVGA 5JPDA 1AQLA 1A4UA 3IHLA 1LLUA 1UOPA 3VYUB 2GD1O 5K8CA 5A3SA 5AW6A 3R8CA 1L7XA 2X0IA 4UUPA 3ZIAD 1G42A 2HK9A 1HLDA 1LQTA 4AJHA 1PS8A 4DQVA 3BTSA 2B2CA 1V4VA 2GTHA 3G8BA 1WQ1R 5P21A 3VZQA 4GOLD 3M1AA 4DA9A 3U62A 2CB9A 5KOJB 2AA3A 2VYVD 2OBLA 5BN5B 4BNDB 4C43A 3IUYA 5CG1A 1JMVA 1RYBA 2VSNA 1PFQA 3T4XA 3SX4A 2GRAA 1CF2O 2LKDA 2QW8A 3PX2A 4W99A 1KK3A 5AI0A 5EZYF 3RUPA 1VL2A 1CUJA 1YL6A 3BH0A 1ZN7A 1VMIA 2QIPA 5DWQA 3TOVA 5DV9A 5DBFA 5FB3A 2FPIB 4RJTA 4UAJA 3ZUGA 3MOSA 4LBVA 4BLQA 4EFNA 3NWJA 3LVBA 4RDHA 1B8OA 3GOHA 3K0HA 3LW8A 3QIAA 4XLLA 1U0HC 1CDDA 1U02A 2Q3LA 3N7AA 3JQPA 4L7QA 5KYUA 2OHXA 4TT8A 1CS0B 4A73A 4BFWA 4ZDJA 2RG7A 2XUFA 1ECFA 3NAMA 4HQKA 2PZKA 1OLSB 4OGKA 4OYYA 4CLXA 2Z6UA 3U16A 4GZ3A 4QPJC 3FWNA 1HL3A 2DXIA 3ESCA 5AUOB 4KCGA 1YB7A 1JBKA 3G9XA 3SE0A 5AVSA 3UQZA 3T5AA 1SCQA 2ZE5A 3HCWA 3U56A 4JJAA 3OEHA 4R83A 3NIGB 3G59A 4TL8A 4G63A 4N47A 1KSFX 3OBIA 1TO6A 5DGTA 3AKCA 2B83A 3L5KA 5CX1B 1TGYA 1V2GA 4ZCIA 3MRXA 1U5AA 3C74A 3HLYA 2R8PA 4HDNA 4IRUB 4WUTA 4YUXA 3GLIE 1LY1A 2FMFA 1OV4A 2H2DA 1G5IA 3HV0A 3IQFA 5BN4A 5CA1B 5D7BA 3MJDA 1V71A 4PAQA 3RVLA 1CETA 3RC1A 2GKSA 2QVLA 3SBOA 1YMUA 3UK1A 3WXBA 1N5DA 5SZHB 3R09A 1IL0A 4I4LA 1D6MA 4YRJA 4CTJA 2WMOB 3OPVA 5TPWB 1S9HA 3WTBA 3WWEA 1GT91 2NSJA 4N8SA 3OU7A 5CNJA 1T9DA 1HT0A 2CNDA 1HYBA 2WWIA 5F1YA 3VMMA 1E62A 3DLIA 4E3ZA 1TZMA 1KYZA 4ZJUA 2QWXA 3EQ9A 4GECA 2ZJ7A 4KE6A 5FLKA 4FSDA 1GTJ1 1KFEB 4KWIA 1JHVA 1SD5A 1YH3A 1YQQA 2ADMA 3BFJA 3EN0A 3NRCA 5TEWA 3K05A 3WGKA 3ZWBA 3RS8A 2AF3C 1U9CA 4L4UA 2Y0PA 3F97A 2JFOA 4MW0A 3FHJA 2GN0A 2IP1A 3CV3A 3IDZA 4CF7A 2NUBA 4MH0R 1IBSA 1I7LA 3HJNA 4I08A 3PR3A 4OQ4A 4Y9RA 5KQPA 4WKNA 7ADHA 1JG1A 2H54A 1T2NA 4AYTA 3MCAA 4BPRA 2N3ZA 3F6RA 1IC6A 1DAIA 4N0MA 2ZJ2A 4YRDA 3DE4X 4QJ3A 1ZNZA 1YT5A 2LZ0A 2O7NA 3GXBA 2NYUA 4C7KA 1IEWA 4KQFA 2FSFA 2KJQA 2GESA 4XWGA 3V3TA 4B9EA 4YCJA 3LUBA 4B6QA 3CUSA 5BWLA 4QREA 4X1KB 4J3FA 2RHLA 3KWJA 2YW9A 3P0RA 4E21A 1KNQA 1I6WA 2P69A 4QNRA 5B3LA 5BWMA 1U7PA 1QQTA 3DV2A 1P5HA 5B30A 1EQ2A 3EOBI 3CG0A 3KVNA 2E5WA 3CC8A 1XCPA 3QKIA 4V3BA 4KK4A 4O2BA 4B3SB 4Q4JA 2P0EA 2BV3A 1CJTC 4OOFA 4HD8A 3GGCA 1OLXB 2NV2B 5D87A 3PWKA 4AP9A 1XALA 4QULA 2B92A 5B3KA 2R9VA 2C5LA 2GA9A 2FSVA 3P71T 2D2XA 2YUIA 2AFIA 3QFHA 4X71A 5H82A 4QG3A 1PT8A 2WFMA 3PEUA 1SUWA 3GT3A 3KJNA 2JCBA 4LTDA 2PBZA 1YKSA 5FXMA 2RSLA 1AZTA 4TROA 3UA4A 3V33A 3MB5A 3UAVA 1FDOA 4WXPA 4EKDA 1L7QA 1UC4B 3NHUA 2GERA 5C5DA 3OJFA 4Q03A 4YAOA 2AVDA 3OIWA 2JA2A 4KXQA 2AUMA 1SC6A 1H5QA 1XTKA 2EKPA 1VGVA 2FRDA 2ZAMA 3CU5A 1EVYA 4H3HB 1O0SA 2IYVA 2GZ1A 3PNBA 1NJ5A 1XKXA 2GJ9A 1GV1A 4D4GA 1J5EB 4HYEA 4JOQA 1KYTA 5CAEA 4LZZA 3EMKA 2FAXA 3CLTC 3HYLA 3I76A 3OD5A 3PE3A 4HGPA 4PSKA 1MGPA 4ZAGA 2NU9A 4HMQA 3RVSA 4YRCA 2J0UA 1OWNA 3BA6A 4ZO4A 5KNCA 4C0XA 3HVIA 4E2XA 1TAGA 5IEJA 2HRCA 3PHBE 4IYRA 3DAYA 2X23A 1EGQA 1Z73A 1IN8A 1DJQA 3MAJA 1ZLXA 2VK8A 3MUNA 3QOFA 5ALTA 4B6JA 4C3ZA 3STWA 1B2LA 1T8WA 5JVDB 1S2LA 5KO2A 3ORYA 2VUHB 3FPBA 1I4WA 4FHFA 3WP0A 1PGPA 1FC0A 3RSHA 4D81A 3VR2D 2H0AA 4R16A 3UHOA 1RAEA 2O7QA 2Q5FA 4TMTA 3I92A 3IIIA 4XXHA 1IY8A 4X6XA 2ZJZA 5JXIA 1KI7A 5LWHA 2B5OA 2A1TR 1T9AA 3C87A 4II7A 1BNCA 3G8DA 3QEBZ 1E2GA 3QLVA 2ZUBA 4A8JC 4FLFA 4BRSA 2BEUB 3E58A 4YX9A 1GR1A 2VRWA 3GRYA 1JR3E 3WV4A 1RLIA 2Z8YM 1XQXA 3MELA 1PNVA 4YCBA 2GHTA 4FE3A 3U3DA 1D1TA 2HF8A 3FTEA 4L8FA 1AMUA 1MTOA 3N3BC 3RSGA 5A4JA 2AC4A 2C7GA 4AN1A 1RRCA 1ZMBA 1M34B 1UBFA 2QX7A 1G55A 1NBAA 3UMBA 1R50A 3TB4A 3DAHA 1BEZA 1ZGJA 1OYYA 1W48A 4F06A 4QODA 1XDSA 2OHFA 4JP2A 2ZVJA 3RU2A 4BEVA 3U5ZB 4POAA 4F71A 4TMYA 2QT9A 2SECE 1DG9A 1N92A 1U3CA 3BDIA 4WNAA 2PKXA 3D2CA 4JEHA 5ADUS 1QHEA 5H59A 2DKNA 1E1YA 2Y1LA 2CMHA 1RRMA 3Q2IA 4H16A 3R3HA 2VXYA 1RR6A 2Z3VA 2G9VA 2TMYA 2QTAA 4M38A 4I9UA 1YCGA 1SVLA 1OZFA 3VU3A 4D42A 1FYXA 5AUPB 3KQPA 1CF4A 3D6MA 2OXIA 4FFBA 4V0OA 2FUCA 4GVXA 3O8RA 2E6KA 2G0TA 1IZ8A 4TTJA 3KLPX 2GWHA 4LXUA 2QZZA 4O02B 4BNXA 3IAXA 1QO0D 1ZN8A 3ODGA 4HVTA 3JQAD 5EJEA 3U5TA 4BNZA 2JDIA 1A2BA 2W42A 1XMPA 2TSYB 4O5OA 3IAUA 3FVTA 5FYDA 2OV1A 1HK7A 1NYLA 1POWA 3HSKA 3PKZA 2F3SA 4DR6B 2H2WA 3O9VA 2C95A 3OT4A 4YJ3F 1QP8A 4BO0A 4N3BA 1UIRA 4I14A 4NV1A 5E95A 3OMWA 3TJMA 1CLEA 2EARA 5DMXA 4EB6B 1ISRA 2IE0A 4IIGA 5G53C 4DARA 1VJ0A 4KO1S 1ZXBA 3IMFA 4V3CA 3I9MA 3INRA 2BGKA 3DGEC 4U2BA 4P93A 5G4KA 4A10A 4CIBA 2WI8A 4NCNA 3IHTA 1O2DA 5AW7A 1LVUA 4EHNA 1DC3A 1JSLA 3UXYA 3T4UA 1H6BA 3VPBA 1DC8A 5JJBA 4MVJH 1E3DA 4JA2A 2L0XA 2GXSA 2YJZA 1S2IA 3O8DA 4CCAA 3C5WP 4XVRA 3RAFC 1VCNA 9LDTA 1L9KA 4PONA 1G8MA 4DIOA 1NQTA 2PL1A 4HDSA 1C8BA 1T0BA 4LCEA 2IS1A 5FULA 4YXWA 1IBKB 1AK9A 1SBCA 3PGVA 4QRHA 1X9HA 2WINI 2C4KA 1Z2OX 3DLBA 3SP1A 1U3DA 4P34A 2RGUA 4HNUA 2VYND 2EF1A 1NRXA 4GRDA 3HUEA 2IYZA 1SOMA 4M60A 4DQDA 1I2AA 2ZRNA 2GUGA 3C7AA 4KQJA 4DLTA 3MCTA 4L07A 4MEBA 1PO7A 1T9HA 4OHMA 1VYHA 2LGJA 1ZITA 2ODPA 2CZQA 3GBPA 1EK5A 1EAMA 1RZVA 3LY9A 4BFZA 1XXLA 3VZCA 3BCHA 2NN3C 3IJRA 1GPAA 2GEKA 3OEED 4L15A 4NBVA 1L2TA 2GXUA 1E0JA 1GKYA 3RFUA 3T3HA 4O4IF 2XOKD 1IUPA 3JQFC 4GRIA 3BWMA 2VA8A 5DEIA 3WYAA 1AA9A 3RQIA 5HRAA 3GEMA 1KI1A 5BR4A 2VJYA 4J4BA 3DEKA 3RFVA 1JWLA 3H6HA 3GGPA 3N07A 3GLIA 3BFKA 3NB0A 3GLGB 1FUUA 2EW1A 2N1BA 3SXUA 3SPXA 1I1OA 3AKEA 1C1DB 4P6VF 1FSZA 2JD2A 3WWCA 3AJ9A 1IAVA 3QU9A 3U4AA 1NFRA 3UPTA 1SCNE 1U1DA 4RSMA 1ZD1A 3OJXA 1P8JA 3GJYA 4YXFA 3ZW8A 2Q9CA 2AOTA 4IX9A 2AXPA 3GUZA 2HRZA 4L3WA 4AMUA 3VR5D 3DBRA 1VSUA 3EGDB 3GPLA 3EXAA 5LBUA 1JQAA 5IFKA 3AR8A 1II8A 3OLXA 2OFXA 4HZIA 1ODIA 3GBVA 4UBLA 4Y2GA 2DVMA 3IQDB 2HLHA 3R9IA 1SXGA 1UXJA 4PQRA 4FB4A 1JBQA 2ZIXB 3QQ5A 4HF7A 2FYTA 4JOSA 3G49A 3KJIA 1KBOA 4KE7A 2YS6A 5TV2A 1GRQA 2HD4A 2Z5GA 4OHKA 4B76A 1AURA 2QM7A 3UYKA 4DCTA 4KX3A 4URHA 4I2VA 3I2GA 1WPXA 2X58A 3EDCA 4JBWA 4YEDA 1I94B 1FSFA 1GSOA 2A2ZA 3CUKA 3TYXA 2G7MC 4FOPA 2BUAA 3CX3A 1XZBA 5KDLA 3OZ7A 2QPTA 1Y6QA 2IYUA 4CDNA 4RELA 1C50A 2YZKA 1M8GA 1XJWA 2JI6A 4G1BA 3WRWA 3H5VA 2Z5FA 2Y1GA 2GHQA 1V5FA 4MOWA 4O2AB 4UHCA 3DWIA 3Q9UA 1HSOA 1LPMA 4Q47A 5HMMA 5LZ5A 2VFAA 4HFRA 3DB1A 4JYMA 3EDQA 2CMDA 1UJ4A 4KFTA 1YA8A 5HF6A 3PLAE 1Q6YA 1PK8A 3MD9A 1NP3A 3T34A 5F9FA 3HYSA 4OFWA 3KR0A 4DOMA 4BWVA 4RW0A 4B0PA 1DKUA 1R0LA 1MABB 2WV7A 1C8VB 2FVYA 5C8YF 4FYPA 2B9VA 3NNDA 3IAS6 3O8OB 1VL5A 2VYQA 1C9NA 3JQFA 2C9ZA 1KY4A 1KIMA 4QOJA 4JLPA 1C41A 4I4TB 4DDUA 5AVWA 1WW8A 3M33A 4Y2TA 4W5WA 4C06A 1BYIA 2AOVA 2B98A 3P2IA 4AKHA 3WGVA 4Z4HA 5ALDA 3ZHYA 4K81B 4Q7MB 4E5UA 2C4WA 4PXSA 4MV1A 3UAGA 3RRJA 1KS2A 4KV7A 4GMFA 4J6EA 1PSZA 3ZY6A 3E9RA 2DBQA 4P8RA 1UBRS 2ZB2A 3P9CA 3PC2A 4L50A 3SJAA 2I2BA 3ISJA 4CGYA 5ADHA 2C96A 1XTBA 3A1EA 3N8GA 2A7XA 4YRSA 1E4OA 2FGJA 4CLHA 2PGLA 2JGAA 3QVWA 4KGXA 4LRWA 4AC9A 3N39C 5HILA 2RARA 4UVIA 4U39A 2O8BB 2ZU6A 2HSDA 3FWPA 4L4SA 3KXPA 5LR6A 4M87A 4HXGA 5KC8A 2JGDA 5FTNA 4UDOA 1GIAA 1ZS9A 4RXTA 4PZUA 5JTTA 1YNSA 1W52X 1K2WA 2H5JA 3MGCA 1MPXA 3D4IA 5TB5A 2QTLA 5IU6A 4O4JF 5FDFA 4X24A 1EBFA 2K2WA 2QNRA 2X42A 1ETUA 4PO1A 4E03A 5IKXA 3I1YA 4MP8A 3K9WA 2J9FB 1M6YA 1N2CB 2SKDA 4LOKA 1H1TA 4NRDA 3R0QA 4PYNA 3COSA 4M0EA 2VJNA 4GSKA 1P6QA 1Z08A 4PHCA 3QQPA 4C76A 1U2ZA 2RGNC 1QRUA 4WOPA 4L76A 5DNAA 2W2MA 2JGRA 3LUJA 4LZJA 1HFEL 5JYCA 1MZPA 4TMXA 4PFJA 2EP5A 4RIIA 4YLEA 2CDNA 3BWXA 1VHWA 3GC6A 4AG6A 1U5CA 1XEWY 1ZM3A 2AMFA 2R79A 5GJWC 1OIWA 2IT1A 4MVJG 3UMGA 4BB5A 4XIYA 4KSCA 1JFFB 4I55B 3NATA 4PQFA 3Q2OA 3B6IA 5IDYA 3EY4A 3R3UA 4KG7A 4X8OA 5HQJA 8LDHA 2G9RA 4G5QA 2CT8A 1F06A 3CLHA 4WOCA 1TQ4A 2WU4A 3E9NA 2MT9A 3O03A 1E6KA 4JKIA 3W0LB 4ND6A 5HNKA 1WPRA 1JIUA 4QYIA 1G9SA 4MKIA 4YAKA 5D3QA 1COZA 4DHEA 1RAIA 1UF9A 4C22A 2GZ3A 3QOWA 1PZEA 1X1BA 3FGOA 4I1UA 5I7EA 1BXGA 1UDAA 1SG6A 1TM5E 4JU9A 5F1PA 3H9CA 1JAHA 3O21A 3I2JA 2Y27A 1FP1D 5AKXA 4EG5A 3LAWA 1RC8A 3DCJA 3S2GA 2MOKA 2AJCA 3K2BA 2ZS7A 2ZSAA 2I7TA 4CNBA 3RAEC 3PC4A 2QMZA 4N5IX 1Y8QA 1ABFA 2WJAA 2IZ6A 5C80A 4GLFA 4DUPA 4UM5A 3GEEA 2MHCA 3A31A 3EZ9A 2EZ9A 3AP2A 1OC4A 2CDRA 3KLMX 1XPJA 1OLXA 5JFGA 1SA0A 3BK7A 2XGJA 3L05A 2I22A 3ANLA 3FM9A 1ULZA 2VZEA 3DWEX 4R2JA 2NVUB 2OBNA 2X0NA 1J42A 1A95A 3ZBQA 2P67A 2Q9UA 3M8KA 2C4TA 2R8EA 4EX7A 5KSYA 4F3RA 2C7VA 1EVKA 3CLUC 1RYDA 2JNWA 5ED0A 2AI1A 2G36A 1QF6A 4HWKA 1N3IA 3GLSA 4Q3BA 1LI5A 4ZT6A 5LIPA 4CFSA 5DM4A 1TM3E 4QYTA 1CDZA 4UBIA 4LHSA 5C4MA 4WKGA 4Q15A 2DLDA 3IDFA 3ZW9A 3WRXC 3TD6A 1JJVA 4PU0A 1GT6A 1Y7PA 2QVBA 3WNBA 6ABPA 3IPYA 1K3FA 2F8MA 1Q83A 1A72A 1XEAA 2A9FA 1XDGA 1DJNA 2YX1A 3KBOA 4YUAA 5CGQB 1A0OA 3FIJA 2VF5X 2XF2A 1H5UA 3GNTA 4PQGA 4NCHA 4S35A 4GQAA 4N49A 1PT6A 5T67A 5AM0A 3N7TA 1A82A 5KNDH 2PMFA 2FR8A 3SZOA 2HRQA 4FLMA 1G60A 1QBGA 1V7CA 1M2WA 1UMCA 2M1ZA 2RGGA 3QWHA 3G5LA 1T3GA 3EEYA 2XRYA 4K6KA 3BFVA 4ZT7A 1NGSA 4DLWA 3L0ZA 1IONA 1TQDA 1ZI9A 2AJDA 5C9ZA 4NULA 1WSAA 2RBKA 4CWAA 1TTTA 4KK3A 4QVKA 4V2IA 1KZHA 3ZLTA 1VJCA 1ICIA 4GM4A 3Q8LA 4JY7A 5LDGA 4ZOAA 1GZ3A 5BMVF 4E2ZA 2NP6A 3T99A 1LK7A 2PY6A 2X2FA 3BXXA 5EHXA 4RC9A 1K3TA 2ACVA 4V02A 3NEPX 1M8PA 1OGYA 3P7MA 3K6RA 3BXZA 3C16C 4A03A 1T8TA 3SFZA 1X3SA 2W6NA 5EIAA 3SDSA 4NE2A 1QIDA 4KPUB 5K4HA 1V3UA 2QAJA 4UPEA 1U0EA 1OREA 3N75A 3QY9A 4GP7A 4I9HA 4DZRA 1CHNA 2V45A 1P0FA 1Q3TA 1OLOA 2YMMA 3TR5A 2SNIE 3GRFA 3AGPA 3P20A 2UXBB 4DV5B 2B4TO 5E2AA 1VRVA 2I67A 1FJHA 3SKYA 5I45A 2C94A 1JQBA 4FOOA 1WHTB 3VYRB 1KJIA 1EUDA 1EWKA 2VDUE 3P0HA 4OJTA 4M1EA 1U2TA 2JBHA 3K72B 3E27A 3IVMA 3N8KA 1J8DA 4NU5A 4F3YA 4QT0A 4RVFA 4DL9A 1BJRE 3SF0A 4XQ0A 2QGNA 3F47A 1L5HB 3ED5A 4GH5A 4IO1A 4TSRA 2Q4OA 3HU1A 1GGFA 3ETGA 3QYAA 4LQ4A 4CMIA 4S05A 3M3DA 4LJKA 4A8PA 5ITSA 5F98A 1EYZA 1JYSA 1MB2A 4IGFA 1IZ7A 3URKA 3CE9A 3L2OB 1DC6A 2CL7X 2ZFUA 4IOMA 2NUPA 4F8JA 1JV2B 2HIGA 3F5QA 1HUQA 3L9WA 4N7JA 1L5HA 3UUWA 5H4GA 1E2FA 2W93A 2YHBA 5F5LA 4YIKA 1GUBA 3OICA 4Q6BA 2CW5A 4CCSA 1MV5A 3VAAA 5CT6A 3OC6A 4UNNA 3NBZC 3P4XA 5FL3A 1DTWA 1OMOA 4YMWA 3GG2A 4PBTA 3IESA 3T7KA 3TFQA 4FMCB 3OHPA 3VR5H 4CU5A 5B4VA 5J2TF 1U7HA 1P1KA 1FU8A 1S4QA 3G7UA 4GEKA 4H7IA 2D2VA 1OBFO 4TSFD 1E6WA 1XELA 2Q6TA 3LX5A 3ZCUA 1Z62A 2ZPTX 4LKRA 3A1FA 2OCAA 4PRZA 2ZIWB 1CUYA 3I4LA 4MCJA 1GAEO 3II6X 5BN1A 3BBPA 3I9FA 1C1XA 4M0CA 4BQEA 3NHWA 4D45A 2HJ9A 2QRQA 3I01M 3RNOA 2WJHA 2UU9B 1Y4DE 4HDMA 4X7RA 1T9CA 4WKCA 1N1EA 1H1DA 1TFRA 1KQ3A 3ESQA 4BN5A 1T3HA 1VYTA 1D2RA 3D64A 3PUXA 4BY9E 3KIPA 1E1RA 3HB5X 4H6WA 5IKEA 4LC1A 3JQ7B 5BR7A 1N2ZA 4JJEA 2C04A 4B32A 1PV4A 3OM8A 2FA9A 1RWNA 3DHWC 4J7AA 1XEXA 2DR0A 2VJMA 4ZQFA 3RVPA 4D25A 1YHYA 2JK1A 2VAPA 3K9HA 3LX4A 3CA8A 2DPXA 3E5HA 2CHQA 3L02A 3P97A 4W9MC 1U0OC 1M6NA 1RQ7A 3OJOA 1AKRA 2HDHA 2XZPA 2BTQA 2V54A 3T38A 4C03A 3BGOS 1NA5A 4JWTA 2QUKA 1W30A 2AZDA 1ZQ1A 4PYOA 3NT4A 2AR0A 3SU8A 1V6SA 3HH8A 4JFRA 2X0EA 3RF6A 1XQ9A 5DXFA 1TJ5A 2WWGA 3GEGA 5GIOE 4EPXA 4G5XA 1K98A 4BEWA 3NW9A 3B1FA 4YR7A 3UC5A 3OC0A 1RKUA 1P62B 3JVIA 4MAAA 3OOWA 3SQLA 5FTLA 3AVWA 4GKKB 1ZJ4A 3P9ZA 4FGSA 5BUZA 4LSGA 4Z4FA 1I2MA 1XXHA 3DMTA 1I24A 2CYBA 3KR2A 1WCYA 4D57A 5KNBH 3KDAA 4U7GA 3RADC 4LJ6A 3WLQA 1AQNA 1FNMA 1Q0ZA 2QMQA 4RIEA 1JEJA 3DVLA 4QXAA 4IXWA 5JMTA 1U63A 5IFLA 1E6LA 4CNQA 3WK7A 4NZPA 1KHHA 2FWBA 2RB5A 1X1SA 3LQ2A 3K5PA 3MHTA 3FA2A 3JW8A 4LW8A 3W7AA 4JLDA 3HWX1 4I55F 4CL3A 3O5AA 5AW9A 1L4NA 1IY9A 2ANCA 3R7AA 3GPCA 2DFPA 4TKUB 3QRWA 2Y92A 1GV0A 1GPNA 4EP1A 2BKVA 1YZKA 3S1LA 4RUKA 3K8QA 1OHHA 1N3YA 2Q1XA 4YASA 2P3SA 1QUFA 5EWLA 1N4AA 3TWOA 3ZXUB 4IP0A 4QKQA 4ZJPA 4EGCB 2B4YA 2WJJA 3VDXA 4IGIA 4XYMA 4YPFA 2C0PA 2DR2A 4GP6A 4WT7A 2JFXA 4ESEA 1GDDA 2WIAA 5EQTA 1XR3A 3RTBA 1DAPA 4DRZA 4OV6B 4KE9A 5FP0A 3LCUA 2QQ0A 4PV7A 4WIAA 4HWRA 3U6BA 3PXEA 3TLMA 5CRIA 3RASA 3VJKA 3JZMA 1BWSA 1RS0A 1CQZA 1FFWA 2Q62A 2WM8A 2YBEA 1AQ6A 2C31A 4LHWA 4LY6A 4MAMA 4Y2RA 2O05A 2J9GA 5AOVA 1QIJA 2WR8A 1NE2A 1SBNE 2DH5A 1ZU5A 3WB0A 3ZNNA 1K8QA 2Y3IA 3N59A 4QQ8A 5LQCA 3S8EA 3MCVA 3X3HA 4CODB 2FEWB 3CUTA 3KX2A 2UXCB 2LKCA 4D9IA 3ICPA 4EFKA 4U1RA 4HTFA 1HE3A 3OT1B 2OAGA 1KRXA 3VKWA 5GOZA 1RRGA 2ODNA 1TYBE 2WJ4A 4V0MA 3UQYS 3CSDA 4LE1A 3WYFA 1V35A 3AR4A 4FGWA 4X7MA 1HZZA 3AUFA 3B52X 1ULBA 5TXGA 3R9KA 4EJ6A 3DB2A 4YC7A 3UY4A 6LDHA 3DVRX 4UTZA 3L77A 3NTOA 2IHYA 1P2TA 4F1JA 4CMKA 3G9UA 2O59A 3O4IA 1P75A 3U7QB 5SZKB 5IUNC 4U9UA 3WLOA 1EFHA 1P7YA 2UZ3A 3H9GA 3L18A 4ZYYA 4OI0A 3V2IA 3SWWA 1DIAA 2ON6A 2IU0A 1XTUA 5C5IA 3B53X 2FPWA 3C3BA 3HI6A 2CVHA 1AF7A 4MQ5A 5F3RA 3TQIA 3Q7RA 3F8SA 4PX2A 1E4VA 4BLUA 4Y6OA 5CXSA 1KWGA 4ZOQI 1V0JA 1B0ZA 3AEKB 2VZ8A 3PPVA 5DHAA 3WIUA 5FPKA 2AB0A 1T2CA 5B6JA 1P77A 3FKSA 2BGRA 3R6TA 3RUDA 2ENWA 2OV4A 3GRAA 3OPQA 4EZEA 4JT9A 1YC5A 2DJIA 4NTZA 1YRYE 3EBLA 3PI7A 5LQMA 2B37A 3M6FA 3D7RA 3E03A 4ZO6A 2YYAA 2ZRMA 2CHEA 4NCBA 1LPNA 2Z3WA 3RUEA 1ZQ9A 1UFQA 5HIAA 3L7AA 4X3PA 5DWVA 3OQNA 3CVWA 3MCWA 4OHOA 1U5BA 2IV7A 1R37A 4XI9A 4F6RB 2ZWPA 3W5BA 4QAJA 2WZBA 3B7PA 2ONJA 3O2SB 3ZDBA 2W6IA 1XDWA 4AJLA 3B6KA 2R97A 2IUTA 4QGAA 3H1TA 1PX0A 2Q49A 2X14A 2YC4C 3T9DA 1CULC 1FXSA 2WVJA 1Z5GA 3EISA 2VP4A 3CYFA 2QP4A 5DTJA 2D1FA 5EHIA 3EPHA 3MUOA 2M6KA 3B6ZA 3RYIA 2ATXA 4H08A 2B5VA 1B42A 1RAHA 2HPVA 1H4SA 2VWQA 3JQRA 1B8NA 2FOLA 1RTTA 1L1EA 1ODCA 3KHUA 4FI3F 2IZZA 1E0KA 4MWGA 4MROA 5LQKA 3E4DA 4ZXFA 3TN7A 2JLXA 2V1UA 3EEOA 3BF8A 3LCRA 5CH8A 1M8FA 2FCAA 4LHYA 2Y1CA 1QDEA 3HXKA 4Q01A 5D85A 3RAJA 1UXOA 2JKYA 1BSVA 3LHKA 4RORA 2WTXA 3E15A 2BFDA 1W96A 4UJ5A 3TDMA 3UJBA 3FBTA 1CQPA 2W9XA 1Z37A 3AEZA 2G7ZA 4X20A 2RHDA 1MIHA 3LUGA 3WB2A 3T54A 5C8VA 1AHPA 2VHQA 5EE5B 1LDNA 5IZCC 1E2MA 2I66A 1CEYA 2BP7B 2FXVA 3GMIA 3H8VA 3T7RA 1XMJA 3QKRA 1T4DA 4UAUA 1N6RA 3KCQA 1FFGA 3ZCXA 3BZUA 1KZ6A 4NNOA 4X6UA 5JU6A 5LVAA 2PL9A 2YZ7A 5ICMA 3IIKA 5F2KA 2AFVA 3HB0A 1KC3A 2DMRA 2OT3B 3W3ZB 3PDUA 2GBFA 3LLUA 1X7GA 4NMXB 2CLSA 2VT2A 5EIOA 5FO0A 1Q84A 3RRFA 4KVFA 1J20A 2IHVA 3K20A 4KXMA 1R0CA 4RDXA 1P5RA 1YJ5A 2VKTA 3SFTA 3IBFA 1F14A 1H9BA 5M29A 3WNDA 4ZI7A 2VH5R 4CM5A 2H2HA 4IG9A 5BXQC 1B0AA 3HR8A 2MR5A 4OXIA 3A6FA 5AVZA 2PX8A 2GYWA 1RYZA 2C83A 1NRJB 1A8SA 2E4XA 4JBXA 2ZRPA 2R96A 4MSUA 3I83A 4Q9AA 3RYHB 3QNWA 3USCS 5JNTA 1Z4IA 3AHJA 3RS3A 3SXPA 1I2BA 2PUVA 2O4CA 1M67A 1CW2B 4LJ5A 5HZGA 1CC1S 4LXXA 4DSTA 3LQ4A 3DL4A 4FFDA 3O26A 3BQ9A 4U4AA 5KYYB 2QRLA 1ID1A 3TOSA 1VYUA 2GK4A 4QL3A 2ZJ5A 1NMYA 4RA6A 4PNEA 4PR3A 4OBBA 1YVPA 1V5GA 2KQUA 1NW5A 3RG8A 1YJBA 2AC2A 2B1RA 3PKJA 3FCSB 2PXCA 4PPNA 4X91A 1A9TA 1XPRA 3WC4A 5ERXA 5AXBA 3VBCA 2GN9A 3IXLA 4LOAA 5LDDC 2BH9A 4OATA 1AUXA 2O57A 5DI3B 1OVMA 1GZUA 2IKSA 1KJ9A 4D4KA 4TLCA 3RT7A 3VSCA 1PKEA 2BCGY 2P3QA 5BWCA 3DO6A 3W4IA 1DXOA 5HUQA 3IB6A 3GJTA 4PTYA 5TJHA 4GI2A 4P7JA 4Z3KA 1K4MA 4IEIA 4MUFA 4TV8A 3TE6A 3TRHA 3BMOA 4DLRA 3IBSA 2F1RA 2FPRA 4O1MA 1L3IA 1KYIA 3H5AA 3NH6A 3OPMA 4I3GA 1YZUA 3LC7O 5TRTA 1WAMA 2UUPA 3WDMA 4C6SA 1DKNA 1FIUA 5HCUA 3VO8A 4OI4A 1UM9B 4QUAA 3G3EA 2G9UA 1UAYA 3HU3A 1FMCA 3LO8A 2BYTA 1HNWB 1SCUB 1ZY2A 5JDCC 1JDSA 1KFBB 3DTNA 4NP6A 4YCCA 4RTMA 1EP3B 3FMPB 3FN4A 4MUKA 3GIDA 5AKYA 4ANFA 2PGIA 4CKZA 4JL6A 2JKZA 821PA 3E3LA 1GSHA 2Q6VA 4MVJP 4DLUA 5C31A 2A0KA 3FDZA 1HFJA 1TD1A 5HIMA 1F2TB 5HBGA 2V6BA 3RKUA 2HBZA 2ZYWX 3ETDA 1L7OA 4CMCA 4D43A 4YYEA 1MORA 4AX4A 3PPXA 4WZBE 4C88A 2PMBA 4ZCSA 2JLZA 1BHQ1 3KC2A 4XIJA 1RHQA 2ZTMA 4O59O 4E51A 2AC7A 3WMEA 3VH2A 2R65A 1Z6PA 2OK7A 3DZBA 3EJ6A 3LX6A 4F5DA 5JXJA 4FDTA 2YYYA 1VP3A 3QLJA 3TL6A 1TYZA 4WKBA 1UKAA 1JHAA 5E9AA 4UD2A 3T5GA 4RPCA 4Z5XA 6ADHA 3L1UA 4ZKEA 5MFPA 5E1MA 3OX1A 3LXXA 4YCDA 3UB3A 1V11B 2ISSD 4Y98A 2HBYA 1I30A 2ZI6A 4DQKA 2W2LA 1G41A 3WJ2A 1WKVA 3DMFA 4BC1A 5JCJD 1RRPA 1NDHA 1PV2A 3RJZA 4GPAA 1C14A 3EFBA 1IN7A 4EYSA 3HNOA 4RGYA 4B4WA 1G3QA 1Z56C 3RHFA 1IOLA 4X1OA 1S3IA 1KDPA 4RZQA 4YRGA 3C8MA 4ND8A 4NSNA 4R2HA 4TXHA 2XCOA 3NJRA 3AG6A 2O2HA 1KE1A 4NYMQ 2Y4OA 1QQ6A 5IJ9A 2OO5C 2C7QA 1GJRA 5J2UA 5JANA 3JQEA 2C8LA 4WTOA 5ARCA 1ACMA 4ER7A 4BQRA 1XGKA 3WKCA 3VR3A 4D02A 3ROKA 4TOIA 3AEYA 4IBOA 1YAJA 2B2NA 1L4YA 1OTYA 4R1QA 5ALIA 2OYSA 3HCDA 3K4QA 1K5PA 3CVXA 4L16A 2V0CA 2Y9PB 1H2AS 3KQHA 2VL7A 5KHLB 3PCTA 1W5AA 4M9ZA 1BKDR 4TXMA 1V16B 1PEYA 3AM5A 2XWSA 3BKWA 3U2QA 2ARKA 2OBBA 2R7MA 2CHVA 4R1UA 4UUBA 3QXGA 3O7MA 5ARBA 5KTNA 1M7HA 1GRNA 2NO4A 4Q7LA 1E4EB 4ER3A 3LC2O 4HSGA 5JVDA 5EWLB 2K2QB 2A1UA 4KXFB 4TTSA 1T0IA 1HI9A 5KSZA 2BR3A 1D07A 2V8OA 4L2IA 4JQCA 1YWGO 3S29A 3GJ5A 2C9BA 3DFIA 3Q7QA 4A9AA 3LCVB 2AI2A 4W7SA 1U4OA 1W25A 3HU2A 3M34A 5F76A 2Q5HA 2AR9A 2UVDA 3AESB 4IDDA 4F4IA 1F3OA 1R4NB 4BTVA 5JZMA 1FFBA 2GVDC 2QTFA 5KYXA 3PCXA 2XWJI 4YMSA 4B87A 3B7WA 3I30X 4PGGA 3RT1A 3BBLA 1JKXA 5CB4A 2DP4E 5MN5A 1X14A 1EX1A 4MVXA 2QRUA 4YP7A 4C9BA 1FQKA 4J7UA 1M2VA 3EBOA 1JQKA 2NG1A 2PLFA 4YMIA 1ADFA 1KVSA 1NJ8A 2FPGB 1BXRA 3FKJA 3QPUA 2QTTA 4K7JA 3AM3A 4KU4A 4O1IA 3OE4A 5CYPA 1J0EA 5DP2A 1T6YA 4Q02A 1VBMA 2F3PA 3FNGA 2V3VA 1YR7A 3U4QA 4CF4A 3OA0A 3H3JA 4XEHA 3BX1A 3PNQA 3RU9A 3UTDA 1XVIA 3NBXX 1QYVA 5COQA 3UT5B 4BTEA 5J1SB 4DW8A 4LI3X 2BTQB 1E6UA 3EG9B 4K3VA 2O8FA 4FHGA 1VL1A 3T95A 4YAUA 1ISJA 4ZCTA 4HN9A 2CLOB 4NECA 4MI9A 4P35A 3HDHA 3F6YA 4TL6A 4RYLA 3Q0EA 4OLFA 1H0HA 5KJCA 3OCVA 2YH2A 1AH2A 3AQIA 1NBIA 2QNIA 2CCKA 4XDZA 3I09A 4Y7DA 2IPAB 2HSEA 1KKLA 4DIKA 4EY4A 1VYVA 3GAAA 4OFBA 3HR4A 4DJDC 2IE8A 2UZ1B 1P9NA 4IIYA 4M0FA 3ZWQA 5JOQA 1JI3A 5BN3B 4IV8A 2H1WA 4GXQA 4YAFA 5F4ZA 3GGJA 4QFCA 1UKCA 3DEFA 2EYUA 1GNTA 2O3UA 3Q1KA 4TS3A 4BN4A 4Q3EA 3KPYA 5KTYA 1XOIA 4JI7B 4MCAA 2IUFA 4PNPA 2N75A 2OGTA 4R01A 1C1XB 1JE0A 3RHZA 1M83A 3U4IA 1E4YA 1FOEB 2C0QA 5ILOA 3ZKWA 2GKOA 1NMZA 1YZHA 3I04A 2BFFB 1NPDA 2PRYA 3U3KA 1FS6A 3ZLJA 1E3QA 2OWEA 1ZA2A 2ZITA 1J99A 2WFLA 3BSYA 5C4GB 4Q7EA 3EVFA 4K8OA 2DWUA 3H99A 4BLOA 5BPHA 4MWCA 4U6NA 4X84A 3SKVA 2H4JA 1P39A 3GCGA 4W5TA 5ENVA 4EPWA 2Z08A 1ZOSA 3QKUA 5JBQA 2GBLA 2DWCA 1SKYB 3VC1A 4FYJA 2XIJA 1KORA 3AERB 4HDOB 5ALOA 5GP1A 2B4QA 3ABOB 5AO9A 1K1EA 3Q0TA 3VNQA 2XSZA 2P78A 4GMHA 1VDZA 3FCCA 1VCIA 1C4OA 3NVDA 3C6KA 4NWIA 3ANTA 1H05A 3V00A 2CVFA 4BLRA 3AI7A 1U6JA 3ZX4A 1QVWA 1T5OA 4RTOA 2EDCA 3C3XA 4JASB 5IUKC 4IRXA 1O94D 4LDAA 3VTKA 3SZLA 3AY3A 3DMRA 4CMEA 3R3WA 4BJ5A 5CCEA 1NVEA 3I2HA 4OHPA 3D81A 1P9OA 1A77A 4PM4A 4ENPA 3KWFA 3MCZA 4P0PB 1V47A 3OBBA 3L4EA 3RROA 3HFSA 1AT1A 4HDCA 2R1VB 3PBKA 3K1ZA 2XWBF 4HUJA 4OH1A 4Q39A 3OF3A 5ELLA 5I7AA 4BX3A 4XUCA 2QBYA 5D3KA 2CLIB 3OQHA 2WJIA 2D8MA 2QTNA 1AK1A 4G07A 2R8YA 5AK5A 5BQOA 1QC5B 1M8JA 3OLWA 4B74A 4BKUA 2VA9A 3KOOA 4U8GA 3CWZA 5KQGA 4HQOA 1PX2A 1OZGA 2K7ZA 4UZFA 5M7EA 3CR7A 3F96A 1YO6A 1FBTA 2H29A 2ID9A 2VYFA 1G8AA 4F11A 1EWYA 4XOUA 5B37A 3ZGXA 1OV6A 1UKVY 2C07A 4X7PA 1ACLA 2NO6A 1MMFB 3GZTB 4E6EA 5B57C 2VK4A 3N2IA 3QG5A 1NSYA 1SK9A 1N3BA 3B6MA 1E5TA 4Y8VA 1YAHA 2KBFA 3MWEA 2V7XA 2W5UA 4IDPA 1CY4A 1JH9A 2QRNA 3TSYA 3VH3A 2NO5A 1D4OA 3O8QB 1X39A 4MKXA 2ZI5A 4MUNA 4FIZA 1NVWQ 4KWHA 5D3MB 1DXQA 1V1JA 4UDXX 2JCYA 1C0PA 1R0RE 3OCWA 5JRJA 1INLA 2NW6A 4WXEA 1DZIA 1L6RA 2GT1A 2JHPA 3GELA 1Z45A 2BF4A 3N8DA 1QG4A 5AWFC 2QMYA 1YHNA 3FYHA 5BQPA 2CUKA 1PJTA 2NTYC 2ZYDA 3HKEA 1D09A 4G1FA 4ID9A 4ZVOA 1TK9A 2VDLB 4CMAA 4BO7A 5A4AA 4G0WA 4ZVUA 3T7AA 1NQVA 2BFPA 5BN5A 1LBIA 1NZDA 3R24A 4LXHA 3N2GA 4NCKA 5JIBA 3L0SA 1D5CA 3AW8A 4G4JA 3WBBA 2VQFB 3W2EA 4IJ6A 4RHCA 3M4JA 4V03A 3I04M 2JG3A 1PBTA 6PFKA 3KELA 2NU7B 2Q7XA 1JTFA 1ELOA 2PSEA 3VR5A 3L7IA 5FUWA 2NO9A 2NVUA 1OBHA 1GCIA 5ICCA 4JUBA 3GH3A 4JLMA 4G0QA 2AN3A 4P3XA 2VTKA 5TGDA 3G79A 5G0WA 1C9EA 3FKSD 3C3MA 3TSZA 2AL7A 3CS3A 1Q0UA 3IP3A 1LBEA 3K0FB 3MINB 2HLNA 4JXXA 2ODWA 3AJEA 1U2DA 2Q3BA 4W5OA 2AOXA 1ZH0A 4DLKA 1K4YA 2GTPA 5JY6A 3LS2A 3M6WA 4ZCPA 3KTDA 1ZH2A 4BV9A 4I50F 3T61A 2RGAA 1MX3A 3DG9A 1IUKA 4YUVA 5T64A 1GAJA 3FPKA 4DBLC 4DV4B 2DUWA 5FOVA 3HJGA 4P92A 1A7KA 3VFDA 4CM9D 3FZQA 4Q4DA 2B82A 3L0CA 3OQ1A 3HO8A 3QXHA 2FUG1 3C0KA 4G8BA 5FCDA 1MT3A 1GWNA 3W05A 2Y1XA 3H4MA 1SIBE 2C57A 4RHTA 1GZ7A 4E7PA 2GYUA 1B8PA 3EOAI 4OF4A 1PT7A 1TW3A 3D7MA 3T3DA 4JS0A 3GJ0A 3H5OA 1QOZA 1T1SA 4FOLA 5J5VA 2VQSA 1O5TA 5KX5A 2H57A 2OO3A 4M37A 4GMGA 5EE9A 1KOGA 4YQZA 2ADFA 3FOFC 5DNVA 4OXNA 2QYTA 3CSUA 3MB8A 1JE1A 3NXSA 5HJ2A 1XHLA 4BNHA 1FTQA 3R77A 2Y1OA 3IOCA 2QYHA 2QJTA 1OZHA 2VZ9A 4HP8A 4IHQA 4C04A 4EHKA 1JW9B 3HJHA 2C4VA 3TRKA 1CUAA 1NY6A 4IG4A 5DNEA 3GOQA 2WHPB 5CHYA 2H65A 2ISQA 1XDUA 1W85B 2CLCX 1UT6A 3IULA 2J9FA 4KYUA 3NZEA 1J8YF 2JAUA 2OENG 4KQ6A 2NUTA 3UJ8A 2EP7A 1T5DX 2J9RA 1Q1EA 3V4VB 3ZU5A 3LRXA 3GCDA 4IJUA 2Y99A 5BT9A 2XVAA 1N32B 1Q1QA 3LLSA 1SVIA 2C2YA 3VPFA 1NJ2A 4HQ6A 3LZCA 2BSQA 1DQSA 1LWOA 3KQNA 3AY7A 2NUAA 1M1NA 2J8ZA 2HEGA 4RTQA 4GMKA 1DQRA 3TXAA 4GPBA 1TM4E 3KQKA 2I5PO 1EUCA 1SG9A 2TMDA 1JU4A 2X6RA 2V5UA 3PQ2A 4MTLA 1TDJA 2P5SA 2PM8A 3OPYB 4AX8A 2E0IA 4RD2A 3D6JA 3OAAD 4O0MA 2HK6A 2JF0A 2ERXA 3I45A 4I4IA 1I4OA 4R69A 2VRBA 5A02A 4XD7A 4Q12A 3SVLA 1C7QA 3HKDB 2WWRA 3LLCA 5E4YA 4P36A 1YZTA 3STYA 3O1HB 4X8LA 2DPHA 1HT1E 2WAOA 3U0VA 1EE1A 3L6DA 4CM8A 4DV6B 1LZLA 4FR0A 2WICA 1UT5A 3WFIA 2C9CA 3H8JA 4YDQA 4OQYA 2FN4A 2W58A 3E05A 4CZ2A 1T43A 1Q0TA 1DS6A 1WUYA 2O20A 1W5SA 1C0IA 2BEVA 4JB0A 4AF6A 1NU8A 3TRFA 1ZEMA 1E98A 4JCCA 3M4ZA 3UTCA 3L4KA 1YCHA 4ZYVA 2ASEA 3DE7X 3ZGOA 4QFMA 1VJ5A 2V3CC 4DSAA 5KNDD 1D2AA 1NAIA 1O7JA 2PUTA 2YKGA 1MQ9A 4KVAA 2BN4A 3OJ0A 4I5IA 4LWQA 3ZZ0A 4B6SA 4A2QA 2OFPA 2PV7A 4B84A 2R84A 1XRMA 1N2EA 1BE1A 3QX8A 4NBTA 5FR1A 4MS3A 3ZK9A 2QI9C 3L8HA 4Y2VA 521PA 2E4WA 3ST7A 4OUDB 2XQIA 4O2AA 3OZBA 1FNCA 4Z51A 3HYCA 3B78A 1U4NA 4AUEA 3MJCA 4RIHA 1KK2A 5A0VA 3NGMA 4B8YA 3OQMA 3FHOA 4GXNA 5DDIP 3PFBA 4FYVA 4CF3A 5K3EA 4AULA 2B4AA 1UDCA 1WCIA 4QM6A 1YI1A 4I4TF 2XYPA 1Z4PX 3UMMA 2VI5A 4XYEA 4IZIA 2QL9A 3LHFA 1L8XA 2EJVA 3G2HA 2REOA 1YZLA 4FI3C 2QORA 4KV9A 3S68A 3ND8A 1J49A 1QKKA 4E5NA 4XLZA 4Z9BA 4MQFA 5IF9A 4CCYA 2FF5A 1IK6A 3HJTA 2R7LA 4IDGA 3RIXA 4MV7A 4D3SA 4KWTA 4LIPD 1QAOA 3DNFA 1TAUA 1VPTA 3L0YA 4LHEA 5DOZA 4R6XA 2JLBA 4GS5A 4V0SA 4P9NA 4HRXA 1JHXA 2PMKA 5F35A 3UANA 1CUCA 4FEYA 1RJFA 3HJAA 3N6RA 1CVRA 2IYLD 3EZXA 1I1QB 2E5FA 4B6GA 1G20E 2GBGA 1ZIYA 3EC2A 5BMOA 1MJNA 3A2KA 3Q6NA 3TFOA 4QDTA 2CLEB 4QHSA 4R3WA 4BUJA 3X1WA 3VKGA 4U00A 1L5YA 3ZE2B 1DLJA 3LJKA 4B4OA 2ZBVA 3B9RA 3KJGA 3PUVA 3AM1A 3T06B 4MKZA 1GNSA 1Q50A 5CM2Z 3U44A 2AYZA 2LR0A 1B3BA 1JA1A 2K4MA 3KT6A 1QONA 4IJWA 3BXGA 5EHZA 1JHDA 2VP5A 5DNDA 1XCMA 1Y8QB 5FFFA 4FHEA 3E9EA 3PG5A 3NR2A 3PT9A 2I6QA 3OZFA 1IVNA 1RI4A 3UFXB 1HMYA 3NQ41 4EVQA 3OMLA 5BMVA 2PKCA 4I46A 5EYPB 5JCOA 2DJ5A 3DT8A 5JAPA 1JJAA 4IXNA 1ZAYA 1TK2A 2FP4A 4MV9A 3WLFA 2WSLA 5MFZA 2FK8A 4P22A 1BDIA 2MYTA 1LB1B 3V6LA 1EHIA 3VKVA 1GTG1 3F4KA 2JLWA 2XGMA 3HO1A 5LXTF 4DEYA 1A97A 1CRQA 2Y0CA 4RF5A 3DWFA 4L9RA 3SJCA 2GX6A 2F1JA 3W5DA 3SLGA 3OVMA 3UW1A 3W8NA 1GZDA 3FYUA 4BP9A 3NYIA 1Y33E 3FVRA 3CX6A 4KDFA 5B12A 4PN7A 4HBZA 1Q57A 2FRDC 1TAQA 2MMCA 5AMXA 4G1MB 8GPBA 2BMJA 4JEIA 1YMVA 2GDZA 4ZVMA 3C6MA 3UGJA 2QDXA 4OYLA 4RNCA 1NG9A 4TQAA 5BOVA 2YXNA 5DN6D 1W88B 2Q27A 5EJAA 1PVVA 2AX4A 5KDOA 1J1IA 1GCOA 2UYQA 2WBLC 3GNSA 3MQ4A 4P81A 3HA2A 3KLOA 3CZRA 1FVHA 1WTCA 5IBQA 1GUZA 2HT1A 4WBNF 2Y1KA 1IXRC 2I6UA 3VPGA 3WQBA 5A5EA 3GDHA 1ORWA 2D1QA 3Q3HA 2JAQA 1XLTA 4FINA 1Q1NA 3VYVA 2KLBA 3AP3A 3K7EA 3TM4A 1ZNQO 4M9CA 4X93A 4PIVA 1E92A 4FR5A 3V80A 3U48A 5AM5A 2YV3A 4UE3S 5M5BA 3HNPA 1W76A 3HGTA 4LXIA 1XWWA 2LVBA 3CO5A 4Z99A 3O8BA 1GTMA 3DE6X 3S99A 2JAPA 3EMBA 5DCLA 1R0SA 1RBYA 2B20A 1GADO 4TLAA 1PTJA 1YV9A 3FPFA 2QGFA 4PSUA 2Q5QA 4QNNA 3A1CA 3DUFB 5I7VA 1E94E 2AEMA 1DCTA 3FLAA 5D5QA 1ZGCA 2ODQA 4NFHA 3AHDA 1YQWA 3GLTA 3HCAA 2AMYA 2QEQA 3KR9A 3RVOA 4CLOA 4JC0A 3SAJA 1KJWA 1Q91A 4D2IA 4WK4B 3VX4A 3BAFA 1IEXA 1UEXC 3LBIA 2IZ5A 3DO8A 1MB4A 2F7SA 3DL0A 3GT4A 4M3NA 4FZRA 3PNSA 1RPAA 3A36A 2A6PA 2P9HA 2X9GA 4XX1A 5AQ1A 3FMGA 4QHTA 5ETJA 4J75A 3BL8A 4M1TA 3HB4X 3ZWCA 2A7QA 4JAVC 2OHIA 2GPJA 3AF4A 4MEJA 3C6YA 5IVPA 2BONA 4Z1OA 4TKVB 5AM3A 5FOWA 4IVRA 5TEVA 4DQ0A 2ATEA 3K31A 1OXTA 4R2IA 2BD0A 1LK0A 1N5LA 1WUIS 1FJGB 1N0UA 2XA9A 2YJ5A 3ZTYA 4MICA 1WXIA 1Q0QA 4KL8S 1GCUA 4H1HA 1XROA 4P7GA 4S0ZA 2XAUA 3WMGA 1F8XA 5HHTA 5KYWB 3MPUA 2W98A 3G85A 3I9NA 1VG0B 3QXXA 4YJ2A 3N6XA 3GRZA 2CLKB 3L6RA 3B1VA 3L43A 3JARB 1VGRA 2FUKA 2ZROA 1KJJA 1P4HA 1R16A 2ZYHA 3BE5A 3KU1A 3R0XA 4UU7A 3PDCA 1T1GA 5H68A 3GGGA 4YJFA 1BX3A 2J5KA 1FXWA 2HQ1A 2JA1A 3LOQA 1AHHA 3OZIA 1I2CA 4ESHA 4H15A 1RBZA 1RWXA 3EUWA 4QG7A 4AY6A 3FCYA 2WSMA 2ZIGA 4G3XA 2JAOA 3AKDA 3DE0X 3CMMA 3FNFA 1QP7A 3KEFA 1U3TA 1QCYA 2D0OB 2FDRA 3N0VA 4C4TA 2ZUFA 4UNSA 4N3AA 3KAKA 2XUAA 2XUDA 1EDBA 2Q99A 1EFPB 4BGDA 3UFBA 3ABSB 2OORC 2W8ZA 4YS6A 5EMHA 4I1RA 1NULA 1EZ4A 2GJKA 2HMWA 3HP7A 5E8JA 5J59A 3REFA 1E79D 4Z0TA 3V2HA 3QVJA 1HDYA 2P62A 2Q3EA 3DW1X 1WZIA 4DXHA 1OIXA 2KW5A 2DFKB 3GARA 1J0XO 5CLGA 4MS4B 3DKPA 3C97A 1WB4A 4BMOB 4EAQA 2XDYA 1UJ6A 3E8MA 2EV9A 2J0QA 3HUTA 2HTEA 4M9XA 1W36C 1W46A 4JC8A 3SZRA 5JWOA 4XSVA 4NC9A 2E9SA 1XZQA 4MDFA 2NZ2A 3LY8A 3KQYA 4E15A 2NIPA 4MV5A 1JNYA 4KX5A 1AC5A 5KX5F 2I9KA 2IYQA 1HLGA 3KB1A 1J8MF 3TMKA 1NBHA 3U3JA 1ZLYA 5KVCA 1H4QA 2BHLA 3EQ6A 4ETMA 1K9SA 4EPVA 4GUAA 2Z6AA 1GARA 5BOSA 4WNCA 3UJ6A 4KNYA 1SXJB 3DKRA 4LISA 1WG8A 2IUUA 2IV2X 4I2NA 4OFXA 3TNJA 1SHZA 1X70A 1JAYA 2PSFA 3JAMA 2GUWA 1FA9A 3U0BA 3BC1A 5D51S 4O8CA 2R66A 3IKLA 1PFKA 5AXCA 3SF8B 2EKZA 4Z9XA 3ILVA 4PTLA 1R10A 4Z3DA 2I3DA 5IULC 3HVRA 3FX2A 1GPWB 1PGNA 5THXA 3AHEA 1XVLA 4KAJA 3DEAA 4HS4A 1OPXA 4QAQA 5FNVB 2C20A 5B2ZA 2IYNA 4N01A 3BDVA 4L3OA 3VNAA 3ZZUA 3UOGA 1OH6A 3LT2A 4X3CA 2BI8A 1HE4A 4ZFNA 2IWRA 2VSOA 1RPZA 1F0PA 1Z82A 3PNMA 3IT2A 4NYJR 5JO9A 5JDCA 2BGLA 3ROTA 3IPLA 2ZJ4A 1E5QA 3UMVA 1E2DA 4ZMRA 1JLLA 1Y9ZA 4LN1A 5FTMA 4RVSA 5CXXA 5KPJA 1JNXX 3L7BA 2ZBDA 2O3QA 3B13B 2PUBA 3M6UA 3ZZNA 3CZCA 2PWBA 4D3FA 5GY7A 1OIVA 4L72A 1G8YA 2XEXA 3S55A 2R2GA 4R6WA 5K0NA 3D54D 4BNLA 5EIBC 1OYOA 1JVNA 2EFDB 4UUAA 4HWTA 4UQPA 4TXLA 1XZIA 3ZWMA 3MGKA 1B1AA 5FPHA 2QLFA 4OB7A 1H5NA 1HYEA 2ZPAA 2ZYRA 1C7EA 2G5TA 1G20A 3ZWOA 2QVCA 1M1YA 2ZIEA 3NHPA 1NBEA 4AF8A 1QAQA 3EWNA 3P0JA 5SYMA 1T25A 1BQ3A 4R1LA 3PFGA 2J45A 3ENQA 3SIPA 4CM9A 4JB2A 4BHTA 1V6AA 3L7JA 1AXGA 1R9JA 1UADA 1VPEA 2C9DA 4XIGS 3WLJA 3KOMA 1SGWA 3C7DB 1JLHA 4FT2A 4HN2A 1MT0A 4KLAA 4MWBA 4Z6KA 2ZLBA 2PH1A 2IXFA 4RZ2A 1D7OA 3LKVA 3GFQA 4UULA 5K4AA 4P3YA 1TEHA 4UHBA 3V5NA 2HHJA 2YR0A 4KN5A 1JHUA 3F5MA 5CCXA 3DCYA 4MWOA 4JSTA 1D03A 4D8VA 4ALIA 1PDVA 3L8EA 3GUUA 4PFKA 4JJGA 4HEQA 2L82A 4E31A 3HCBA 2QE6A 3UHFA 5EJ6A 3ROGA 5JFTA 5TMEA 2I2XB 5GWXA 1WE2A 4AURA 4D9HA 4IF6A 5G1OA 3T35A 3H9UA 4A4DA 4ALMA 5FAXA 4Y9DA 1NF2A 5A7GA 1LRJA 3L82B 2BLNA 2OFFA 4DA7A 5DM2A 3U3XA 2ACWA 2X6QA 7REQA 3THXA 2JZCA 3TAXA 2Y05A 3WAJA 4YCMA 3DWGA 4GOKA 4Z8YA 1N8SA 1KMHA 2GPAA 3NFYA 1U0SY 1RADA 3IVCA 1QV6A 2A59A 1FYDA 3Q7EA 4CUKA 2VHZA 1GZHB 1EXVA 3R7WA 1AKTA 3O2NA 3DLPX 2BKXA 4LV8B 2RMKA 3RVKA 4OLAA 3ZQJA 2VJLA 1W6RA 2HWXA 1QWSA 4B7CA 4B46A 5HW0A 2J59A 1ZJYA 1UT8A 2OCGA 1FFCA 3L93A 3UENA 2CEAA 1VBKA 1XB2A 2JLRA 2PEZA 3EH1A 2KLHA 1O9HA 3H9JA 4JBIA 3MAAC 4AO6A 4FE7A 2XRMA 4FYYA 1OUMA 4HDKB 2PA0A 5TY0A 3SHTA 3DBHB 2JJ1A 5F73A 4BNUA 1ZVKA 3G7NA 3IE0A 1P6XA 2GB4A 1UDWA 1YDGA 4G1UC 3TMAA 1OTXA 4RKWA 2O9JA 3DDSA 2PWAA 5DGXA 1UP4A 1I7NA 1VPLA 4MHTA 1UPAA 4DWWA 4BUCA 4LZWA 1GYPA 1XWFA 1JYEA 2WF5A 1ZVQA 2VP9A 5D01A 3VPDA 1E5XA 1L7MA 4UFOA 4EELA 4B40A 1DAOA 2XMZA 2CJPA 1XKLA 3GPDG 4IOLA 3SDZA 3WWZA 4EBFA 3QPDA 1NIJA 1BDBA 3DBIA 4XAQA 2ZREA 2XE6A 1JA9A 2XUJA 1DQPA 1IQRA 4CG3A 4WRRA 2F6RA 3CEJA 2HF7A 4H6PA 4D5GA 3SQNA 1DKMA 1W0KA 5AP9A 4FFRA 5DF1A 5HZMA 1FYVA 3IUEA 3ZD9A 3RI3A 1TOAA 1EDZA 5CBPB 3LDHA 1Y4SA 4LY0A 4ZZ2A 4B6EA 4TWAA 1DAFA 1GAWA 4CM4B 3NDRA 1AMOA 1G3IA 4IHJA 1KE2A 2IHZA 3ZLBA 3K1AB 2CNWD 3KFLA 2HGZA 2VUSA 3KEOA 3R75A 4BJ3A 5L95A 4JYZA 2WHXA 3EHDA 1KO4A 5C0OE 1KY2A 2OBMA 3Q8XB 5SY4A 3NI2A 4R7GA 1PR4A 1JLRA 1VIAA 1J6UA 4R2LA 2FPPA 3EIQA 2PT7A 1BKSB 3TLKA 4Z53A 1X13A 3HA5A 2DBYA 2ZTSA 3HDTA 2YN2A 2GH1A 2F9MA 3A6GA 1N6LA 4QXRA 1TT5B 3ESAA 4KPFC 3OAAA 2H31A 4LHXA 3RPEA 4QBIA 2C77A 2G1UA 2HHCA 1ES9A 2REQA 3LKDA 3PTLA 4R4JA 4D96A 5CBKA 3PXGA 3UWMA 3HCOA 4JB8A 1NXSA 2BZ0A 2DCMA 2IPOA 3NTLA 2Z5LA 1XWIA 4BC0A 1GLVA 2ZIAA 2JW5A 3NC1C 3TKLA 1MNAA 1R4ZA 4RULA 4RD4A 2M6LA 2XCUA 3L4BC 3G88A 5EXEA 5EHQA 1N9ZA 4LZOA 1CE8A 3C5VA 1M33A 4XFJA 2VPWA 5ADWA 2PUWA 3QF4A 3M0EA 2XHEA 2ZUCA 5JJCA 5D1HA 1W0JA 2HJVA 3DZJA 3MT9A 4OUDA 2H7VA 2PXXA 3HRHA 4Y6SA 2PJRA 1AUQA 3UW3A 4V1CB 3BIXA 3G5AA 1FTSA 2ADOA 2HK8A 1KEEA 2JCSA 4QUHA 5BVGB 1NLFA 2PHZA 4NLLA 4E4YA 1ABBA 1SQGA 4IM7A 4MYDA 3LSTA 1NVAA 1SZJG 2GO1A 1F38A 2C61A 3RS5A 4WK2B 1C4XA 1T13A 4B3GA 3AP1A 3NTQA 4KXYA 4AQ7A 1UKZA 2ZJBA 1YBFA 4DV2B 2XUHA 4CKBA 1FDTA 1I7DA 3G1UA 1GD1O 2QVYX 4E3WA 2QLJA 5GMOA 1NR7A 4R5HA 3GLHE 3CX8A 3TZQA 1OFIA 4RSRA 5K0LA 2FMIA 2I6SA 2UUOA 4D4LA 1RMQA 5IEBA 2QN2A 2J30A 1NRWA 2L42A 4IIBA 1W94A 4HDNB 4EJSB 5JSZB 4HC4A 4IDOA 4QPCA 1ZL0A 1BGVA 1RLTA 1UOEA 4ZV9A 4YT4A 4N5DA 3MS2A 4DPLA 5CVDA 1DJOA 1ONPA 1UK9A 2GCPA 3OP1A 4D4HA 2IHUA 3RFCA 2HR1A 2LDXA 4GICA 4AS3A 5TF0A 3NEAA 1C7FA 2HQRA 1FXWF 2O3JA 3DDWA 3E82A 1W93A 3PGXA 5CURA 5WRFA 4E5YA 5KEIA 3K0BA 3Q3CA 1NN1A 2IEZA 2IBMA 1H3EA 5CX4A 1RZ3A 3NT2A 1O57A 4H77A 3N1UA 3CNHA 3RUAA 1ST3A 4QGBA 1KSGA 1HDXA 3G2NA 3COPA 3M3PA 4MPPA 2NPFA 3H2YA 4FC6A 4FFLA 2QXYA 5HKKD 1YIOA 2E85A 4KIFA 3HXMA 4D74A 3L06A 3NV7A 2GN4A 2V3WA 1DUVG 2QR2A 1B8UA 4J16A 1U2DC 4NYIR 4RJ2A 2WF6A 5EMLA 3X0DA 1UDXA 1J9GA 1RJ9A 3GRRA 3ESBA 1NYTA 2V55B 1OGJA 4BVJA 1TJPB 2LCQA 1LRKA 4Q1VA 3L7YA 4RK0A 5JATA 2OVBA 4ONEA 5BSVA 1LC0A 2RHHA 5G02A 5CFPA 2Q0SA 4IRMA 2I8AA 1GNPA 1IRXA 1FY2A 3OOHA 5AD1A 5AM4A 1I5RA 4ZYZA 1A1SA 4F21A 2SICE 4B79A 4LRYA 2IUYA 1YJAA 1XNQB 4BZWA 1WXXA 2DZDA 3H19A 1MEJA 1N0IA 1JJFA 4DBLE 1NKVA 4B9AA 4AWXA 2JZNA 2QRVA 3FNBA 4Q3LA 3KQLA 2X9LA 2Q0QA 5D3ZA 5DLDA 2Q3DA 5CB0A 3CCFA 4MIKA 2J5XA 3GLFB 3BMXA 3HJUA 1WSWA 1XAIA 1UBSB 3FHLA 2QK4A 1VJTA 3EZ2A 2BGIA 1YGPA 4Y6RA 3RV4A 3KWLA 5JCOC 2C2OA 2P4UA 1HO3A 2RIPA 4YAWA 2IHNA 4OGLA 5CNKA 3UWPA 4IHJF 3UMFA 2VBIA 1CVLA 4OAQA 2HF9A 1ZW1A 2ORIA 3KJQA 4ILEA 4L51A 2D7DA 4XSHA 5GIPE 4IV0A