3MMZA

Crystal structure of putative had family hydrolase from streptomyces avermitilis ma-4680
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
163
structure length
163
Chain Sequence
SLGALPTAEDIDAVVLDFDGTQTDDRVLIDSDGREFVSVHRGDGLGIAALRKSGLTMLILSTEQNPVVAARARKLKIPVLHGIDRKDLALKQWCEEQGIAPERVLYVGNDVNDLPCFALVGWPVAVASAHDVVRGAARAVTTVPGGDGAIREIASWILGPSLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative HAD family hydrolase
publication title Structural basis for the divergence of substrate specificity and biological function within HAD phosphatases in lipopolysaccharide and sialic acid biosynthesis.
pubmed doi rcsb
source organism Streptomyces avermitilis
molecule tags Hydrolase
total genus 50
structure length 163
sequence length 163
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3mmzA00
5AESA 1ZS9A 2O2XA 1F5SA 4BBJA 5AK4A 4RETA 5ALTA 5ALZA 5ALXA 5AW7A 3R4CA 3QUTA 1RRCA 5AVUA 3ZTWA 1CQZA 5ALDA 1Z4QA 4BX2A 1YV9A 3B9RA 2P69A 3WK8A 2G09A 1ZRNA 5AVYA 2FPWA 2P9JA 3OPXA 1WVIA 3R09A 3D6JA 3ZX4A 1NNLA 2R8XA 3SHQA 3WK5A 5AI9A 3E81A 3L8GA 3SMVA 1XP5A 4UMDA 4UARA 5AVVA 4HGPA 3A3YA 3GYGA 4ZEWA 1ZJJA 4CF4A 3QUQA 1YS9A 2IOFA 1Q91A 5IT4A 3KOOA 5AICA 1O08A 4OHFA 3EF0A 2G1AA 3QU9A 2YJ6A 3KC2A 5AI5A 3WKBA 3L0BA 2HCFA 1VFPA 2I33A 3ZI4A 3ZU6A 2B0CA 3QU2A 4UMEA 2YMMA 1NRWA 5IT0A 4HGNA 3QU7A 3A1CA 4ZEVA 3AR7A 3HYCA 3A1EA 4UATA 3KZXA 3UMCA 5AW4A 2HHLA 1ZOLA 2PQ0A 3U7FB 2YMLA 3FVVA 3K1ZA 2WF6A 4Y2JA 3SD7A 4KYTA 2GO7A 4KX5A 4Y3UA 1WPGA 3E84A 4HYTA 2EARA 2GHTA 3KDPA 3AR5A 1XPJA 3L1VA 4G63A 2YN4A 5ALEA 5AVTA 3ZVNA 2ZBDA 3U19A 4L57A 4HGOA 2MSNA 4YCMA 2CFSA 4OFZA 5ALKA 5AM5A 3KBBA 4Y2YA 5AK5A 1RMQA 2C9MA 3QU5A 4UASA 1L8LA 2X4DA 5AHXA 2FDRA 2ZBFA 3NRJA 5ALQA 1RPZA 1L8OA 3UMBA 3PGVA 3L8EA 4G9BA 4L6AA 2PR7A 1RKQA 2WF7A 4JB3A 4C4SA 5AM4A 4BYGA 1RLTA 5A3SA 5AK3A 2WF8A 3B8EA 3OCXA 5AI6A 4GXTA 4IG4A 3A1DA 3L0YA 4BKMA 2HX1A 3IB6A 1RLOA 4Y2VA 4UMVA 1WR8A 2DQSA 3NAMA 1Z5GA 1PW5A 4XE5A 3FZQA 3QU4A 4DWOA 4NV0A 4YGYA 4OCZA 3FPBA 1Z4PX 4UAUA 2R8ZA 3R9KA 4B6JA 3M9LA 2QLTA 4Y2SA 2W11A 3HLTA 3MC1A 3OCYA 4C4TA 1RQLA 2WHEA 2FPXA 5A3RA 5FP0A 3QUCA 2ZBGA 2G0AA 2YJ3A 1L7PA 1U2TA 5A3QA 2W43A 5ALWA 1MH9A 3CNHA 1S2OA 3AR8A 3DDHA 3L8FA 2I6XA 4Y2TA 1QQ7A 3L5KA 3I1YA 3W5BA 2C8KA 3ESQA 2ZBEA 3QGMA 4XQ0A 5ALYA 3S6JA 1Z4KA 4EENA 3NASA 2I7DA 2HO4A 2P27A 1AQ6A 1Y8AA 2RAVA 2HI0A 3AR2A 5ALNA 3EF1A 5IS2A 1N9KA 4NABA 3QUBA 1TE2A 3NALA 1RDFA 2I55A 2FPSA 3W5AA 3TLMA 2D2VA 4MWOA 2OA0A 4EX6A 1ZD4A 2W4MA 3I28A 2G07A 5ALMA 2P11A 2AGVA 1QQ5A 2FEAA 3DAOA 3ZVLA 4YCNA 3IJ5A 4BEWA 4F72A 4Y2XA 1ZRMA 4DCCA 3QLEA 3MMZA 5AKZA 3WK6A 2IOHA 3L0CA 4UU0A 2OM6A 4Y2RA 5AW9A 3ZWKA 1T5SA 4AP9A 2ODAA 2R8EA 2BDUA 5E0OA 2HF7A 3QNMA 4O8CA 1TJ5A 3ZUPA 5AM0A 2FI1A 2IOFK 4DFDA 3N1UA 1KYTA 3WKDA 3U26A 3ZW7A 5AVQA 3ZVMA 1RKUA 1X42A 2G06A 4EEKA 1Z4NA 2YBDA 3U13A 3OCWA 2FUEA 5ALPA 4UM5A 4UW9A 3E8MA 4ZEXA 5AIAA 3EPRA 1Z4MA 2B8JA 3I6BA 3DNPA 5ALRA 1VJRA 4BX3A 1TA0A 5T41A 5ALHA 4J03A 3UMGA 3OTQA 3NUQA 5AKGA 1J97A 2C88A 4L6CA 3P96A 5ALGA 5AW3A 2WM8A 5AW5A 3ZTYA 3VAYA 3SF0A 4Y2UA 3M1YA 1S8OA 2RBKA 1T5TA 2YJ4A 3FM9A 1O03A 2Q4TA 3ZX5A 4H1WA 5AK6A 4FFDA 3SLRA 3AR6A 4YH1A 3U7HB 3AR3A 2B30A 2CN1A 4CF3A 2EATA 4YIKA 2ZOSA 2G08A 1LVHA 1L7NA 3ED5A 5AI4A 3WKAA 4AS2A 2QYHA 5ALVA 1YNSA 5AM3A 2MU1A 3QX7A 3U7EB 1JUDA 2YMPA 4F71A 5JJBA 3E58A 5AKIA 2RARA 5AW1A 2HSZA 3OCVA 1SWVA 2B1QA 2AUTA 3PCTA 1QQ6A 4IFTA 1SWWA 2CFRA 1RC8A 2Q4RA 5ALFA 1L7MA 2I54A 3MN1A 2O9JA 2R8YA 1RQNA 4QJBA 5ALLA 1EK2A 3N28A 2ZG6A 4RESA 4MUMA 4C4RA 4DW8A 5AVSA 4BEVA 3KD3A 5ALIA 2IA5A 4PNHA 2CFTA 2GFHA 1Z4LA 4BX0A 1IWOA 3J7TA 5AI8A 4EX7A 4YCLA 2HDOA 5AW0A 2BY4A 5AVRA 2IYEA 3OCZA 4EELA 3WK4A 2PKEA 3ZWDA 3L8HA 3DV9A 3WGUA 3SKXA 3PDWA 2HOQA 2VKQA 3RFUA 4NAVA 3N5KA 4KN8A 1Z88A 4UAVA 1U2SA 2AH5A 3I76A 4FE3A 3B9BA 1K1EA 1QYIA 3EWIA 3FGOA 3CZ4A 2WF9A 3N07A 3ONNA 4UMFA 1Z5UA 2NO5A 1RMYA 3WKCA 3QYPA 4CF5A 2B82A 1EK1A 1ZD3A 4HAIA 2JAOA 2NYVA 4XPZA 2YY6A 3L7YA 2JAWA 5AM2A 1NF2A 4NWIA 4GIBA 3AR4A 4J2TA 1WZCA 2JARA 2FUCA 2GHQA 4UM7A 4YIHA 3ET5A 3BA6A 3UM9A 1VJ5A 4KNWA 2ZXEA 5AKEA 3QXGA 5AI0A 2FPRA 1J8DA 4CNQA 4EZEA 2Q5EA 2WF5A 4I9FA 1Z4JA 4BNDB 2HEGA 5ALSA 4QQFA 3NIWA 5AKXA 4Y2PA 1XVIA 5ALOA 4HGQA 2FPUA 1LTQA 1TJ3A 2C4NA 1Z4OA 2HF2A 4AS3A 5AIBA 1RLMA 5ALUA 5AKJA 2EAUA 3FPSA 2C8LA 5AKLA 5AVWA 3BWVA 2AMYA 3WGVA 3OCUA 5AKHA 4KX3A 5AKKA 3N8GA 3WKEA 5AW6A 1RKVA 3PGLA 4BNDA 2YMQA 3SKYA 3L1UA 4KNVA 1L6RA 1Z4IA 2BDEA 3ET4A 5AVXA 1Q92A 2OYCA 2OBBA 1U7PA 4UU1A 3RF6A 1U02A 4NFLA 1YDFA 4HGRA 2NO4A 1QH9A 3ESRA 1RMTA 3F9RA 3U7GA 4CE6A 2B1RA 1ZD2P 1U7OA 3W5CA 1N8NA 5AKYA 3AR9A 1YJ5A 4I9GA 1SU4A 5AW8A 4E88A 4JDPA 5AVZA 2I34A 3IRUA 3W5DA 4Y2QA 1FEZA 1L7OA 2B8EA 5AW2A 3MPOA 4OD0A 5ALJA 5AM1A 3WK7A 2YJ5A 1TJ4A 4XOUA 2WFAA 2JGAA 4FYPA 2G80A 2GMWA 3WK9A 1YMQA 2RB5A 1T9ZA 2YFYA 1ZD5A 2JAUA 3NANA 1CR6A
chains in the Genus database with same CATH superfamily
5DZSA 3W2HA 4U9UA 2Q8QA 1NUSA 2KBFA 2G71A 1EFTA 1RQGA 2GVDC 4RWZA 5AJHA 1O6BA 1IDOA 3NYIA 2ENUA 4LZJA 1NG1A 5ALZA 2VZ9A 1NXTA 3FCEA 3SHTA 1TQ6A 4HLQB 2VK4A 2XUHA 4M8LA 5LM3A 3DGEC 4DSNA 3IMEA 4QM6A 1T10A 4ZHQF 5A2GA 2LVBA 2XKAA 4RGYA 2YBEA 2YYZA 4KK4A 2QUZA 4IV0A 4YP6A 4AJ9A 4C22A 1Y63A 5HK8A 1G18A 4NYIR 3ZCRA 3FLEA 3IVAA 1W4AA 1QHFA 4J0HA 1GYRA 1ZRNA 4QAQA 3R6TA 5T6MA 4LYJA 3IEVA 1TRKA 2OD7A 1KMNA 2BF7A 1WVIA 3F5SA 3GGCA 3TAXA 5SZJA 2WPDA 3W90A 2JBAA 3R09A 4NCJA 1PQUA 5J47A 4OAQA 2V0CA 1PJCA 1EI9A 4PSKA 1A9YA 1DCMA 4RMIA 2G72A 2IYVA 2OCYC 1G21A 4ZIRB 4UMDA 4UARA 3ICOA 4OXIA 1Z0IA 1F38A 1CDEA 2PM8A 2Z5FA 4LSGA 3KVOA 5BSFA 2FETA 1CUGA 1L7AA 4RZIA 2F1KA 2ZJYA 3JSAA 4POAA 1C9DB 1LB1B 1J2RA 1XWWA 3NHMA 5CNMA 3DBLA 2O1EA 3BF7A 5MHTA 1W4ZA 1WXEA 4QBFA 5C7IO 3NIFB 4B80A 1FW6A 2I6QA 5JZOA 2PXAA 4RVCA 4OHFA 3AETB 4YMGA 5KNDD 2O8FB 4M0EA 2GPNA 3R7WB 2WTXA 2ZRFA 2ACVA 4FOPA 3MWFA 3PPVA 3SM9A 2PUAA 2F8LA 3DP7A 4XOIA 2SKCA 1Z7WA 2NADA 4CKCB 1OT5A 3ZI4A 2DECA 1XXHA 4XWGA 2QL7A 4RJTA 1Z0FA 2MT9A 5CDHA 3OECA 3RROA 3MB8A 2WFLB 3DYVA 1LBQA 3P45A 4B4UA 1Z29A 1ADGA 1G8JA 1YJXA 4LZLA 2EV9A 5CD9A 1L5HA 1JN0A 1SUDA 4IV5A 4PG6A 3BQMB 4D7AA 3SJUA 1T6XA 3E4CA 3DCYA 4W99A 3OQJA 4LA4A 2DTDA 5I6DA 2AS0A 5KJEA 2DSTA 1NM5C 2RGCA 3RIHA 1Z06A 3SC4A 2DH6A 4AURA 4Z3OA 3JCZA 1E94E 1TM7E 4PR0A 2Z4TA 3GUZA 4HZIA 4EW1A 3G59A 4RA9A 4TWAA 3OMXA 4V1CB 1X13A 4J7AA 3H87A 4D8YA 4UTZA 1FLAA 3OSZA 2M98A 2BGLA 5FRDA 3GJRA 2V59A 2BRUA 1A8HA 2JGDB 2X8WA 1U9CA 1X7HA 4XQGA 3W9YA 6LDHA 3IAAA 1G8MA 2Q9AA 3K7EA 3MJHA 1DIOB 4G5RA 5DVZA 2GXUA 5C80A 3PVSA 4HDSA 3CLTD 4N12A 1ISRA 1M5UA 3I3SR 5I9BA 3OJCA 5KC9A 1C3EA 1XVVA 2IIVA 1OX4A 1E77A 1KJZA 1GRQA 2V7PA 2VHZA 3IH5A 1XG5A 4ZOQI 5KDDA 1CJSA 1P5RA 1WP4A 3KQNA 2R47A 1EDEA 1NHWA 4EQZA 1VTKA 3KBBA 3FMPB 1LXCA 1F4VA 5KNDA 3HI6A 5AHXA 3MCTA 3TSOA 5EZ5A 2FZVA 5HGJA 1TC2A 2BMAA 3A4TA 2JFUA 2YOGA 3K4QA 2Z83A 3I6IA 4HXFB 5KQMA 3RSGA 1C7EA 2PR7A 4M1ZA 2EFDB 4RA6A 1U3CA 1N6OA 2VHXA 3JD2A 4QUBA 4C4SA 1YNOA 2OXEA 3AQIA 3P4YA 4P36A 2PSDA 1DJOA 4M1QA 1ZK0A 3O4GA 1HG1A 5IAEA 1JDJA 4FCVA 1QZTA 4NAHA 4E2XA 3AIOA 2E21A 3KSBC 2XYGA 2R1TB 5CT8A 2IH5A 2XYVA 2H2WA 3QLUC 3M6XA 4B4VA 1WNTA 3H11A 2PRZA 1KBZA 4FMCF 7AT1A 2R8PA 4K6CA 4OLJA 4RPIA 1D6SA 2C58A 4C0AC 5JNWA 4UVEA 1DQPA 1C9NA 3T9CA 3ZLJA 4AYWA 1K2VN 4C4ZA 2EDCA 4EZIA 4LDAA 4JOBA 5ANRB 3D64A 1B2RA 1V95A 4NPCA 3RSZA 2I6SA 4JN6B 4OQMA 4WN9B 3REGA 2ZAIA 1PFKA 1PZXA 3O8RA 2YQ4A 5CYPA 2JJQA 3RPEA 4BYMA 1VGVA 2QUKA 2WU8A 2FW1A 4EVRA 1UBLS 4JGIA 5ECWA 3VKFA 3UWMA 2NO9A 1ZLXA 3M9XA 1ZC4A 2HC9A 4DR7B 2Z43A 5FKJA 1DKNA 1EX1A 2P3QA 3FFWA 4B7CA 3DE3X 4CFSA 1P4SA 3STHA 4HDMA 3UEOA 4A5SA 2NU6A 3OIFA 3U3RA 4EIWA 1VSQA 1GGVA 2YWEA 1T8UA 3ME5A 4MCAA 3EXEB 1UBRS 2X1MA 3IL2A 1ZU4A 4IXTA 1TX4B 1BSVA 2QTVA 3K5WA 3OFND 3OZIA 2FR8A 2HTEA 2QLNA 4FE7A 3WGLA 4I55A 1N2HA 1XCGB 1M34B 3SX2A 1D4ZA 1M1YE 3A7EA 3UHAA 1BD3A 1FNBA 1UPTA 2NW6A 1QXSA 2H2HA 4OMDA 2C3UA 3SHVA 3NHAA 3QMVA 1WV0A 1NJ8A 4JT9A 5K3FA 3UNXA 2PQ6A 1JG4A 3HMQA 4TLBA 3ZC3A 5JFTA 1XQXA 3THOA 2X9NA 1SG6A 4E7PA 3OFVA 3W34A 4YYEA 4UE6A 5AJXA 2NUAB 1E7WA 1GZ7A 3I52A 5ALNA 5HUJA 3C16C 1NC3A 2ZM5A 5EI5A 1B6TA 1KJ9A 3TDMA 3EWSA 1FX1A 2EIHA 1Y1QA 1BG6A 3K0FB 4E2WA 1Y80A 2HU5A 3H9UA 3RUHA 1XDBA 5DT2A 1XZDA 1NR1A 5E9QA 3HA3A 3MOIA 1ENPA 3VX3A 3EQ6A 3D1VA 3CM0A 3MXTA 4YAKA 4RULA 3W8DA 5CDGA 2XMPA 3WFJA 1ZO8A 2DFPA 1XTVA 4F0JA 1ZKDA 3HFSA 4E46A 1R0WA 3N86A 3JZDA 3GH1A 5CJPA 1LI7A 1GPH1 5FV4A 1Z28A 4PYNA 2ZAMA 5ILOA 4KPYA 2VSQA 4BKOA 1DMSA 5F4BA 4G4GA 4C2TA 1QCCA 1YI0A 2YWFA 2ZSBA 4GT1A 4AW9A 5JPCA 4RTRA 2PUEA 1MJNA 5H7XA 4D02A 5K51A 3QVWA 1A27A 2ODAA 4JU8A 3FTQA 3O8OA 5CIWA 1OFVA 2O7NA 2OZPA 4DREA 2ACEA 4DXAA 1TJ5A 5BUZA 1HPLA 3K70C 2WSLA 4UM9D 1IZ7A 3X1JA 4DFDA 2G3YA 3U26A 3EY4A 3C5VA 4NCXA 3HCNA 2MJLA 5JZSA 1P6QA 2B20A 2PT6A 4WXRA 2RD2A 3GG2A 3H9JA 4L4YA 2R6DA 3LJKA 5KNDH 1X86B 3GRVA 1H0HA 1G4UR 3I42A 1BEUB 1GPLA 1E5VA 2ZIUB 3PGA1 4TMKA 5GWXA 4NU0A 4PW0A 1VJRA 4W7HA 5ALRA 5EQTA 1XHLA 1J8MF 2W2PA 5ALHA 3HVKA 4QREA 2P9GA 4WY2A 2YUTA 2ZTVA 4GVLA 3G0BA 2XUIA 2G5TA 4RPCA 2DLNA 4N0MA 4PXAA 3LBIA 4FS8A 2FZGA 4L6CA 5EXXA 3VKVA 1QJ4A 1S4MA 3G1TA 2W2LD 1V8OA 4XDYA 3ZTYA 1MH1A 1YQTA 1T4CB 2HJGA 3M1YA 1S8OA 3SEFA 3C98A 3LHIA 1F2TB 2ST1A 4UTVA 2N1MA 1FFXA 5ICFA 1U2RA 1GYPA 3TLCA 1I2DA 2ZB3A 2BCJQ 2IFTA 2BRUC 3SLRA 3W4JA 1UOEA 1Q74A 1N7IA 1NXXA 1MX1A 1JTFA 4ZRMA 1T26A 2HIAA 3C3DA 3I04M 3F2IA 3KTOA 4U3JA 5DNYB 1JECA 1B8UA 3GMIA 4BC1A 2H4YA 2DY0A 2X86A 2YYSA 4ZCSA 2YFQA 4MV6A 5JD4A 3HFGA 3OD5A 1BJKA 2W48A 3ED5A 2YASA 1P61B 2A35A 4B3DA 4EHAA 5B3LA 4NRDA 1O89A 1GYQA 4X71A 1R9GA 3OZCA 3HZOA 5ALVA 1M2NA 4N3NA 5DCUA 1D4FA 1XFAA 4L5AA 4LC9A 5E9AA 2R7NA 4MEAA 3NRBA 5ECYA 5LU9A 3C8DA 4CKBA 1IZ0A 5T3UA 5B64A 1NULA 5DBFA 1C41A 2HF8A 3GT4A 3Q8LA 1PK7A 4E33A 3VU0A 1XSEA 2W8BA 3F98A 1MB4A 1Z3IX 4RKYA 2QR3A 3SSAA 4IILA 1JKJB 4L4UA 3EVEA 2HWKA 1XFDA 2H16A 5F98A 1INLA 4AF6A 4DLNA 4B84A 1H2FA 2ZJ4A 2V5UA 3ANSA 4NE2A 3WIOA 5CBPB 4F93B 5FT9A 1Z7GA 1XAJA 2W2LA 2V4UA 2XQFA 3L7LA 2GJKA 4PSDA 1KVTA 4KLZA 4OX9Y 3LCUA 4FU0A 4FILA 4BEVA 3AM1A 4WNIA 5GY7A 4QUEA 5BO5A 1IAQA 4UFNA 4JBWA 3RW9A 3OEWA 3DDSA 3BDIA 5ELXA 2QTWB 3EQ7A 5FI0B 3D59A 4R5MA 3WYBA 3VDQA 4BBZA 1T0BA 3EVFA 1PJLA 4CCAA 2X15A 3KTAA 3A4IA 4BRUA 2MYPA 3BBPA 1GTJ1 2PY6A 2WT8A 5EP2A 3ERCA 3BT7A 2QVYX 2YINC 3L8HA 4QHTA 4WERA 4UNSA 3MYRA 1NC1A 3WRVA 1WDWB 1ZNXA 3QOWA 4LRQA 3H16A 4Z0NA 2RHCA 1X7YB 3HM2A 3N5KA 1NVXQ 1E5QA 1V3TA 1A9XB 1G9XA 3B7PA 5JEDA 3M1AA 3I76A 2XTMA 2OGTA 1OLUA 1QHEA 3SYKA 5I4KA 2R4UA 5EZSA 2EG9A 1HEYA 3W5JA 2IVZA 1QF6A 3HGMA 3QLTA 4J6FA 1PV2A 3DEYX 3R5XA 1YU9A 4OHOA 2C2MA 2JFBA 2O0KA 1B1AA 4BXOB 5I7EA 1USGA 4X85A 1PT9A 3KLPX 3AB8A 1DKUA 3IEMA 5DI3A 3K53A 4DA8A 5J4KA 1NR5A 4C01A 2GHRA 2G25A 1EK1A 1ZD3A 2PPVA 2V74B 1V8ZA 3A3NA 1MPTA 3UN1A 3CQ9A 4LEIA 2F4VB 1WXXA 3X2EA 1IK6A 2C5FA 2HL6A 2PUJA 4P31A 4QBTA 1E6CA 5DNAA 3VYRB 4D8VA 4OYYA 3D81A 1JEEA 2IYOA 5CT9A 2WLSA 1CEYA 2I22A 1GPAA 4IZHA 1RWXA 1YF3A 3V97A 4ID3A 1GIAA 1VYVA 4M1KA 1V0JA 3AGPA 3OP1A 4HLDA 2QRHA 3NFRA 1HH4A 1AKMA 3COVA 4X6LA 1E2DA 5KU7A 3EDMA 3NDIA 3EFOA 5LP1A 5DM1A 1QYXA 4U0KA 5ES4B 2GJAA 1E2MA 2WQZA 1S6YA 3AUSA 3F4LA 4LV6A 4AUMA 3EDRA 1SY7A 5CEJA 4DUYB 1T91A 1OFTA 4B3FX 2EW1A 1NQOA 1R0BA 4CNQA 2P5UA 3CINA 1ITZA 3AF0A 5DMHA 5J4LA 3WBJA 4G89A 4Q24A 1PJRA 1W19A 2A2ZA 1ODSA 1HRKA 4FFRA 3PXUA 5IM4F 4JLUA 1ABBA 1M6NA 4IJ6A 4OQQA 4BMDA 2G8NA 2R25B 5BVGB 4W5WA 3WOHA 1L5LA 3ES9A 3HABA 4Z1MD 3GDGA 3GHYA 5EGNA 1THGA 1LQUA 1NJSA 4FD2A 5AKLA 3NC1C 3ZJTA 3E7PA 3BVPA 5HIKA 3KDSE 1EU1A 4HAUA 4Y0NA 2ECKA 1ILWA 1PS9A 2XE4A 1FUKA 3GELA 4JSTA 4AMZA 3PDHA 3WGVA 1VRCA 3JRWA 1EFHA 1QRTA 3FY4A 3NYWA 2WTUA 1MT3A 1PBNA 3X1YA 2FOXA 5B7QA 1PNOA 4L16A 1IY2A 1M2HA 3DW3X 4H1UA 4WZBA 5TDHA 5DM60 1YVPA 3U6KA 1OV6A 3MLEA 5JBQA 4FFMA 4A1OA 5JQGB 2BHTA 1XZIA 2A9QA 2JIDA 1GUDA 1G3UA 2EIXA 2A33A 1WUKS 2VT7A 3MCUA 4GNRA 3RAJA 3L6DA 3TIVA 2ZYDA 1I4OA 3QTBA 5HXAA 1JHVA 2HAEA 1YOBA 3CX3A 3SBOA 1A9OA 2VDOB 1SIUA 1HDIA 3K9BA 2GM5A 3GAMA 4A0RA 1GZ6A 3QSGA 4HYEA 1DKQA 3LZ6A 1V2HE 3FI9A 3NBAA 4YRTA 1F5NA 1V5IA 1JG6A 2VUSA 3E9RA 3I9MA 3MCAA 3G0IA 4KQMA 4ALIA 4M9CA 5JIBA 2J9XB 2RMKA 1CRPA 2QL6A 3ICEA 3MELA 4DCJA 4HBGA 1UDXA 1PVDA 2IBSA 5HX7A 3MTGA 4B40A 1II9A 1TPYA 4QELA 1ZH6A 4EJ6A 5FL7A 1KRXA 4RXMA 2VHUA 1QZ3A 5H3HA 4DCGA 2RAPA 4O2BF 5AW2A 2VDQB 3QBDA 4FMBB 4QUAA 5C81A 4Z1MA 2P2DA 3HR7A 3R6DA 4U7TB 4X3OA 2WBLC 4MGEA 3B3FA 3R0VA 2NUPA 4O2RA 4ESEA 4TWJA 4EY6A 3T1OA 4UEQA 2CVQA 2DH5A 1YMQA 4K86A 3MUNA 5F12A 3R74A 2C2OA 1T6NA 3PQ2A 4AG6A 1T0JB 1E3EA 4BZXA 3C6QA 5HKBA 1KTIA 3F1LA 4IRMA 1VKZA 1CUVA 2Q3DA 3BGOS 3OIWA 1RJDA 5CA1A 2B4RO 5M5BA 1XZHA 3V00A 2JBAB 1I1OA 1XZLA 3WGNA 3GFSA 3OJLA 2GCEA 3PC2A 3C3WA 3ZEIA 4E03A 3QVSA 5MF6A 1G21B 2VDWA 1TIPA 5ALDA 4X93A 2Y0PA 2V5VA 4URWR 1JLLA 4R8LA 2ZYWX 5CAEB 4ZQIA 1SOWA 3BMQB 4DCTA 2VNHA 4KW7A 1Y33E 2ZRLA 4J0EA 5CW1A 1BMFD 3DBLB 1QUEA 2QN8A 3MRSA 5EZYF 3TQFA 1Z2OX 1B42A 3K70B 4Z1OA 4CF5A 2I1VB 3HN2A 3LGXA 3LXMA 1GU7A 2XGSA 2Y76A 3Q3EA 5ICEA 5IJ0A 3JTMA 4ES6A 3FNGA 1YDMA 4XGQA 4RTNA 3QSYA 1U6IA 4IDNA 3K1AB 1AZLA 4BRZA 1HQKA 1SHLA 1TOAA 1XXHB 1IY9A 3AFNA 1AE1A 3P9YA 3Q2KA 3UTCA 1DT5A 3BEOA 1L3IA 5TJ9A 1RT9A 2BMFA 4ENUA 2UAGA 4YR9A 2HNKA 4JX8A 2CMFA 3RLIA 4N6GA 1WB4A 4DV6B 1ZVKA 1WKVA 1L5HB 1V8DA 1J5XA 2J9GA 2MOKA 2YV4A 3MJSA 2OZVA 1AGNA 1YS6A 2IOFA 4NULA 3B48A 4N65A 2B5OA 1DV2A 1NFQA 2WWWA 3U81A 1G4AE 4CYMA 3FOCA 3N2EA 5DI9A 2CBXA 1T2NA 4RA9B 4WACA 4E3WA 1JAIA 2ZUUA 1B00A 4IIJF 1Y3FE 3R3VA 1QIHA 5B1EA 5KYVA 3C41J 3UGTA 1FJHA 1V3VA 5FFFA 1YFLA 4IV8A 2D5IA 4KUEA 1EG2A 4K9OA 1PGQA 4FFOA 2R751 1GAQA 2BTQB 1N5OX 4HDSB 3RIMA 4TS9A 4L4SA 1I01A 3HLYA 4MLZA 4C3OB 3EZ6A 4EUEA 5CBKA 4WEQA 1NBOA 3F6EX 1NT2A 1W2GA 4MB6A 3NHFA 5DULA 2J7KA 3UAWA 1X8KA 3I61A 3DWFA 3W9SA 1DWPA 3UJNA 4IUBS 1ZOLA 2H0AA 2OB2A 3PQ5A 2QK4A 1X0VA 2BEVB 2AZDA 1CRLA 1G8AA 1RCUA 2GVNA 1GEGA 3NAQA 2JI8A 4B6EA 1R7RA 1Q84A 4EG8A 3B3GA 4Y2JA 5FA8A 4NBTA 4KYTA 5A5FA 4RA6B 2CLLB 4J6EA 5TJHA 1TGYA 5L45A 1A3CA 1QV6A 2A57A 3ELDA 2EJBA 3SDBA 3QPAA 5JXGA 3ILVA 4Q16A 4LZOA 2FN7A 1UPUA 3E4DA 2CCKA 5B1IA 4BGEA 4CNBA 1CK4A 1FVOA 2QT0A 3ADOA 3E70C 3OU7A 4FGJA 2CJFA 4RACA 3H04A 5AM5A 2C3YA 2ZJ0A 3H11B 4Y8VA 1SR8A 4IQ8A 4V0OA 2ZIAA 1VJGA 5ALQA 2HSGA 4CCSA 3UB4A 4MQ6A 1NJ2A 2Q2NA 3DFZA 3UMBA 4E1AA 1HYEA 3RJTA 3S99A 2X7JA 4P53A 1UC8A 4ZOLB 1SAYA 3RANA 3UENA 1XMJA 3JALA 2CV2A 3EMDA 1FC0A 4MJXA 4ML3A 1OX5A 1RKXA 1RPJA 3QKRB 4JP8A 4K9DA 3VSDA 8GPBA 5AOCA 3OCXA 4PYLA 3HNRA 4H6WA 1ZL0A 3TTYA 4QUDA 3R0ZA 3R44A 1FS4A 3IB6A 4HFRA 5IP5A 1Y48E 5JZBA 3Q11A 3D2CA 2VHJA 2AYZA 3FHJA 4HDMB 4UMVA 5IMBA 1YSCA 3P4UA 4EATA 2J33A 2NU6B 1KYYA 1PW5A 3AGQA 3LPLA 2YOFA 4XFDA 1IYZA 4L0DA 4L27A 2EU8A 4CDMA 2CVFA 1D6NA 1D0IA 1SHKA 1V1RB 1EBFA 1SBNE 3BJIC 3GFBA 2G7ZA 4I55B 3GDHA 1QHXA 4L9RA 1Y8ZA 2JRLA 4G4JA 3OE5A 3EIOA 3H4MA 3GIDA 5F7XA 4ETWA 3G2IA 5K3FB 4Q3OA 1ZDMA 2GXQA 3A6ZA 3K94A 2FMFA 2BZSA 4C4TA 2WKRA 4BCBA 1RC1A 3ORHA 1JDNA 2QPLA 4EGAA 2C84A 1TRHA 3FRHA 5HBRA 4BV3A 4IDQA 4XW2A 4MUJA 5HPYB 5KU1A 2VJLA 2Z1MA 2MSKA 2ZR7A 2G77B 1LBSA 1OY1A 1T3HA 3C43A 3CVJA 2IYAA 2JGFA 1QYWA 4YJHA 5K2MA 4NESA 4DMGA 2QVBA 1EK5A 4EB8A 2ZW9A 4YFVA 3WL3A 4FM9A 4C76A 3DDHA 3BILA 3MPUA 4MWBA 4UKDA 4KWTA 5KHOC 1F3LA 3QWIA 3STTA 3KQKA 2ZJ2A 1W6RA 1ZGZA 4HF7A 4KN9S 4FQ7A 2K5UA 2XQGA 1F14A 4ZEOA 3ZWPA 1SPBS 4QOIA 5CJ2A 3OOWA 3P20A 4QTZA 3KQOA 4AJOA 1Y3IA 1FU8A 1BYIA 5JYEA 1ONSA 3O1JC 1ADFA 5IF9A 1VMEA 4YAFA 4RV5A 5DXJA 2KYRA 3D4LA 5DW0A 5ICMA 5GJBA 1GNVA 1FQOA 4URXR 3GUUA 3O8OB 1T1GA 1CZRA 1PZEA 2OHHA 3KJEA 4A36A 4D9MA 1XE3A 4OU5A 1J00A 1X87A 1WCIB 1JHPA 2CLSA 3GF4A 5K8JB 2BN4A 2Q7XA 3CGGA 4G5FA 3DHYA 3EGCA 3RTDA 1F06A 5NLLA 4MB0A 1OI3A 4ZI7B 5IK2D 4UTOA 5LQAA 1Z6XA 1P4AA 4M1TA 1L3BA 1DE0A 3IMCA 3KS9A 5B6PA 3R75A 1Z75A 3DAYA 3SX0A 4WJZA 3EZFA 3QVMA 4J4BA 4GP9A 3NGXA 4BKPA 4W6QA 2IOHA 1KPIA 1EBBA 1JHUA 2OP0A 3IJRA 2I4TA 4OAOA 5JH7F 1M0TA 1NJGA 3KQHA 1E1LA 2EEPA 3Q6IA 2QD5A 4RPHA 1ESMA 5E0OA 3H1BA 4R6WA 5CLQA 4ND3A 3VDMA 3OOJA 1B41A 1NUAA 1QHIA 2IY9A 1U0LA 3D7MA 3H05A 3T1NA 2I4OA 3WKDA 1KR5A 4E5SA 3ZVMA 3KZ1E 4BTVA 1SCKA 4UHEA 3MZ0A 3NPAA 3PX7A 1RYDA 5EJ5A 3HBNA 4HTFA 5FNVA 2FPPA 2ZYIA 1FFXB 2VQEB 3RU7A 2R6CA 3FIJA 3CKYA 4JIGA 1D09A 1GPKA 2BGRA 5LZ8A 3MGCA 2ZU6A 2JFVA 1TA0A 4LWOA 3D5EA 3ZHXA 1OAOA 3G8YA 3OD1A 3IAHA 3FTFA 4U3JB 1R6AA 4N8DA 3SZOA 1P80A 1XKLA 2ALJA 1Z5ZA 1XVLA 5F7ZA 5BSKA 1FMFA 1GSHA 3P96A 2NYRA 4PCVA 3UGQA 1Q7GA 1QG6A 1KOLA 4KJXA 1BJTA 4XDHA 3CISA 3NTQA 4K40A 5J59A 4RIHA 4EYSA 4K9KA 5JAQA 4E6PA 4M7WA 1T5TA 4H1WA 4ZCIA 4I5IA 4MWGA 3IPYA 3B5JA 1UC4B 4LQ4A 3WLFA 3UJDA 3K0KA 3L4KA 2E1RA 4BFWA 4CKBB 1F2UA 4FFDA 4JXXA 1XNRB 2QDXA 1RP7A 2XNDD 3ZD6A 3LO5A 1W85A 1WXFA 3WIDA 2W8BB 2BFWA 3FHOA 2JLRA 1YRQA 3OLWA 4R1OA 2HA6A 3LFUA 8ATCA 3SQOA 3L0DA 5D5HA 1LVHA 5HSGA 5JDIC 4HFNA 4J2OA 3CG0A 5BQ5A 3P27A 3V4VB 2PQ2A 4DIEA 3EVNA 5KOJA 2FX3A 3S3TA 4IDBA 1IB0A 1XIVA 4AXXA 3PD7A 3LF1A 4FUTA 4XKJA 4DDHA 2QYHA 2QTMA 5A2QA 3KQUA 5FOTA 1NBHA 3MTDA 4BNWA 2WKQA 3RB8A 2NYUA 4IQ4A 3TRIA 2YVLA 4PYMA 4RPLA 3WY9A 5LUAA 5KAMA 1KSGA 3FVRA 2GM3A 3IVCA 4B3JA 1P4GA 5BPHA 1ZGAA 4FCTA 1OR8A 1BS2A 1YXMA 1RWWA 2CL7X 4H7DA 3ZDAA 1OU4A 2VTDA 1DGQA 3FNEA 3PUKA 2ZUEA 3RSLA 3PEYA 1PZGA 2QU8A 3FNBA 3LPNA 3RBVA 4N9WA 1UKBA 5KWSA 1NVKA 1BDJA 1T1RA 2CSUA 2QD4A 4HB0A 3KTAB 3KVYA 2TSYB 1E7MA 1AT1A 1G0OA 1XTZA 3DZFA 3UUEA 3C7TA 1RAGA 5TS3A 1MEEA 3HZZA 2OFFA 4ZA2A 1ZNYA 4HS4A 3HCEA 5J63A 1EVZA 2HCRA 3W4IA 5LZ4A 3KYBA 3FBTA 1H69A 4YRNA 2FF5A 3BIFA 5J3JA 3DA8A 1P19A 4NCAA 3SYLA 4PNHA 1OLUB 1XZPA 2GFHA 2IE8A 4HQRA 4MPRA 4RV4A 3BQ9A 1RAIA 2H2IA 3UK0A 2NQTA 3EXAA 3LUAA 3NIDB 1E79D 1Z5NA 3A1UA 4XRGA 5JC8A 4EUNA 1Q0HA 4N7RA 3L6RA 3SF8A 2IYEA 4PBTA 5ULLA 4B6QA 4CMGA 2A0WA 2GYWA 2IPLA 3TLGA 3ZZMA 3ZWDA 4WLNA 5KAPA 5H1YA 1UBUS 4QYWA 4X7MA 3T7CA 2BYTA 2HRCA 5H0IA 4TL9A 3HSYA 2GAOA 4A0GA 5LDDC 4KZPA 1Z6PA 2XUGA 3O8LA 3GPDG 1LV8A 2Y6VA 4NBSA 2P8SA 4ZRDA 1Y8QA 2VUTA 5B2FA 1G7RA 1LVGA 1OB5A 1PX2A 5KYUA 1FJXA 2AH5A 1H5NA 2J6HA 2H1CA 4RFSB 5HK9A 5CLFA 4TV9F 1V71A 3VDRA 3PXCX 2HFKA 2I80A 1AKWA 4YRCA 4CTKA 3A9UA 5BPFA 1C4WA 3A32A 3HA2A 3QPVA 1JFFA 2X2OA 4QPPA 2XRFA 4LG1A 3QJYA 4OFXA 3ZNPA 2P9QA 3S1SA 4RTJA 3AFIA 2QV7A 5JPIA 5CX4A 5FTNA 3HCOA 4DR6B 1AURA 4TKZA 2W4IA 5LXTA 1NNSA 3DTTA 2RGRA 1YAJA 1JKXA 1IC6A 1V6AA 3CVYA 1JPVA 1NW6A 1JTEA 1RRPA 1Q7CA 3O03A 4D82A 3FNRA 1JR3E 3GLIB 4BB6A 2JAWA 5AVJA 3D8HA 5GADl 2TMDA 1VFNA 2NQ8A 2Z09A 3G9XA 2OP1A 3M4YA 4LK3A 4QRIA 5EERA 1ZK3A 4BNXA 1RM5A 2XEDA 3JWHA 2FSFA 5FADA 3ROKA 3ECAA 4YQFA 4ZYVA 2FSHA 2WJPA 3PHGA 2Z2JA 3VR1A 4E13A 1KJYA 1U9IC 2JFWA 4JIMA 1QTNA 3HB1A 3OX1A 3CLHA 4GOMD 3VR2A 4L5BA 3NORA 1E79A 1QM5A 1VBNA 4D4KA 1G3IA 1ID1A 3Q7IA 4BJHB 3NVMB 4HL6A 1E3DA 3Q7QA 3TPZA 4CIDA 2NG1A 2CV0A 4B3TB 4BQNA 3IPRA 1CY7A 1L1QA 5E6SA 1JBKA 3BGIA 3MRXA 1XPOA 2XOXA 4LQLA 4WZBB 1E2GA 2DULA 2O1WA 1ZZGA 3Q7TA 2VF7A 3HYNA 4QATA 4QDTA 3QG1A 5EHNA 1W581 4NU6A 3BPSA 4TX1A 1E2BA 2BFBA 3PIIA 1ATZA 5DGCA 1T13A 1Y9ZA 1Z5OA 1RLMA 3W5UA 3H6KA 3PF9A 4WKGA 3F3YA 2AOWA 3BZBA 5AVWA 2UYCA 4NLLA 5C52B 2CWDA 1EWKA 2P1ZA 3KEMA 3W6ZA 4F85A 5EJ8A 4PNEA 3P9ZA 3U39A 1YMUA 2AB0A 2WE8A 3K96A 5FLEX 4ESOA 5JANA 3GCZA 4HQLA 3MJCA 3EPPA 4WXEA 3WKEA 1DELA 3GH3A 4A0SA 1OAOC 3CONA 5EQFA 2WSIA 2UVQA 3T06B 1E6KA 1ZH0A 2ODWA 1S96A 1G5IA 1E9SA 4G2TA 4DQXA 3GGGA 3IEKA 5C34B 2NPFA 4JFRA 4DQUA 3RGGA 2NOAA 4K03A 1QDUA 2W6CX 4NC9A 3NUGA 2J87A 2EKBA 1F17A 5HVNA 2JHFA 5H70A 3B1VA 1JL3A 2B1RA 3S2UA 3W2EA 3PFHA 1ZD2P 2GVZC 2NUPB 1VSVA 4JASB 4II2A 4WXMA 3ABQB 3Q1LA 4RGVA 4XH9B 5EMJA 1N8NA 4ZXPA 2HHCA 4V24A 1Z0UA 4CV3A 2G4CA 3O75A 4NMHA 2FK8A 1PT5A 1WMDA 3GZJA 4MRSA 2WP0A 1Z07A 2Q3MA 2WJ3A 2E87A 1TTQB 1VL1A 3K16A 4YJ3F 3HB5X 1I3OA 4NH4A 5GZ3A 4II3A 1A4UA 5DRTA 1T2CA 3SHWA 1DU4A 5JAOA 1C4KA 1ODJA 2VDWB 5AM1A 2DXIA 1E2IA 3TNFA 1L1EA 1JLLB 1YJQA 2HWWA 4FEAA 4RKQA 1B1CA 2VSYA 1W9MA 2FEOA 2PUVA 3GWGA 2ZJ1A 4XOUA 2YZ2A 4W5TA 1NBWB 1NQAO 4YMIA 5DRYA 1QO7A 2C78A 3E15A 3TCXB 1MRZA 1J20A 1JXAA 2VHTA 4K2HA 1Z17A 4YI5A 2VTEA 1O8CA 2H51A 4S0XA 4P4SB 3UKDA 3OHMA 2VUHB 4EFMA 2WIFA 5JASA 4UPVA 2WKSA 5IJ0B 4AUNA 4AMGA 2IS1A 1CEQA 1CV2A 5JYBA 2MSDB 1I94B 5KNCH 2IITA 2PL9A 4MICA 2O8EB 5HEKA 2XT9A 1C0PA 1CQZA 2LKDA 3ACDA 4KYVA 3ZWXA 4AUEA 1S0UA 3ZEAA 3M6LA 5BWMA 1A2BA 5JCOC 3PPYA 1WW3A 4IOJA 3KXDA 2WA2A 3M5PA 2G09A 4JBXA 4OSPA 4FZJA 3AH8A 4ZD6A 2OQRA 3VYSB 4M0MA 1YQEA 3QEJA 4CUJA 3DE7X 4PC3A 5BQFA 5CMLA 4IDCA 3S8EA 3EULA 3L6BA 2XRZA 3D6JA 4TTIA 1WSAA 1JAXA 3TNDA 1XVUA 4N54A 2PQMA 4BQRA 4D98A 2R8OA 3ZU4A 2ZTHA 4AX4A 3LSYA 2GBPA 2PSHA 2QRUA 4EI7A 1Z2PX 1ZJ4A 1O6GA 4ZT7A 3X2SA 4I1SA 1V8PA 1VPTA 3U62A 2Q0HA 3SDSA 3ZNQA 1S2LA 3P97A 3ZV6A 1ISGA 1J8VA 3VISA 2X9LA 5EIBC 5LKAA 2PS3A 1G3QA 3BMCA 3MS2A 3E0QA 3OQOA 2XTJA 4CLRA 1AHNA 1E58A 1MDBA 4MA0A 2PA0A 4ND1A 1OVGA 3MHTA 1CF4A 2BM1A 3Q7RA 4QDZA 4Z3KA 2Z9CA 5L4NA 1JE1A 3ZU6A 5F7OA 1FQJA 5I8PA 1AKQA 1IEQA 2B0CA 2P9HA 3SZRA 3UWKA 3OE4A 4PSCA 4DRYA 4LX0A 4US2R 5IT0A 4ONEA 2XY4A 1IN6A 4IYJA 1P33A 1VCMA 2NXJA 3O2SB 2P9TA 4GOND 4QRDA 2CLDX 1Q0UA 1J25A 2AFHE 2ODPA 2Q5LA 3EUAA 1YA4A 2HT1A 3VHRA 4A03A 4PO8A 4EQ6B 1PJZA 2ZPAA 5DU2A 5LWQA 1Q50A 3ZBQA 3ODGA 2WHPA 1E1DA 4N0DA 3G9UA 3UMCA 1P60A 2XOEA 4A6PA 4NI5A 1QFMA 2HHLA 5D2CA 3E23A 3EK2A 4RHEA 1ORWA 4IIXA 3UHFA 2GFIA 4MW4A 4TVKA 4ZCPA 2L82A 1ZJYA 4H2DA 4P3PA 3BXEA 1FP4A 1ECBA 2D1RA 2GZDA 2VCEA 4KFSA 3DVRX 3F7OA 4L4RA 3UPDA 1U3FA 2QJWA 3EAFA 4G4IA 4I4CA 2EARA 3JALB 1W8IA 3OIYA 1GTL1 3OJWA 4I8IA 2ODBA 5HIIA 3ZKWA 4ACBA 2Z3WA 3KDPA 1ZVMA 4Y6SA 1DJNA 5D3QA 5CB4A 1A50B 1M0EA 3G6KA 4AAYA 5JLJA 3A9RA 3W79A 4F5EA 3EC2A 5EZ6B 4L57A 4NSNA 2DF8A 1NATA 4RQUA 3ETHA 1H2AS 5EWMA 1I1NA 4RCZA 5L3QB 4BY9E 2D00A 5AK5A 1JSLA 5EJGA 2Y68A 3OEHD 1TYEB 3EJWA 3NHYA 1AZWA 1GQ2A 3EXG2 4WOJA 1OZ0A 1YC5A 3V7YA 4Z2AA 2MYUA 1RPZA 2X9GA 2RK4A 1XAGA 2AD1A 4L6AA 4TTQA 2C2WA 5D87A 5I7UA 1BGWA 4OHPA 4QVIA 1L5OA 5LA6F 2P6RA 1J4AA 1LDYA 1I7LA 1WF6A 1BWSA 2AXNA 4KWHA 3J81A 2H1IA 2IDZA 2PFSA 2WJWA 2QE6A 1SCUA 2XUAA 3A1DA 3JZAA 2NXNA 4MYUA 5FA5A 4BNIA 4DJDC 3CRNA 5EIEA 2OYSA 3D4NA 1QVRA 1NJ1A 1ZNWA 4GX0A 4JLPA 3VX4A 1DRUA 2ZULA 3Q0EA 3OX3A 2XV1A 4QXAA 4YJHB 3AO0B 4EHDA 1ZONA 4M9SA 4DWOA 2P35A 4G8BA 9GPBA 1NBIA 2FA9A 1ZM2A 4UD6A 1TYAE 1PQPA 4UM8B 5BR4A 4JI0B 1N2BA 3UAXA 4WZAA 2FMUA 1M5RA 4BP9A 1BQ3A 3BD6A 1A2QA 1QAQA 1XZCA 2JJYA 5KX5A 3HJRA 1N9ZA 4JQZA 1Y4ZA 1WY5A 3PVCA 4AY6A 2H57A 1U2GA 2H65A 4P3YA 2WIAA 3PNLA 5GVRA 2FFQA 4QPZA 3IR7A 1FZTA 1QBGA 1QANA 3MTIA 4D1YA 1H9BA 4CU5A 1PHRA 4DLXA 1ULSA 1KAOA 1ZMRA 3FYTA 4BGUA 3LIPA 3RIGA 1WMBA 2YWHA 3SBDA 3T5PA 2O05A 3W2TA 5EUBA 4D0SA 1JA1A 1KFBB 3WDLA 1BD4A 2RGXA 1D6JA 1E0KA 2I2XB 3KLBA 5E1MA 3MMXA 2R11A 1MJGM 1OAAA 4Y2TA 1KZ1A 1JDVA 3VPDA 3NBXX 1NN3A 4JJIA 3L46A 2RHBA 3WL7A 2RK3A 2FSUA 5F3RA 4EFNA 4QPNA 2LUOA 3T1YB 2JGJA 2GGSA 3KZVA 3LDFA 2C9BA 3NASA 3PFFA 3RAEC 4F3NA 4Z8XA 1Y8AA 1WG8A 1JEQA 2VATA 2OORA 4DSTA 4B3IA 3GNQA 2L18A 4OF4A 1T4MA 4XSVA 1E4VA 3R3UA 1F4PA 4FKBA 4O3FA 2BUBA 3PQ4A 5J23A 1EHCA 1R0KA 4BATA 2ZLBA 1N8SA 4EJSA 1DHTA 1V5EA 3ESBA 2VP9A 3BAZA 1A95A 2OA0A 2N42A 2JLAA 1E64A 1WXWA 2JPDA 2P1RA 3O7WA 1TM2A 2J45A 4OHWA 1N9GA 4L9AA 3DE2X 4XD7D 3GJTA 4Z2YA 5KSZA 1F7UA 1EE2A 2P11A 4YJ2A 4A2QA 2G1JA 2X58A 3AESA 3T7JA 1K27A 1RWMA 3OTGA 1DX9A 2XWSA 4PQFA 5F76A 2NSYA 3D4PA 3HZRA 4P93A 4R8KA 4BCDA 4X66B 1ELOA 4CR8A 3QJGA 4Z7NB 2AVDA 3FOWA 3PZBA 5B3AA 3U7JA 3WBFA 4F72A 3GJ8A 4HTFB 2P91A 2FPPB 3BWCA 2FWBA 5FNVB 3UJ7A 2ZB8A 3DFFA 3N0XA 5YASA 3NVKI 4IIYA 5G3ZA 4U7DA 5ICGA 1VRVA 3IUJA 1UDRA 5TVGA 3J81k 1T5SA 1SXGA 4NARA 3O9MA 4YP9A 4AKIA 1ORDA 3RS9A 1EVEA 1KRWA 4YT2A 4CWAA 1QFSA 3Q4GA 3OLYA 2FI1A 4HAXA 5DX1A 3WV4A 3FCCA 3N2LA 4YWJA 3F4BA 1LBHA 2G6TA 3SY8A 4LMBA 5JY1A 4E70A 3CUUA 4L7VA 4KU4A 4KRYA 4RXTA 1A96A 2XCLA 2Q29A 2RGBA 5CFNA 3V7UA 1ECLA 2NIPA 4FC6A 2LBPA 4UW9A 5CXXA 3AHHA 2Q2OA 1GTMA 3FKSA 3ACCA 4UUBA 2O52A 2VFAA 3QEKA 1F2UB 1DTSA 1Q1ZA 2PEYA 2BMEA 2GK3A 3K3PA 1W85B 3WB0A 3UMGA 2GZSA 1R74A 2AKEA 1PHPA 1W1UA 4MULA 1M2EA 1YRAA 1I4EB 3DHVA 3MT0A 2PSSA 4H0CA 1PT8A 1I2ZA 2YWJA 4XD7A 1NVFA 3ORFA 5KOJB 2VK2A 4R2HA 4AJ1A 1XCLA 3H8VA 3GLFA 3AYZB 3EPHA 3MB5A 3N59A 4M1SA 5JDCA 4QPCA 4C5CA 3DZKA 1A9QA 3LOUA 1SQFA 3ZY6A 5BMOA 3E9QA 5GIOE 2OGSA 1K97A 3QFSA 4NZPA 4PPQA 5E8JA 4O2AA 2IKSA 3U7HB 5CUQA 3RGWS 1BWRA 1MT0A 3DFKA 3SLGA 2JG3A 2EWWA 5I7HA 3H3JA 2WD8A 3WS7A 3DWGA 3FMIA 4JCOA 1K0UA 1IM2A 1L7NA 5IPFA 2ZSDA 3PI7A 3QVLA 4MX8A 2GSDA 2Z2XA 4PNPA 3NO4A 3FLBA 4PXYA 3WKAA 2Q0QA 4JELA 4FB4A 2AMFA 5C35A 3PLAE 3HFRA 1QZXA 4H4CA 1U9JA 4HXGA 4M55A 4YCJA 4CVNA 1IG0A 1R0SA 5LZ5A 3R7LA 4JGGA 2HRDA 3ONFA 2PLNA 2ZDHA 3AFOA 1RVDA 3URKA 2O59A 1D1PA 2GASA 2ZJ8A 3WNVA 2JCVA 1XRJA 3EIFA 5CYGA 1RIIA 2CVOA 2P4SA 3GK3A 3I2GA 4TTJA 1YC2A 5EHIA 2HW8A 3IERA 1DSSG 4JOQA 2PK3A 2JIOA 3AILA 1QOZA 1T9CA 4S0ZA 2EZUA 4Q82A 1DBIA 4UE3S 4PQYA 3P7MA 1CDDA 3IS3A 1OX6A 5BNFA 2HD4A 2NO6A 4BV2A 1CW2B 2QNBA 3DTVD 3KO8A 2YWRA 4GGOA 4FQ8A 1EK2A 1EUCA 3R0IA 5ALLA 1CY8A 3TLGB 3ZHUA 4EHNA 4DNXA 1GSOA 1MAUA 2ZG6A 5C3MA 2W42A 2V98A 3SEQA 2WD7A 1U8ZA 4YP7A 1JMVA 1GUYA 1EA5A 1JG1A 5DEOA 5HDQA 1P73A 2A6PA 2FW8A 2ID4A 2ZI7A 3NBFA 4LBZA 4TYQA 2X6TA 1ZJ6A 4RM2A 2QP3A 1KEKA 1WMAA 1U2GC 2PJUA 1KO5A 2BY4A 1GUBA 3OESA 3FDZA 3HJUA 3OIUA 2CFCA 4PFKA 4TMXA 1U28C 1W0JD 3DR3A 5KWIA 4EELA 1L8XA 3HHEA 1FQKA 2PKEA 2HDHA 5LXTB 3S68A 1EA7A 3HDQA 2DWCA 1GKKA 4PWYA 5KYKA 1XVAA 3BL5A 2I76A 5FDFA 1TEXA 5DH9A 1Z88A 3RUAA 1NOKA 3VU9A 4L78A 5ADUS 4RLSA 3NBZC 3PWSA 2ONCA 1BZYA 2XTNA 3ILSA 4HNVA 2ZRPA 3AY3A 2PT7A 3N07A 4ZVUA 2ZCJA 3NKVA 1ZHHA 3F7MA 3ORRA 2E49A 2OORC 4Q4LA 1UXJA 3EVBA 2QUAA 1JQDA 2M6RA 4KQCA 1JKMA 4QULA 3TQQA 3QYPA 3KETA 1SUIA 2OV8A 2DRIA 4YRDA 3RUEA 4MVXA 3VR3D 4EJSC 1NBAA 4ZO7A 2GUWA 4H7KA 4BUZA 3SK0A 4AYXA 1G8KA 1TFUA 5E6SB 2W70A 4N3CA 2CW5A 1XMPA 1W96A 2AHRA 2O7VA 1B93A 3CMMA 4AM8A 2PPLA 2OOKA 3GFFA 3VI3B 3FWNA 1H23A 3H4VA 2BFBB 1L4GA 1W59A 3SE0A 1N1DA 1XDZA 3UHPA 5KS2A 4IGEA 3UUFA 5I4CA 2QWXA 2ZIVB 3H5OA 1A69A 3TZBA 1KEWA 4D9GA 3TW8A 1MNAA 2YXEA 5JEEA 2EBUA 1SU8A 1VJ5A 3BM5A 4PHTA 3CCBA 4XR4A 4Z9FA 3AVWA 1BCRA 4ENWA 1JIXA 1DNPA 4DHEA 3GEHA 4GYYA 3KPWA 5E95A 3JD0A 2XD4A 3E5MA 4JOCA 3KB1A 5ALSA 3N8HA 2JGEA 3RIXA 4A8HA 2O0MA 4QTYA 2OO3A 2ISQA 2PLAA 3UOGA 2FPUA 2DWOA 4X41A 1TJ3A 4CLHA 3EIEA 4A8JA 1OBHA 3A3KA 2IEZA 5EUCA 4FHEA 1S02A 4LRWA 1HY3A 3HY4A 2D8MA 2DTEA 4UEWA 3LPCA 1YB2A 1GPUA 2XB4A 3FZYA 5K3CA 5BYBA 2QX4A 2X0FA 3VPBA 3X2FA 2FN8A 2Y1KA 4GZ6A 1CUBA 1K2WA 3OEED 4M89A 4U9IS 5K0ZA 5JJIA 4NEGA 4ZC8A 1R5OA 5AKKA 3PDIA 2BBOA 5DISB 2ZRNA 1G6KA 4C30A 3EW9A 3VR3A 2C97A 3U44B 2C3PA 3TLYA 2CLIB 3I9LA 1GTRA 4KIGA 1BNCA 1OXMA 4HDOB 5KMGA 3OTOB 4DZZA 1TKAA 2GEBA 1GZUA 3GT0A 3PSAA 4IUYA 4Y7CA 2ZPTX 4AJEA 1M3SA 1RRKA 1I2MA 4KLAA 5TF0A 1KY5A 3CY6A 4YA6A 5C37A 1Q3KA 3PC7A 4X3PA 4B4OA 5JDCC 4B9AA 1MTOA 4FHZA 4IFBA 5CXUA 1E3LA 2P4HX 1XQWA 3I2YX 1ZD8A 2O54A 3ABIA 2VWHA 3GN2A 5HKLA 3L7NA 4CTMA 4HY3A 3VR6D 1MV8A 1Z39A 3C1UA 2A86A 3KHSA 3ZK8A 2DUNA 5JCZA 3FUXA 1ZR2A 1YB6A 2X8BA 1PD1A 3H5WA 2ZT7A 1RVV1 2ZYTX 4Q12A 4EECA 4CM5A 4GLBA 1T36A 1S8NA 1G291 2R00A 1IY1A 3NXSA 5EE5B 4EPWA 3ZLUA 4F56A 2AQIA 1F9AA 2VL7A 2WVJA 3A1WA 3WNDA 4S1VA 4LF6B 3T9FA 3RVMA 4GMDA 5F5XA 2PYIA 3D6MA 4NDZA 3WFIA 1D4AA 1SULA 3LCJA 1H1DA 4RL4A 2Z3VA 1FBNA 4DDKA 2YJ5A 5KNBD 5CT6A 5F3WB 5DLEA 2DKOA 4HMOA 4LMPA 4AIRA 4FMDB 2J67A 4LSWA 1THZA 2CHVA 3WJAA 3ZUGA 1E0AA 4HDAA 1K5PA 1I5EA 1ZD5A 2O2DA 2YFYA 3C3CA 4FI3F 4OAPA 4RH3A 5I9MA 4MQMA 2PMEA 5SY6A 1CFZA 4JUAA 1OWPA 3HMKA 3USCS 4N82A 5T4BA 5HWSA 4DCUA 4H27A 2WY2D 2P30A 2X0EA 5B3JC 1ZN8A 2R6HA 5FIUA 3BSWA 3I9KA 2B8NA 3FUWA 5EL0A 4BTLA 3CIFA 3SXPA 4X91A 1RLIA 4QG3A 4INZA 3SOPA 5HM8A 1TLTA 4J9UE 4CMHA 2G70A 2HQ1A 3SI7A 5K0TA 1SB8A 1XX6A 5GIPE 2ZM6B 3AFGA 3C7AA 3O90A 3R5SA 5TV2A 1FSZA 2PCJA 3H84A 4WPGA 2WU0A 3WO0A 3AUTA 4GP6A 2CB9A 1FXUA 1XL0A 1F51E 1GG5A 4Q4DA 5G02A 2CJYA 1KQFA 1PR1A 3H4TA 1T2FA 2VRBA 3ULKA 3VBEA 1JPJA 1WNFA 4ZARA 3VH1A 5SZKB 3ZD8A 4BC0A 4JS0A 3VR6A 2W2TA 3KK0A 1KJQA 2BI4A 4OJQA 3BMCB 5JLAA 1RYZA 4FHDA 4I5DA 4JJAA 3ZCUA 4CLRB 4I5GA 4YEDA 4F2DA 1GLGA 3IP9A 4JJGA 3SHQA 2BW0A 4ZOLF 5KZMB 4S12A 2BMJA 2QI9C 2BZ0A 3M4JA 4RF4A 2ZRGA 2GK4A 2FQ1A 3FAZA 4L0MA 5ARCA 3VMFA 5BN5B 3D54D 4A73A 3IPCA 4FYYA 4ZT6A 4G9GA 3UO8B 5KNBA 2UUCB 3M33A 4JLAA 3F90A 3I04A 3I09A 4QDXA 3AEKA 4FN4A 2CVPA 3SIWA 1CLEA 2XZTA 2DCMA 2HDWA 1ZIXA 3HKBA 4JNCA 1NKSA 1DJLA 4NR0A 2WHPB 4TN5A 1N2ZA 4DV5B 2F00A 2GTHA 3IP5A 3OIVA 5EXPA 4WA8A 1JSXA 2RE8A 2VF5X 2PZMA 4ZOCA 1P2BA 1KI7A 3A04A 4M21A 4ZPXA 2BUCA 2I33A 3V9PA 3WL6A 1PT6A 4ZZ1A 5CA0B 3X44A 5SZIA 1B3RA 1NI4A 4QHSA 3G88A 4F9EA 2Q9CA 4CIAA 4EVIA 4NYJR 5TF4A 2FWAA 3M5WA 5F5LA 2NUBA 4UOZA 5JCXA 3AG6A 5H9VA 3ZKWB 1AK1A 1BE0A 4YAWA 4R0MA 1R3UA 2XRMA 4CXMA 1SCDA 1GGKA 3A1EA 3VTAA 1WXIA 3K2IA 1BFDA 1M1UA 5EWMB 4C0SA 5AW4A 4AWBA 4EW2A 5FA6A 1YUBA 1W35A 3AFMA 4HWOA 1ZLYA 5BN4A 5C7LO 3VVLA 3I4CA 4PXSA 1SOMA 2MYNA 2QORA 1X9HA 4A9AA 1Z22A 1ZGCA 5CFLA 1VXOA 3KXKA 5BSRA 3DFMA 4WSOA 1TVKA 2COEA 2OWEA 3BE6A 2FWMX 1HWYA 3VPFA 1FDWA 3PEWA 1XRSB 2YL2A 3FFTA 4GQBA 4Y3UA 2XH8A 3UK7A 3DMNA 4CRWB 2H63A 4YHBA 3FUVA 3WWPA 1HTTA 1E3JA 4MR7A 1VL2A 3A4MA 5DFAA 1W7AA 2GOYA 1W9HA 3QLVA 3RKUA 2DPGA 2JGMA 4FYIA 4ZXFA 2VDPB 4V0MA 4RPGA 3WGYA 3L1VA 4JBYA 3FPEA 4ARZA 1V26A 4B32A 3R8XA 4HGOA 2MSNA 4FYXA 4IKOA 1KKUA 2G40A 5AJVB 4RY9A 5EA2A 1KH2A 5D3MA 2QYSA 3SBXA 3ZR4B 3JPWA 1XTPA 2X4DA 4JV5B 2JLYA 1MC5A 2PJZA 3LYAA 1KE2A 3U3DA 2XZOA 2F3PA 1DAMA 2GYYA 3P2KA 1RYHA 3WA7A 3PJEA 5TR9A 2AG0A 3K0CA 2QKYA 3M6WA 4J0KA 4TS3A 4UHFA 2VP3A 4WZAB 3JZMA 4PYOA 5GV7A 1LDEA 1JVNA 5DTIA 4ZI7F 5EJ9A 3AG5A 5KX5B 1RPAA 2D0OB 2W58A 4GI5A 5EE3A 2ZJFA 2KI5A 4GXTA 4IG4A 4IWNA 4B09A 4W8GA 5C8DA 2IJGX 3MWDA 2HX1A 3TWOA 3ZQ6A 5I9TA 2IZ6A 2PWPA 5JE8A 2GA8A 2XMQA 1G5QA 3EQZA 2AKYA 1N5KA 3DKVA 2HMTA 4HNHA 1K08A 1GA6A 4N3BA 3ZIDA 5CD1A 3ZWOA 4TT3D 2W6PA 3RADC 2JI9A 2XDYA 1NMXA 5JJ5A 2IYYA 5E7MA 5GZ1A 4M37A 2VJDA 1YHYA 2G9UA 1AA9A 2PH5A 3O73A 2X0DA 5IASA 1AMUA 3TGWA 2CE2X 2SKDA 1MW8X 1OKKA 2CXRA 4BMPB 5I45A 1BAPA 1PV1A 1HV8A 4CLEA 3D6UA 2PBZA 4EG5A 4HX9A 2R00C 3VR6H 1TLLA 4NV3A 3V3KA 5AJWA 1JEQB 2OV3A 1MABA 1ZRSA 4OGGA 5ER9A 3Q85A 5LCXA 4D9IA 1DL5A 1V45E 2WTMA 2PWZA 1OH8A 3N0RA 2OBLA 1D04A 1E9BA 1G0NA 1N6IA 1NYLA 4EJSB 1XTKA 1R00A 2VT6A 3H8JA 4EJMA 2P7IA 2BGGA 3HO1A 1ZH2A 2IU6A 1N9GB 3L8FA 4IHJA 4UUAA 3SZLA 5LJIA 3DWIA 4Q00A 1WP9A 4YJ2B 4I9NA 5KNBH 2JFNA 4M2LA 5KCMA 1SD2A 5JD6A 3AESB 4L5CA 3MK31 5K5EA 4PS1A 1XQYA 1JMKC 4NK4A 4IEFB 4XM2A 3GLIA 1L7RA 2PGLA 2RAVA 5BQ3A 3DLHA 2QYTA 5D7NA 2BEWA 1N9KA 4N48A 4X7BA 2C7GA 3UH1A 3OJ0A 3GVPA 1SZPA 2A5JA 4B3XA 1A2KC 2VRWA 3TE6A 3HWRA 2VYFA 2J3MA 4C7MA 3KOZA 2AMJA 2QJTA 4TMZA 4WFQA 1QX4A 4XDGA 4ASUD 4DNFA 1UBFA 4TT3A 1NW8A 3ISTA 2NTVA 5KYTA 1PSZA 2GAAA 1WUHS 1J90A 1CUWA 1E1NA 3G02A 5F1PA 3NWJA 1QOPB 1VZ3A 3PJFA 2BKEA 1PS8A 3H1PA 2AGVA 3KR9A 1KYZA 1ZAKA 3SPXA 2I3DA 5I8WA 3OF3A 1LD3A 3SEZA 3EHEA 3ROQA 1YR2A 2IY7A 3IEXA 1NY6A 4LX8A 4F4FA 2UXDB 2DTXA 4YK7A 3RAFC 3UUGA 3A36A 4ZV4A 2FCRA 1NPTO 2D1YA 3CE9A 4UXHA 4ENRA 3DBRA 3CV3A 1IWPB 1JS1X 1SJ9A 4QASA 4GGMX 1B7GO 3AUJB 3L40A 3NXKA 1OA1A 1VMAA 2BDUA 3LOPA 4BNMA 2XHEA 4L5YA 9MHTA 1OC2A 4S1TA 3P2JA 1DG3A 2Z3ZA 2OXTA 3ZHVA 3KJZA 1O3YA 1TF2A 1XDGA 3N1UA 4I1OA 4JLVA 2XSZD 1UJNA 1RI5A 2CT8A 3K9CA 2WTEA 4EEKA 3AVOA 4I8XA 3H99A 4BLSA 4GM1A 3GLFB 3QW4B 4M0LA 2IYZA 4NZZA 3RJZA 2B7BA 3AM4A 3JD4A 2JGRA 1ACMA 1D2CA 1W93A 1MC4A 2CZQA 1KDPA 4U0JA 4ZAZA 3W2GA 4D9CA 2V7TA 4O2AB 2VTKA 3U7IA 3V4ZA 1XBTA 5HTKA 4N8SA 1O5TA 3EZ9A 2ZDQA 3D8UA 4ASUA 4DVJA 5L6LB 4A82A 1MTZA 1G5FA 2A9RA 2UKDA 2R3SA 2PGXA 4PFQA 4YDHB 4R83A 2EJCA 4MVJM 1TKBA 3WMRA 3T1VA 4Y2UA 5CIQA 1VYTA 1IBCA 5D85A 1UMDA 4X1KA 4UOEA 1W29A 3Q8XB 3T7RA 4OJKA 5EIWA 1T5IA 1TTTA 1U0SY 3HWSA 3NAZA 5AHKA 2O4UX 2PANA 2D5LA 3EQ8A 3MJFA 2WJHA 4DB2A 2QS9A 4U2KA 2ZVDA 1B73A 2EKDA 5T4FA 1VLLA 4J0FA 2YN0A 3UG7A 2O19A 2ZWAA 4OB7A 1TJPB 2QTNA 5K05A 3FTEA 1EWVA 1J0XO 2Z4RA 4HRYA 5M04A 3RK4A 1XD2B 2RGNA 3U3ZA 1QPZA 4C07A 4FFBA 4XX0A 3GLGA 1I3NA 4AJLA 4KVFA 5SY9A 1EUCB 2R6GA 1LJLA 5KTKA 3U7EB 1MG0A 3EJ6A 3TPCA 4FGLA 3H3FA 1BA2A 4WL0A 5B7GA 4DNQA 4R1UA 3W8NA 2ANBA 4RELA 5JMTA 3K0CC 1RYBA 4HSGA 4P34A 3TUJC 4BFSA 3R20A 2PHZA 4PZDA 4C9BA 1QQ6A 3K6KA 421PA 4MIEA 1LWOA 1M6WA 1DVRA 3PKJA 1P45A 4IDDA 4PAWA 4J0DA 3IODA 2B4QA 1R66A 4H4DA 2ZBVA 3KWJA 4P1ZA 1QGUA 1XZGA 3FDZB 4JY7A 2XXBA 1H8ED 1FIUA 2IQIA 4QJBA 3DVAA 1ZNQO 3E9CA 1X8JA 3EVAA 3MUEA 4QTXA 4HB3A 3GBSA 2GWRA 4UREA 4F11A 4MAMA 3SOZA 1Z82A 3UA4A 4RTOA 4DMHA 3JQAD 4V0QA 2PKXA 1E1YA 3VU9B 1M0SA 1GZHB 5CCDA 5J4YA 2A88A 4KXXA 4JCCA 5BV2P 3CUTA 1CHNA 1XDWA 1H2YA 2GD6A 3IAS6 2YV2A 4MLCA 2J7PD 1VZ2A 2YWCA 3C5EA 3QZUA 4QJ4A 4ZTBA 3R9IA 1PG2A 1W49A 3WNQA 1XROA 4Q1DA 5HQJA 5HOQA 4J7XA 1UKCA 3DCIA 1BW9A 1X1TA 4B3SB 1M73E 2XNKA 1N1GA 3H6HA 4GWLA 1NSYA 1YZVA 1EE1A 2ZSHA 3GEDA 1PTKA 3GZNA 3NT4A 1VCHA 1YBMA 1FTWA 4PHGA 4G5SA 2JFXA 1GQQA 1AHIA 1UBTS 2QLBA 2XGMA 1YZHA 3IR6A 3N6RA 4NF2A 1KZ7B 3GO4A 4TYWA 4NE9A 3RYCA 4FONA 1AGXA 1N5JA 3IDQA 1QJCA 5A02A 4IJKA 3B9BA 1OGIA 2EJUA 2PS1A 3HDHA 4QXPA 4TQAA 3EFHA 2PKYX 2RC6A 1EVIA 5KPDA 4AO7A 1U8FO 3LT1A 3TW8B 2R44A 2WILA 1VKOA 2Y67A 2B82A 3DVQX 1QRRA 1BCRB 3B2QA 3QVUA 2NYVA 3U4CA 1YR6A 1V1JA 3GLHE 1UPAA 1KDRA 2BSAA 3A37A 4RW0A 1AJEA 3HVRA 3CZPA 2E3JA 1NX6A 1RI3A 2FG5A 4HRVA 4ESHA 5KVCA 1NVAA 1OILA 4KR2A 2VSNA 1E3IA 1X3SA 4PGGA 1H2RS 1II0A 3D4BA 2OBMA 4NWIA 4PPFA 3JQAA 3WE7A 5JMWA 4CEJA 2IUUA 2OV4A 3TGPA 1OJLA 2IEGA 1T6YA 3PTAA 2FV8A 4NNJA 2GJ8A 5AK0A 1YE8A 2BFDA 3QXHA 4UM7A 2J7PA 3H6GA 3HGTA 1L5QA 3NIBA 5F1OA 5FTMA 2PVPA 3QKUA 4F06A 4KOAA 1LFDB 4KE9A 5L7WA 2J4FA 3CH5A 1AD2A 1CIPA 2ZZKA 3GPIA 4LJ8A 2NZVG 3PDIB 1Y5LA 3AI7A 4MZXA 4N41A 3GB9A 4X3CA 4YB8A 4XYEA 1AKTA 4LS3A 1P2TA 1WUTA 4RK4A 5KHAA 4EVSA 5BWLA 1YB1A 3UWSA 4YT5A 4BMCA 1UK6A 2FZWA 4IDAA 2OVFA 3DDUA 4YP5A 4Q4JA 4N3AA 4JLMA 3ACBA 3L6OO 2OYRA 3T5MA 3AQ4A 5E6UA 1Y4DE 2ARKA 3DZCA 3M3PA 3X0DA 2OXRA 5I7WA 2GT1A 4MUKA 5C31A 3TQCA 4YRFA 4CM4A 4V38A 5IXJA 5TPZD 1XV5A 3C14C 2XF8A 3HDGA 3BWVA 4MW0A 4KI0A 3Q40A 3IPLA 2WVAA 3DGFC 2DQKA 3OCUA 1RJFA 2UXBB 4OATA 3ZJVA 2RGYA 4KC0A 1DRWA 1XZMA 3EEQA 4L8WB 4TQ9A 5CVDA 5HCUA 3VNBA 1MO5A 1QK3A 4XIJA 3QM1A 1KL7A 5FFNA 2XYHA 1D0VA 1T36B 2OPBA 4KR9A 3KUDA 4ED9A 1C7IA 3TLXA 2AFIE 2W2KB 4ZP1A 4UXIA 3C3KA 2XBLA 2XTAA 4UTXA 3GP5A 4UU1A 4ENPA 2XDQA 5HM6A 4WVFA 1QMPA 2IK8A 3F6RA 4G0PA 1X38A 2C5SA 3HDJA 2VJAA 2REQA 3HJCA 2C95A 3CNEA 4PLVA 4DCSA 3OQBA 4TSFD 1MB9A 3LLMA 2NP7A 2XE6A 1N2CA 3MTAA 4B7ZA 1GQYA 2E85A 3LKZA 1CR4A 2J4DA 1JR2A 4ZHQA 2Q8PA 4P3OA 1LPMA 3ZDEA 2PGNA 2TMKA 2BE9A 2I2WA 4WUVA 5TMEA 5BY2A 1PT7A 3TZHA 1UJBA 1SBCA 4BNHA 3KQSA 1B43A 2P40A 1L7EA 5HJ2A 1QAOA 2RGNC 1N77A 4J0IA 4QSMA 1VPWA 3SAJA 4KTVE 1ZEMA 4QO8A 4KPUA 5C4GB 3MNFA 2J4CA 2PT5A 1P1RA 4OK6A 4I4NA 4QARA 5ENZA 1OVMA 2AF3C 2HEIA 1JLRA 3AJDA 2JGAA 1JIUA 1UZMA 3AZPA 4NEQA 4M36A 1RQ2A 2BFEA 5K2OA 1I5OA 4QICA 1L5SA 3LBAA 4UXJA 1EXDA 1VI2A 1BMQA 1V48A 3V1KA 1KEEA 2A9OA 1K6EA 3BIWA 4JA0A 3KAQA 4MAFA 4RH0A 5AK4A 3RRZA 3M6MD 5CEEA 5K8IA 1DQRA 2O5EA 5JCJA 7YASA 1LPSA 5H4HA 4GU5A 3FW1A 5KJ1A 4DM3A 3ASZA 3IMGA 3W3ZB 2IV3A 3NKLA 4QGAA 3TIFA 4CFZA 3N3AC 2WIKA 4DTCA 1RSZA 4BX2A 3IOMA 3H7IA 1M76A 4BZZA 4HWPA 1Z63A 3R77A 1I0IA 2ERCA 3T9BA 4A2WA 4BN0A 2DFKB 5JAZA 1HE5A 3KOWA 4FNAA 1AUPA 4K9RA 1UZAA 2IODA 3AEKB 2PD3A 3RV3A 5BQPA 4B79A 1XO1A 2X41A 3UMVA 4R2XA 5LSAA 5JJLA 2RHWA 3C3MA 1PDWA 2ID8A 3HKBB 1DEHA 3RUCA 2PL1A 1GCUA 2P6UA 5FFMA 2EBHX 1W46A 2YC4C 4WNAA 1BMTA 3QELA 1MD9A 2XKBA 4NS1A 5EKDA 3U5TA 1ECCA 2YN2A 2VJQA 5IC6A 2IPXA 1ZI8A 1J24A 2PMCA 3NYRA 1V4VA 4F4DA 5HQ3A 4M0UA 4ICIA 1NI4B 3IMKA 4AJ4A 1M6YA 2VP5A 2ZB4A 3JAKA 1Z6TA 2J9FA 1HFJA 4XR9A 5C46F 1DTWA 4A10A 4BE4A 1FJ2A 2VYCA 3FSEA 2ZBRA 4J0QA 4G85A 4MR8A 1N6RA 1UEIA 3E7WA 3SQLA 5AICA 4CM3A 4WA7A 4JB8A 3T9DA 3G8DA 1QR6A 4OYLA 3GRZA 1KU6A 1DAGA 4FYVA 5AOAA 3T5CA 3WMGA 1YZQA 4KSBA 1TM5E 4RY8A 1FDOA 3TRFA 3FWYA 2F62A 3FB1A 3OPQA 3QU2A 4GEKA 2NU9A 4IWXA 4IDGA 2YW9A 4IDPA 3S4YA 3VOAA 4BIMA 3MXOA 2LCQA 4MR7B 5KDOA 1XHEA 2IQ5A 3A1CA 1HDOA 4PHFA 1IZYA 4EB3A 3F49S 5C8YB 2ZITA 3QE0A 3MOSA 4GSLA 1DAOA 4E1BA 4ARZB 5DW3A 2OTCA 4RVUA 4X7RA 3KZXA 4BP1A 1OLSA 2HCTA 3EDCA 1H22A 4BBPA 3NDRA 1O9GA 3DF7A 4X5OA 1V47A 5AJYA 2YVQA 5EJEA 3IVMA 5C1BA 4PGHA 3STUA 1PJQA 1XCJA 2PSFA 4F38A 3HB4X 3VSCA 3SJZA 4QOGA 3OKCA 1YUMA 1VXRA 3CBGA 3EGOA 3DZDA 4OUDA 3D6VA 2Y1FA 1XD9A 3PE6A 4PX3A 1J07A 1UM9A 2F90A 5IVKA 1M6VA 1SUFA 2AC4A 1XNQB 3MBOA 2R6JA 4CQNA 4N5HX 2RGWA 5FOWA 5K01A 4JB2A 1JHXA 3GPCA 5CHEA 4DLSA 2WAAA 4LYFA 2I0FA 2NQ2C 4N0PA 3QU5A 1GCOA 4RK5A 2Q28A 2QAGA 1AKEA 1FS6A 1E7SA 2A4KA 1I4WA 4HWSA 5EJIA 3FE2A 3FLMA 1VIVA 4YI3A 3WL5A 4RD1A 1G9TA 1UJ5A 1KXJA 1E2JA 1JPUA 3JYOA 3NHSA 2H4HA 4PQEA 1P3JA 2EQAA 1JU3A 1A9PA 1D2RA 4XARA 4KK3A 3M1LA 2D7DA 4I9UA 5FNVF 4FB5A 3NJ8A 4D57A 4D9HA 5FLKA 2KW5A 1FLVA 1M67A 2Q4OA 3EVCA 1MABB 1QLWA 2H31A 3MGKA 5CIYA 2B4KA 2IYLD 5C0OE 2TRSB 4XE5A 2JASA 3CWZA 3FZQA 4OLFA 3TCKA 1X7WB 4R9UC 1GFZA 3EFBA 3O84A 1ORTA 4XYLA 1FDTA 1V7CA 4OCZA 5K4GA 4LTMA 4ZVRA 5FBVB 1M2KA 3IOEA 3A4YA 4Z4CA 1WS6A 2OAP1 2QR2A 3KEGA 4IHJB 4A3SA 1NW9B 2REBA 2OZLA 3TI7A 5JAUA 4UVGA 1U1FA 1F0NA 3EW7A 1RZVA 3CLRD 4G26A 2JIZA 3OCYA 1KAMA 3TTWA 2AWOA 2IWRA 1X92A 3G82C 5PNTA 5JTTA 2OC9A 2YIVX 1Q1NA 2BI8A 4KP7A 1ZM9A 4B8YA 2ZQYA 4CR6A 4ARSA 2BEWB 1UIMA 3G68A 3KUXA 3W5IA 3O4HA 2HDNB 3STVA 4EYQA 4DLYA 1F9EA 1MQ9A 4G8JA 4U5XA 3SR3A 2XMBA 4Q03A 3SJAA 1HLGA 2WG2A 5T8KA 2B34A 5ERYA 4F2HA 4XQCA 4YR7A 5FWYA 2D4HA 1FJGB 2E6UX 2IXAA 1UBEA 4P8RA 2RONA 4P7KA 2PIAA 5COQA 1YH3A 1X1SA 4KVZA 1P74A 3V80A 3BH6A 3ZU2A 4IR7A 4R9VA 1K7CA 1XYGA 3H1FA 1O0CA 1ZXXA 4AKGA 4HQFA 1IJKA 4JB0A 2FLKA 4BQEA 1ISHA 4BPRA 2B4AA 2WIDA 5EZQA 1ZHOA 3U31A 2GRUA 3DYIA 3IUYA 3QNUA 2A9VA 2D7JA 4FUQA 4G23A 4HWGA 5D51S 5I47A 1NIJA 3RTEA 1PRYA 2PE5A 3AW9A 3VO2A 4GLLA 1STOA 3FROA 4PLPA 5CLIA 2AK3A 3O2QB 5KVAA 2W4MA 2F3UA 1IJFA 1OBVA 4UQOA 4YCSA 5KTTA 3INGA 4KDEA 3V4OA 1YDWA 2HM7A 3F6YA 3N7AA 1T3ZA 4GHWA 4MPDA 4QWWA 1F7VA 1U5CA 4XYGA 4WOBA 4AQDA 1H5UA 1DPGA 4H6XA 4DSAA 4WNYA 4TM7A 2VLIA 1VM6A 1E5DA 1LS1A 4UEOA 4WDQA 4PY2A 4F1WA 1O97C 1WY7A 4M1MA 3KUCA 2I8CA 4PU0A 1RHKA 3SFTA 4CPDA 1ZCJA 2DLDA 3JWEA 3PSHA 2CUNA 4FWIB 5TB5A 1MORA 1PO7A 4B6FA 5C1OA 4U2CA 4DM4A 2K7ZA 1PZFA 3IUPA 4WEOA 2CK3D 2V4MA 5JJKA 4Q21A 4ARCA 2ZE8A 3I72A 2XLCA 1X7XA 3WIBA 1GLVA 5FH9A 1UKEA 1GG2A 3KKKA 1DQZA 3MTBA 5K3OA 3QPWA 3TSWA 5AVQA 1G17A 3AU8A 5BR7A 5EJAA 4KODA 5SYMA 3TSCA 1U11A 3I8SA 3B9PA 4WN3A 1S2GA 4P7FA 4KAJA 3OT4A 3FDFA 1DWUA 4GVXA 3VZDA 2H6EA 4DSOA 2FB9A 1UMDB 2OXCA 3OQ1A 4X1KB 4XB2A 3HRHA 4B17A 1G20E 1Z34A 3BFKA 2CHUA 3N75A 4IY1A 5DTJA 2W6JD 3NHBA 2FMXA 3DV0A 4GX2A 1Z8DA 3B78A 3OZSA 3WLMA 6PFKA 1ZIOA 2O3SA 1YQDA 3OZXA 2DWUA 1UT5A 3TLBA 3GLVA 2AI3A 3L7MA 3NUQA 4YAUA 1Y0BA 2DBVO 4M4SA 1G7TA 1AS0A 1Y4UA 5KUTA 1YTUA 1FK8A 5CVTA 2UXCB 4LZWA 1E0SA 1UBNA 1CXZA 1ZMOA 3BXGA 3HDVA 4N18A 3K05A 4XX0B 4JUFA 2EJWA 3GLGB 5JSKA 4HUTA 2FN9A 4GDFA 4TL6A 2D0IA 4IGKA 3I5UA 4P7BA 1JAHA 3BC1A 3PKIA 4FGWA 2PKCA 3DE6X 3T54A 5BT8A 4D2IA 3BIOA 2OSBA 4YLGA 3IRVA 2CC2A 2V9ZA 4M38A 4PE5B 3UJCA 5TT1A 4JUIA 2IP2A 1WW8A 4YUYA 2PIDA 4Y2HA 1U1DA 5JMPA 3GRUA 2CMKA 4X8HA 4XVHA 2CK3A 4Q66C 3LMKA 3EODA 5PGMA 5IDWA 2HU7A 1T9DA 1RE0A 5JXHA 1VKNA 1YT5A 1QGUB 1HZJA 1MB3A 2C04A 1IU9A 2IELA 2XIQA 2Y99A 1BO6A 3K8QA 4DPMA 5CDFE 4WW0A 1SZDA 3C6YA 3DVAB 1TA4A 1K4YA 4L74A 2MU1A 4V0SA 3TIXB 2REOA 4NBNA 2QAGC 3G13A 3N58A 4FEEA 2NVBA 4HPWA 4GBJA 5F7JA 3CSSA 4Y6OA 3UG6A 4CCYA 5HZMA 2AMLA 4P4GA 2GPBA 2AN4A 3OI7A 3T95A 1KQGA 3IAM6 1L5NA 3DZBA 5CGZA 5HRUA 2ATXA 1QWOA 4MB2A 2WFZA 4LJ6A 3W9BA 2I9PA 1K6XA 2W6JA 4G86A 1KFEB 2PV7A 2ZUWA 3LWZA 4O33A 4FFVA 4P3NA 1D1QA 5DJ5A 2CLCX 1W4RA 3BXHA 1N4AA 4E5MA 5DYTA 2G9RA 1Y1LA 5IH7A 4X1OA 3ENWA 4DUGD 1Y5RA 3OM9A 3VFDA 3W9UA 3ROGA 1VE5A 3MN1A 3O8CA 5G2OA 3P4XA 3I2HA 1JFVA 3BB1A 4ZJZA 2FRDA 4D4JA 4JLWA 4XEHA 4WBNF 3GZNB 1RXYA 3RRYA 1GUZA 1AZSC 3OPVA 4NV1A 1TUBA 2A7XA 4ID9A 1XTSA 3ZS8A 4AD8A 5D5PA 2ZUVA 4DGSA 3C39A 3RYCB 3NWEA 2NNWB 3BE8A 4LISA 4K5QA 1S7GA 3ZI7A 3DO5A 3WOVA 3WZ2A 2H06A 3D0KA 4Q19A 1A8PA 2CVHA 5E6RA 2O20A 2N0SA 4KQ1A 1YZNA 1B0PA 2OCAA 2VHCA 1JLHA 3AK4A 3C4QA 3MVEA 4IS3A 3S2SA 3RTBA 4J3JA 3P0EA 3D9QX 1VHLA 4ODIA 1RRVA 2R2AA 4PNZA 4PLHA 3RFXA 2ZIEA 1SKMA 3LDAA 1E61A 1QB8A 4RK6A 2B5WA 1QP0A 1YS1X 3RYIA 2RCYA 5A1TA 2PZBA 2Z6VA 4KN8A 4Z99A 3RFTA 1ISJA 3VV2A 3A3PA 1GA4A 4J1SA 4WLVA 5T8KC 1KP3A 4MW9A 3STYA 2FEKA 2V8BA 1K1EA 5DTEA 4CEJB 4NFYA 1Q21A 1IZ8A 1MNQA 1NXOA 3Q2OA 1N36B 4J0JA 3RKSA 1A7JA 1VC2A 4CDRA 5A1JA 1N78A 1L8QA 1RWPA 1VJ0A 1ZBQA 1G6OA 2VDMB 1VSBA 4AJIA 5IM4A 3MJTA 4Z7OB 4LC1A 4RV9A 2WRZA 3L1KA 2XCRB 1JIVA 3GUYA 3H9EO 4TT8A 4LJ9A 1QO0A 3NFYA 1W5BA 3PFKA 5DN9A 3C3BA 1Z37A 4IOLA 1NZJA 5JG7A 2HR1A 1OI4A 1PUIA 2FSIA 1KVSA 1UZNA 1DAIA 1OTXA 2EJVA 2GUGA 2H3EA 2IU4A 1QE3A 2P2CA 3HSKA 4R9NA 2XXJA 1YK0A 4TTSA 1U1EA 4DIOA 2GN9A 1TO6A 1HDRA 2GETA 2L19A 2B7CA 1WEKA 3WWZA 3CN7A 4Q4JB 1VE9A 3RSOA 3NP7A 5A0FA 1KEZA 1WZCA 3RO7A 5KNCA 4CKXA 1NIPA 1PE0A 1KY3A 1X19A 1WTAA 2CXSA 2Q1XA 3CLRC 3H2HA 4FMDF 5E6UB 4CMAA 2C5BA 5EJ7A 1DIGA 1W5SA 1JHDA 4OXYA