3MNGA

Wild type human prxv with dtt bound as a competitive inhibitor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
161
structure length
161
Chain Sequence
APIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin-5, mitochondrial
publication title Structural Evidence that Peroxiredoxin Catalytic Power Is Based on Transition-State Stabilization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 47
structure length 161
sequence length 161
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2010-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3mngA00
4TR1A 3IAM2 3DYRA 4KCAA 3A2XA 4DSSB 2WGRA 4MPGA 1SJIA 2X8HA 3VI5A 2PERA 2H72A 1YEXA 1YJ6A 3FEUA 4J57E 2IPAA 2D2ZA 1XWBA 1TK8B 3TOUA 5DJLA 4IBPA 4ECBA 5HR2A 1K3LA 4V2NA 3QFBC 4X0XA 2TRCP 3GSSA 3U6VA 3IDVA 1SYRA 2HXKA 4Q5NA 2WRTA 1ZYEA 5IM9A 2CAIA 4MZCA 1CQHA 3GH6A 2YJ7A 1ZOFA 3EU4A 4GSSA 1R5PA 3ZYWA 1QUWA 3JCML 1Y25A 3GA4A 2LRCA 2JU5A 4K6XA 2YPMA 3VLNA 4KH7A 3D22A 1G0TA 4KB3A 3Q18A 3FR6A 4HI7A 1AAZA 4ULXA 2L6CA 1JLVA 4PUFC 2O8VB 5IMDA 4OO4A 5JWRB 4Q5FA 5FHIA 5IMVA 1XIYA 1EGOA 2ON7A 4EUYA 5IQYA 4X1UA 2WS2A 4TXOA 2KP1A 2DIZA 1SL2B 3ZITA 1B8XA 2L6DA 3D21A 2HT9A 2WDUA 1KBNA 3F3RA 5IMFA 5ELGA 3DVXA 1ZMAA 1QGVA 1IYIA 3EYTA 2OJLA 4MMMA 1IYHA 1NM3A 2C0EA 1Q4JA 4FYCA 1U3IA 2CZ3A 4Z7XA 2HLSA 1GSFA 4GCIA 5IOWA 2FNOA 2LRTA 3WGEA 3UBLA 2R37A 1BAYA 2IFQA 3M9KA 2GQKA 5IPHA 3HVSA 3FZ9A 9GSSA 4I6XA 3F4RA 5CP1A 4ML6A 2VL2A 3FZ4A 1A0FA 4EF0A 4XIHA 2RM5A 4MF6A 4MJEA 2H1AA 1K0DA 3DWVA 1OE8A 1FHEA 4AGSA 3MAKA 1Z5YE 3WGDA 2L57A 5IPGA 3LG6A 1F3BA 1T1VA 3QPMA 2FY6A 2H6XA 2X99A 3CYNA 4BVYA 3O3TA 4GSTA 2IFQB 4IQ1A 4EDYA 4JRRA 3I69A 3RPPA 3APSA 2O85A 4MJCA 1KEBA 1Z9HA 4OO5A 1GSUA 4POMA 1T00A 3GKNA 2PU9C 3G7IA 1S3AA 5F0GA 1MTCA 3KH9A 3GKKA 1A24A 1DUGA 5AIXA 3DKSA 2IMDA 2I1UA 4CW9A 1TDIA 3KMOA 4JE1A 3HZ8A 2P0GA 5HR1A 3TKSE 3H4KA 3SWLA 4MK3A 4PQ1A 3QD9A 2F3MA 1QFNA 3BOAA 2C8UA 3HJMA 4RUVA 4P3YB 3PR8A 2CVBA 2OE1A 2I81A 3GRXA 2DJJA 2WULA 2C3NA 4TRXA 4RQRA 1R7HA 2A4VA 1XW6A 1V40A 3C73A 1SKWB 2K8SA 1SU9A 4I5QA 2H74A 3RPNA 1TKDB 4KSMA 2GZZA 4KSOA 1YQ1A 2RUEA 3ZLPA 2J9HA 2IMKA 5GAPD 1SJ6A 4WBRD 3VWWA 2C0DA 3DGQA 1A23A 1PX7A 2GGTA 1EWXA 3A3TA 1KTEA 1G6WA 1OAZA 4MF5A 4HDEA 2VCTA 1HYUA 2I9HA 4EO3A 2I4AA 2MMZA 2FWHA 1SK0A 2AHEA 1AC1A 5GZZB 1J0FA 4AJ7A 5CO3A 2VL2C 2RUFA 1A2MA 4LL1B 1YKCA 1EV9A 1O8WA 1FOVA 1JZDA 2ALBA 3E0UA 3GURA 1ABAA 2CX3A 2DJ3A 5H5SA 5HFIA 3FYGA 4HU7A 2X8GA 2YV7A 2KOKA 4KA0A 1GP1A 2IMIA 1EEJA 2TIRA 3M9JA 4IS0A 2I3YA 3N9JA 3TJBA 4ZB8A 1XXUA 3QR6A 1VF4A 1G7EA 4ZB6A 5J9BA 5ECNB 2FD3A 2R6KA 2E0QA 2TRXA 1CQGA 1U88A 2MMOA 4F03A 2VM2A 5DBQA 5JCUA 5FT3A 2KP2A 4N0ZA 1GUKA 2XBQA 2H19A 4ZILA 3FK8A 5ECQB 2VO4A 3IE3A 4KUNA 2V6OA 1ML6A 1MEKA 2WJUA 2NBSA 2L4QA 4ILFA 2H6YA 3ZZXA 1VGLA 2H76A 4TR4A 3ZRDA 12GSA 1A0RP 10GSA 3RBTA 1SD8A 2H73A 3ZMLA 4YQMA 2WFCA 4BWQA 3GX0A 3PH9A 2YANA 4J56E 3WGXA 1VRSD 2HFDA 3UBKA 4ID0A 2GSTA 4NHZA 5B8AA 4TOPA 3ISOA 1GSYA 3BCKA 1HQOA 1T4ZA 2H0HA 1PRXA 5IMCA 2CA8A 1M9BA 1A2JA 3GL5A 2ES7A 2R4VA 4POBA 1K3YA 1F3AA 2CAQA 3GNJA 3KJYA 1ERWA 1U3AA 1DSBA 5D9TA 2PBJA 4PNFA 2H01A 3FZAA 4IELA 3OR5A 5G1KA 4MH2A 5JCGA 2H75A 2JSYA 4NPBA 1THOA 3W6GA 1BYEA 2HYXA 4FYUA 3TRPA 3US3A 4V2MA 1S3DA 5A4WA 2BTOT 1H75A 1QMVA 1BQ7A 1TI1A 2FUG2 2JZSA 3DIEA 1XW5A 3BBYA 1BG5A 5G5EA 2VL3A 2FHEA 1SJZA 2K8VA 1OE7A 2VOCA 3C1SA 2DJ2A 4HOJA 1PGTA 3MDKA 1OKDA 1THXA 3VI7A 4L5LA 4WBJA 2GT5A 4DSSA 3TKQA 2L5LA 2FWFA 3UIWA 5A5KA 4IVFA 5IO0A 2VD1A 2PMTA 3DVWA 2GZPA 1XVWA 2PVQA 1R26A 3D5JA 3PINA 3GFKA 3IV4A 1GLPA 4TW5A 1XVQA 1K0AA 3GIXA 4MJAA 3QAWA 1DE1A 3ME8A 1FAAA 2H66A 4HS1A 1JZOA 2IN3A 4N10A 2LSTA 2H6ZA 3IXRA 4HEA2 2JZRA 2YWIA 1Z6NA 4YQUA 4D73A 2GSQA 2OBIA 5CRWA 1A8LA 7GSSA 1OYJA 4NMUA 3WT1A 2HE3A 2C3TA 4ECJA 2P5RA 3DMLA 3KIJA 1FB0A 6GSYA 3ED3A 5D8IA 1WIKA 1MD3A 4K7IA 3GKMA 3TJFA 5KN1A 3GX8A 5B6NA 1ZGNA 1HNCA 2F51A 1O73A 5ELAA 2ZCTA 4ISDA 4FIWA 4D73B 3LGCA 1OC9B 4OFTA 2MYGA 4XRDA 2IMFA 4WETA 5DCGA 5ECSA 6GSXA 1XCCA 2N5AA 4RI6A 3F4TA 5HR0A 4K9ZA 3ZTLA 2RM6A 5G5FA 8GSSA 1SL1B 4DSQA 1NSWA 1RQMA 5G2ZA 2E7PA 5JCWA 1GNEA 4EDZA 2VUPA 3H79A 5A4VA 2HI7A 1Z7RA 3CSIA 3WYWA 4O5RA 1NHYA 3AY8A 1WMJA 2LJKA 5AGYA 2QC7A 5DQYA 5E4WA 1K0NA 1I9DA 4FO5A 4MDCA 1NHOA 1TK0B 3EINA 4KX4A 4KDYA 3F63A 1O8XA 3HCZA 2GVPA 1WP0A 4IHUA 1H4OA 2H30A 4ZIJA 2LQOA 1F2EA 5D96A 3L4NA 2XPEA 3GMFA 3P8WA 5EL8A 3ERFA 2B7KA 5GSTA 2LNTA 3GYKA 3QFAC 1SK1A 1G6YA 5D9XA 1K0OA 2MZCA 2JSZA 3DXBA 4H86A 3TB2A 2NTOA 3G7JA 5INYA 2P31A 4L0WA 3UVTA 3FZ5A 1XWAA 5ECKB 1M7TA 3EWLA 1QQ2A 1E2YA 2V41A 1XOAA 3NOFA 1O7UA 2GQLA 4F2IA 3RHBA 1MD4A 4ZBAA 4DSRA 2FWGA 4KDXA 5JWQB 2PUKC 1ERVA 4L8EA 2P5QA 3HA9A 2GLRA 5ECMB 5F05A 1XWGA 2LJAA 3GL3A 2PGTA 1SKSB 2HRNA 4K1FA 4EKZA 3KCMA 3ZL5A 1B9YC 4G19A 1O81A 1X5EA 5COHA 5EPFA 1TTZA 4YAVA 3CBUA 1LBKA 3HVVA 2B6MA 1DBYA 2YNXA 3Q19A 1XPVA 5ECPB 3HZ4A 3W8SA 3HXSA 3V1WA 2A2SA 1GWCA 1ERTA 1V2AA 2EIOA 5CREA 4QL9A 3QAVA 1K0MA 2CZ2A 3HHVA 1JZRA 4HUAA 3H1NA 1GSSA 1Z7PA 3NIVA 2VIMA 1GUMA 2YN1A 3CMIA 4PQHA 3GV1A 4GRFA 3P7XA 2YZHA 1YEPA 2HSHA 4GWRA 1GUHA 2DBCA 1SD9A 4IP1A 3UMAA 3LSZA 4MP4A 4MA9A 2VLTA 3F4SA 5F07A 1JLWA 1Z3EA 2QGVA 3EMXA 2GSSA 1F9MA 4AF2A 2B7JA 5DQSA 3ZFBA 1ILOA 4L5OA 1PMTA 4XS1A 4FYBA 1PL1A 3RHCA 5EY6A 3CRTA 3L9VA 4NV2A 3UOMA 1AQWA 4E8HA 4XRAA 3C8EA 5C04A 5AIVA 5IIZA 4K8MA 1PD21 3J7Yb 1PSQA 4HQZA 1O85A 1QK8A 4QQ7A 1EV4A 5JWOB 5E59A 1XW9A 2CQ9A 4POKA 4AJ6A 5KEJA 2F9SA 1GSQA 2R5GA 2KLXA 5ECHB 3MNGA 4GQCA 3MWHA 2XBIA 3QAGA 4WF4A 3KGKA 2K6VA 1TXXA 4RQXA 3TRXA 3VWXA 5KN0A 4OCEA 1X9MB 5DALA 5J3RA 3I6AA 2J23A 2ZUPA 3APQA 1WJKA 5AN1A 2MBSA 3D0ZA 3EURA 1R4WA 3D4TA 3TRQA 2DIYA 2VM1A 4I2UA 2O89A 1EOHA 2DJ1A 3UVHA 1RK4A 3FR3A 2NPBA 1W89A 2BJXA 1K0BA 1WPIA 4Q5QA 2B3SA 1OC8A 3C71A 2PPTA 5DALB 3QMXA 1GSDA 1AUCA 4G2EA 2C0GA 3CRUA 1FVKA 5KN3A 4PQIA 4YQVA 1ERUA 1GLQA 1G7OA 3L9UA 4GTUA 4BL7A 1JHBA 3IHQA 2M80A 3IRAA 3GHAA 2H0IA 5DJMA 4MZBA 3KMNA 2MMNA 4WEYA 3HDCA 1YDKA 2H1GA 2OACA 1GTUA 2OA7A 3PGTA 2HNLA 3HD5A 3DEXA 1YZXA 2LNSA 4O92A 3F0IA 1PQNA 4KAEA 3F8UA 4TR0A 4BPYA 5D9VA 2B1KA 2E2GA 1C72A 2DC5A 2G0FA 5ECOB 20GSA 1AIUA 3TJGA 5C00A 4MPFA 2AYTA 3DRNA 14GSA 1XWCA 4RI7A 5J5NA 3G9BA 11GSA 18GSA 2FGXA 3EMPA 5DDLA 1VF1A 1Y6EA 2E2MA 5ENUA 1USBA 2AJQB 3UJ1A 5DAKB 3IA1A 3SBCA 5B6MA 3CTFA 5HFGA 2AUVA 3VURA 1F6MC 1BEDA 1TI3A 4KNDA 4PURA 3KZQA 2EIQA 4JBBA 1XOBA 1U6TA 5GSSA 4NAXA 1PN9A 3S9FA 2VCXA 2CX4A 1XZOA 3C1RA 5HQPA 1BJXA 2H8LA 2H1BA 2NDOA 1ACVA 4POLA 2C4JA 3LWAA 3APOA 5J4UA 1UN2A 4XCSA 3IAS2 1PKWA 5D73A 4IP6A 6GSTA 2M72A 2AB6A 1FVJA 1J08A 1TW9A 3TCOA 5B7CA 3ZIJA 1FG4A 3GH9A 4KE3A 1K3OA 4G9HA 3R2QA 1V98A 2VLVA 2FCHA 3HYPA 1T4YA 4ECIA 5LCZA 1YKAA 3ERGA 1EOGA 2WCIA 2XPDA 2FWEA 2VLUA 3KP8A 1GRXA 3KTBA 3ZVJA 1UC7A 3F9UA 4HZ2A 4EC0A 4EE0A 3LYKA 2GT6A 4ZB9A 2IJYA 5ABRA 1GL8A 4N0VA 5H5QA 2B1LA 2A2RA 3IPZA 3TKRA 4JU5A 1HNAA 4MJBA 4ZBDA 2V32A 3E3EA 4I2TA 4TN8A 3QDNA 2BMXA 1RW1A 6GSUA 3GKXA 1U87A 1OC9A 1FW1A 1GH2A 4MABA 2YWNA 5DCHA 3ZREA 1OKTA 2LV3A 1PL2A 3H8QA 1M2DA 3F6FA 4YH2A 4XS4A 5D9WA 1TRSA 5B8BA 2IIYA 5ECIB 1GTIA 3TOTA 1A8YA 2WB9A 4ZBBA 2DJ0A 1TU7A 3IBHA 2F8FA 3CXGA 1EGRA 2YJHA 4ACSA 4IQAA 5A4UA 1ZCPA 5ID2B 1T7PB 4TR1B 1FO5A 3CTGA 1X9WB 3D4MA 22GSA 2B5YA 3ZFLA 5G30A 3TKSA 3TJJA 2GQMA 4XS4B 4K0GA 4LMWA 3VWVA 4EVMA 3ERWA 2C80A 1B4PA 2Z9SA 4V1Ag 1SKRB 2B5EA 5AISA 5LNKe 5KN2A 4PXOA 2QKEA 4ZXGA 2ON5A 1Z6MA 3HY2A 3VFIA 2JADA 5CRDA 4GF0A 4YAPA 4N11A 4XHMA 2GS3A 3M8NA 3WT2A 3IK7A 3F6DA 1ZL9A 1V57A 4PUAA 6GSVA 1GNWA 3NZNA 3D6IA 3LFLA 5IMZA 4IJIA 2PVOC 2VL9A 2WZ9A 2CVDA 3G7YA 3VWUA 1LU4A 2LS5A 4LMVA 2AV4A 4JR4A 2VAFA 3KH7A 2KHPA 3FW2A 1W4VA 3VK9A 1E6BA 1B48A 1AXDA 3TDGA 3DD3A 19GSA 1SENA 4XS6A 2OADA 4PGTA 4WF5A 2GZYA 2V6KA 2VD0A 3LXTA 3LYPA 4ZL7A 3FY7A 4MH3A 3J7Yk 4V2LA 4HZ4A 3M3MA 3A2VA 1V9WA 4OWYA 4TXOB 1N8JA 3TUEA 2LTKA 2CV4A 2LQQA 3M0FA 1HNBA 1URMA 3VPQA 2IL3A 4F82A 4ECCA 1JFUA 5CAXA 2H0GA 1BX9A 4GXZA 2DMLA 4GLTA 2GDRA 5HFKA 2XC2A 1ZYQB 3BJ5A 3FHKA 5L71A 2C3QA 4DEJA 4E8EA 4NHWA 1KNGA 1TP9A 3L78A 1N2AA 3A5WA 2HZFA 1MDIA 1DE2A 3I43A 3TKSC 2OBKA 2YCDA 2GTUA 2JACA 1XFLA 2HZEA 3GN3A 1NW2A 5CYYA 3QOUA 1X5CA 3GSTA 4Q5RA 4GQFA 2KUCA 3CSJA 2OKAA 1GULA 5ECLB 4MCUA 2HRFA 1EP7A 3UEMA 1ON4A 2RLIA 1OC3A 2L59A 3EVIA 3WD6A 3QCPA 1ZZYA 4EL1A 1F37A 2JL4A 4HU9A 2YP6A 2HSYA 2AAWA 4LLRA 2PN8A 2YV9A 4HQSA 3BCIA 2HZEB 2R2JA 1SYXA 1B4QA 4K2DA 2NVLA 4OFNA 1VF3A 3U5RE 4I97A 5LD0A 1EEMA 2X64A 1K0CA 2MBTA 2VCQA 1WRYA 4GSNA 4AJ8A 3O6TA 4LA1A 6GSWA 1I5GA 4L0UA 5J9CA 2FA4A 3LXZA 6GSSA 3IC4A 4DVCA 4X43A 3ME7A 2VCWA 2H70A 4PX1A 4BA7A 2B5XA 2MMAA 3I9V2 3UL3A 4F0BA 3EE2A 1TRUA 5G1LA 1Q98A 2OE3A 4WXTA 4OMVA 2C1YA 3W8JA 4NWYA 3C7MA 3TKPA 3P2AA 2IMEA 2K18A 3L0HA 1YF0A 3LQ7A 4WR5A 3ZMKA 2L4CA 4CDOA 1SK2A 4ML1A 4IJ3A 4F0CA 1EZKA 4O7HA 2YWMA 2K9FA 2F8AA 3GUSA 2PWJA 5DVBA 3EC3A 5CRGA 4TVEA 3UAPA 2L5OA 5CRHA 2YOIA 3CSHA 1M99A 3VPTA 4OFMA 1XWKA 1X5DA 1PKZA 5H5RA 1GTBA 2VCZA 2LKUA 1J9BA 2LJRA 4IW9A 1GTAA 4CHSA 3N5OA 3IK9A 3FR9A 2V1MA 3E9JB 2R3XA 1TJDA 4NXIA 4QL7A 1YY7A 4IKHA 2G2QA 3IR4A 2O87A 5IMAA 5F06A 5IOXA 3HKRA 3H93A 1GSEA 4MF7A 1WWJA 2M46A 1XBSA 1UA5A 4NV5A 2CVKA 4O32A 5DAKA 1TK5B 1EP8A 17GSA 4N30A 4WKWA 3LJRA 5FWGA 3KM6A 2FLSA 3LORA 2LRNA 4JEDA 4ZL9A 1HD2A 1MDJA 2VCVA 1JZWA 1UVZA 3P90A 4OCFA 2V2GA 2IWTA 2YWOA 3F3QA 4TR3A 3IOSA 1M9AA 4KW6A 4MZWA 3M1GA 2JZTA 1MDKA 3KXOA 4HJ2A 1ST9A 3KTLA 4FH8A 4K7NA 2ZNMA 1X0RA 2O7KA 3LEFA 5HR3A 5ECRB 3BD2A 3RDWA 1X9SB 2DJKA 2DMMA 1TOFA 2LUSA 16GSA 2H71A 4KCEA 3UARA 2GSRA 5G31A 2X8CA 4BWSA 3KD0A 1SL0B 1WOUA 4IN0A 3Q6OA 1M0UA 1OVNA 4I8BA 4HJMA 4KDUA 2XHFA 3HVXA 5D93A 3MSZA 5EVOA 1WE0A 5J41A 2N5BA 2C0FA 3O76A 4BVXA 4TKYA 4OD7A 2DLXA 1O6JA 2N5FA 4J2FA 2QSIA 1TU8A 3GTUA 3EU3A 4KGIA 4WR4A 5CNWA 2REMA 3Q74A 2EC4A 2YZUA 1PA3A 1VF2A 2EIRA 5GAND 1S3CA 1YF1A 4JZQA 1M2BA 4MLYA 3KEBA 1T3BA 4G10A 3KP9A 1B9XC 4ZL8A 1V58A 4K7OA 4LL4B 4EXJA 2OE0A 2FA8A 2H1DA 1A2LA 2CT6A 3L9SA 3FRCA 3TJKA 1R5AA 1AQXA 1TRWA 3K8NA 1LJRA 13GSA 3HJOA 4K0NA 4IGJA 4XTSA 1AW9A 3GTUB 1AQVA 1QXHA 4F9ZA 4V1Ap 3RAZA 4JR6A 1T8EB 4PNGA 3ZIVA 5F8BA 3TGZA 3ZVJD 3A2WA 3FKFA 3HJPA 4TXVA 2DSAA 1FB6A 1TRVA 5IO2A 1PX6A 2RIIA 1M2AA 5ID2A 2LEGA
chains in the Genus database with same CATH superfamily
4TR1A 3IAM2 3DYRA 4KCAA 3A2XA 4DSSB 2WGRA 4MPGA 1SJIA 2X8HA 3VI5A 2PERA 2H72A 1YEXA 1YJ6A 3FEUA 4J57E 2IPAA 2D2ZA 1XWBA 1TK8B 3TOUA 5DJLA 4IBPA 4ECBA 5HR2A 1K3LA 4V2NA 3QFBC 4X0XA 2TRCP 3GSSA 3U6VA 3IDVA 1SYRA 2HXKA 4Q5NA 2WRTA 1ZYEA 5IM9A 2CAIA 4MZCA 1CQHA 3GH6A 2YJ7A 1ZOFA 3EU4A 4GSSA 1R5PA 3ZYWA 1QUWA 3JCML 1Y25A 3GA4A 2LRCA 2JU5A 4K6XA 2X4AA 2YPMA 3VLNA 4KH7A 3D22A 1G0TA 4KB3A 3Q18A 3FR6A 2R0GA 4HI7A 1AAZA 4ULXA 2L6CA 1JLVA 4PUFC 2O8VB 5IMDA 4OO4A 5JWRB 4Q5FA 5FHIA 5IMVA 1XIYA 1EGOA 2ON7A 4EUYA 5IQYA 4X1UA 2WS2A 4TXOA 2KP1A 2DIZA 1SL2B 3ZITA 1B8XA 2L6DA 3D21A 2HT9A 2WDUA 1KBNA 3F3RA 5IMFA 5ELGA 3DVXA 1ZMAA 1QGVA 4BIKA 1IYIA 3EYTA 2OJLA 4MMMA 1IYHA 1NM3A 2C0EA 1Q4JA 4FYCA 1U3IA 2CZ3A 4Z7XA 2HLSA 1GSFA 4GCIA 5IOWA 2FNOA 2LRTA 4FQUA 3WGEA 3UBLA 2R37A 1BAYA 2IFQA 3M9KA 2GQKA 5IPHA 3HVSA 3FZ9A 9GSSA 4I6XA 3F4RA 5CP1A 4ML6A 2QA2A 2VL2A 3FZ4A 1A0FA 4EF0A 4EIPA 4XIHA 2RM5A 4MF6A 4MJEA 2H1AA 1K0DA 3DWVA 1OE8A 1ZYNA 1FHEA 4AGSA 4CY6A 3MAKA 1Z5YE 3WGDA 2L57A 4Z2UA 5IPGA 3LG6A 1F3BA 1T1VA 3QPMA 2FY6A 2H6XA 2X99A 3CYNA 4BVYA 3O3TA 4GSTA 2IFQB 4IQ1A 4EDYA 4JRRA 3I69A 3RPPA 3APSA 2O85A 4MJCA 1KEBA 1Z9HA 4OO5A 1GSUA 4POMA 1T00A 3GKNA 2PU9C 3G7IA 1S3AA 5F0GA 1MTCA 3KH9A 3GKKA 1A24A 1DUGA 5AIXA 3DKSA 2IMDA 2I1UA 4CW9A 1TDIA 3KMOA 4JE1A 3HZ8A 2P0GA 5HR1A 3TKSE 3H4KA 3SWLA 4MK3A 4PQ1A 3QD9A 5BRTA 2F3MA 1QFNA 3BOAA 2C8UA 3HJMA 4RUVA 4P3YB 3PR8A 2CVBA 2OE1A 2I81A 3GRXA 2DJJA 2WULA 4PTSA 2C3NA 4TRXA 4RQRA 1R7HA 2A4VA 1XW6A 1V40A 3C73A 1SKWB 2K8SA 2QA1A 1SU9A 4I5QA 1PFOA 2H74A 3RPNA 1TKDB 3A5IA 4KSMA 2GZZA 4KSOA 1YQ1A 3MYDA 2RUEA 3ZLPA 2J9HA 2IMKA 5GAPD 1SJ6A 4WBRD 3VWWA 1M3IA 2C0DA 3DGQA 1A23A 1PX7A 2GGTA 1EWXA 3A3TA 1KTEA 1G6WA 1OAZA 4MF5A 4HDEA 2VCTA 1HYUA 2I9HA 4EO3A 2I4AA 2MMZA 2FWHA 1SK0A 2AHEA 1AC1A 5GZZB 1J0FA 4AJ7A 5CO3A 2VL2C 2RUFA 1A2MA 4LL1B 1YKCA 1EV9A 1O8WA 1FOVA 1JZDA 2ALBA 3E0UA 3GURA 1ABAA 2CX3A 2DJ3A 5H5SA 5HFIA 3FYGA 4HU7A 2X8GA 2YV7A 2KOKA 4KA0A 4Z2TA 1GP1A 2IMIA 1EEJA 2TIRA 3M9JA 4IS0A 2I3YA 3N9JA 3TJBA 4ZB8A 1XXUA 3QR6A 1VF4A 1G7EA 4O5QA 4ZB6A 5J9BA 5ECNB 2FD3A 2R6KA 2E0QA 2TRXA 1CQGA 1U88A 2HRKA 2MMOA 4F03A 2A4HA 2VM2A 5DBQA 5JCUA 5FT3A 2KP2A 4N0ZA 1GUKA 2XBQA 2H19A 4ZILA 3FK8A 5ECQB 2VO4A 3IE3A 4KUNA 2V6OA 1ML6A 1MEKA 2WJUA 2NBSA 2L4QA 2UZ8A 2H6YA 4ILFA 3ZZXA 1VGLA 2H76A 4TR4A 3ZRDA 12GSA 1A0RP 10GSA 3RBTA 1SD8A 2H73A 3ZMLA 4YQMA 2WFCA 4BWQA 3GX0A 3PH9A 2YANA 4J56E 3WGXA 1VRSD 2HFDA 3UBKA 4ID0A 2GSTA 4NHZA 5B8AA 4TOPA 3ISOA 1GSYA 3BCKA 1HQOA 1T4ZA 4BL7B 2H0HA 1PRXA 5IMCA 2CA8A 1M9BA 1A2JA 3GL5A 2ES7A 2R4VA 4POBA 1K3YA 1F3AA 2CAQA 3GNJA 3KJYA 1XG8A 1ERWA 1U3AA 1DSBA 5D9TA 2PBJA 4PNFA 2H01A 3FZAA 4IELA 3OR5A 5G1KA 4MH2A 3EPTA 5JCGA 1S3RA 2H75A 2JSYA 4NPBA 1THOA 3W6GA 1BYEA 2HYXA 4FYUA 3TRPA 3US3A 4V2MA 1S3DA 5A4WA 2BTOT 1H75A 1QMVA 1BQ7A 3CQFA 1TI1A 2FUG2 2JZSA 3DIEA 1XW5A 3BBYA 1BG5A 5G5EA 2VL3A 2FHEA 1SJZA 2K8VA 1OE7A 2VOCA 3C1SA 2DJ2A 4HOJA 1PGTA 3MDKA 4K5SA 2A2PA 1OKDA 1THXA 3VI7A 4L5LA 4WBJA 2GT5A 4DSSA 3TKQA 2L5LA 2FWFA 3UIWA 5A5KA 4IVFA 5IO0A 2VD1A 2PMTA 3DVWA 2GZPA 1XVWA 1ZYPA 2PVQA 1R26A 3D5JA 3PINA 3GFKA 3IV4A 1GLPA 4TW5A 1XVQA 1K0AA 3GIXA 4MJAA 3QAWA 1DE1A 3ME8A 1FAAA 2H66A 4HS1A 1JZOA 2IN3A 4N10A 2LSTA 2H6ZA 3IXRA 4HEA2 2JZRA 2YWIA 1Z6NA 4YQUA 4D73A 2GSQA 2OBIA 5CRWA 1A8LA 7GSSA 1OYJA 4NMUA 3WT1A 2HE3A 4USSA 2C3TA 4ECJA 2P5RA 3DMLA 3KIJA 1FB0A 6GSYA 3ED3A 5D8IA 1WIKA 1MD3A 4K7IA 3GKMA 3TJFA 5KN1A 3GX8A 5B6NA 1ZGNA 4CY8A 1HNCA 2F51A 1O73A 5ELAA 2ZCTA 4ISDA 5KOWA 4FIWA 4D73B 3LGCA 1OC9B 4OFTA 2MYGA 4XRDA 2IMFA 4WETA 5DCGA 5ECSA 6GSXA 1XCCA 2N5AA 4RI6A 3F4TA 5HR0A 4K9ZA 3ZTLA 2RM6A 5G5FA 8GSSA 1SL1B 4DSQA 1NSWA 1RQMA 5G2ZA 2E7PA 5JCWA 1GNEA 4EDZA 2HSMA 2VUPA 3H79A 5A4VA 2HI7A 1Z7RA 3CSIA 3WYWA 4O5RA 1NHYA 3AY8A 1WMJA 2LJKA 1PN0A 5AGYA 4G0LA 2QC7A 5DQYA 5E4WA 1K0NA 1I9DA 4FO5A 4MDCA 1NHOA 1TK0B 3EINA 4KX4A 4KDYA 3F63A 1O8XA 3HCZA 2GVPA 1WP0A 4IHUA 1H4OA 2H30A 4ZIJA 2LQOA 1F2EA 4KF9A 5D96A 3L4NA 2XPEA 3GMFA 3P8WA 5EL8A 3ERFA 2B7KA 5GSTA 2LNTA 3GYKA 3QFAC 1SK1A 1G6YA 5D9XA 1K0OA 2MZCA 2JSZA 1M3JA 3DXBA 4H86A 4X4JA 3TB2A 2NTOA 3G7JA 5INYA 2P31A 4L0WA 3UVTA 3FZ5A 1XWAA 5ECKB 1M7TA 3EWLA 1QQ2A 1E2YA 2V41A 1XOAA 3NOFA 1O7UA 2GQLA 4F2IA 3RHBA 1MD4A 4ZBAA 4DSRA 2FWGA 4KDXA 5JWQB 2PUKC 1ERVA 4L8EA 2P5QA 3HA9A 2GLRA 5ECMB 5F05A 1XWGA 4G0IA 2LJAA 3GL3A 2PGTA 1SKSB 2HRNA 4K1FA 4EKZA 3KCMA 3ZL5A 1B9YC 2DKHA 4G19A 1O81A 1X5EA 5COHA 5EPFA 1TTZA 4YAVA 3CBUA 1LBKA 3HVVA 2B6MA 1DBYA 2YNXA 3Q19A 1XPVA 3HZ4A 5ECPB 3W8SA 3HXSA 3V1WA 2A2SA 1GWCA 1ERTA 1V2AA 2EIOA 5CREA 4QL9A 3QAVA 1K0MA 2CZ2A 3HHVA 1JZRA 4HUAA 4YKFA 3H1NA 1GSSA 1Z7PA 3NIVA 2VIMA 1GUMA 2YN1A 3CMIA 4PQHA 3GV1A 4GRFA 3P7XA 2YZHA 1YEPA 2HSHA 4GWRA 1GUHA 2DBCA 1SD9A 4IP1A 3UMAA 3LSZA 4MP4A 4MA9A 2VLTA 3F4SA 5F07A 1JLWA 1Z3EA 2QGVA 3EMXA 2GSSA 1F9MA 4AF2A 2B7JA 5DQSA 3ZFBA 1ILOA 4L5OA 1PMTA 4XS1A 4FYBA 1PL1A 3RHCA 5EY6A 3CRTA 3L9VA 4NV2A 3UOMA 1AQWA 4E8HA 3LW9A 4XRAA 3C8EA 5C04A 5AIVA 5IIZA 4K8MA 1PD21 3J7Yb 1PSQA 4HQZA 1O85A 1QK8A 4QQ7A 1EV4A 5JWOB 5E59A 1XW9A 2CQ9A 4POKA 4AJ6A 4A5PA 5KEJA 2F9SA 4YKGA 1GSQA 2R5GA 2KLXA 5ECHB 3MNGA 4GQCA 3MWHA 2XBIA 3QAGA 4WF4A 3KGKA 2K6VA 3IHGA 1TXXA 4RQXA 3TRXA 3VWXA 5KN0A 4OCEA 1X9MB 5DALA 5J3RA 3I6AA 2J23A 2ZUPA 3APQA 1WJKA 5AN1A 2MBSA 3D0ZA 3EURA 1R4WA 3D4TA 3TRQA 2DIYA 2VM1A 4I2UA 2O89A 1EOHA 2DJ1A 3UVHA 1RK4A 3FR3A 2NPBA 1W89A 2BJXA 1K0BA 1WPIA 4Q5QA 2B3SA 1OC8A 3C71A 2PPTA 5DALB 3QMXA 1GSDA 1AUCA 4G2EA 2C0GA 3CRUA 1FVKA 5KN3A 4PQIA 4YQVA 1ERUA 1GLQA 1G7OA 3L9UA 4GTUA 4BL7A 1JHBA 3IHQA 2M80A 3IRAA 3GHAA 2H0IA 5DJMA 4MZBA 3KMNA 2MMNA 4WEYA 3HDCA 1YDKA 2H1GA 2OACA 1GTUA 2OA7A 4K5RA 3PGTA 2HNLA 3HD5A 3DEXA 1YZXA 2LNSA 4O92A 3IC8A 3F0IA 1PQNA 4KAEA 3F8UA 4TR0A 4BPYA 5D9VA 2B1KA 2E2GA 1C72A 2DC5A 2G0FA 5ECOB 20GSA 1AIUA 3TJGA 5C00A 4MPFA 2AYTA 3DRNA 14GSA 1XWCA 4RI7A 5J5NA 3G9BA 11GSA 18GSA 2FGXA 3EMPA 5DDLA 1VF1A 1Y6EA 2E2MA 5ENUA 1USBA 2AJQB 3UJ1A 5DAKB 3IA1A 3SBCA 5B6MA 3CTFA 5HFGA 2AUVA 3VURA 1F6MC 1BEDA 1TI3A 4KNDA 4PURA 3KZQA 2EIQA 4JBBA 1XOBA 1U6TA 5GSSA 4NAXA 1PN9A 3S9FA 2VCXA 2CX4A 1XZOA 3C1RA 5HQPA 1BJXA 2H8LA 2H1BA 2NDOA 1ACVA 4POLA 2C4JA 3LWAA 3APOA 5J4UA 1UN2A 4XCSA 3IAS2 1PKWA 5D73A 4IP6A 6GSTA 2M72A 2AB6A 2R0CA 1FVJA 1J08A 1TW9A 3TCOA 5B7CA 3ZIJA 1FG4A 3GH9A 4KE3A 1K3OA 4G9HA 3R2QA 1V98A 2VLVA 2FCHA 3HYPA 1T4YA 4ECIA 5LCZA 1YKAA 3ERGA 1EOGA 2WCIA 2XPDA 2FWEA 2VLUA 3KP8A 1GRXA 3KTBA 3ZVJA 5KOXA 1UC7A 3F9UA 4HZ2A 4EC0A 4EE0A 3LYKA 2GT6A 4ZB9A 2IJYA 5ABRA 1GL8A 4N0VA 5H5QA 2B1LA 2A2RA 3IPZA 3TKRA 4JU5A 1HNAA 4MJBA 4ZBDA 2V32A 3E3EA 4I2TA 4TN8A 3QDNA 2BMXA 1RW1A 6GSUA 3GKXA 1U87A 1OC9A 1FW1A 1GH2A 4MABA 2YWNA 5DCHA 3ZREA 1OKTA 2LV3A 1PL2A 3H8QA 1M2DA 3F6FA 4YH2A 4XS4A 5D9WA 1TRSA 5B8BA 2IIYA 5ECIB 1GTIA 3TOTA 1A8YA 2WB9A 4ZBBA 2DJ0A 1TU7A 3IBHA 2F8FA 3CXGA 1EGRA 2YJHA 4ACSA 4IQAA 5A4UA 1ZCPA 5ID2B 1T7PB 4TR1B 1FO5A 3CTGA 1X9WB 3D4MA 22GSA 2B5YA 3ZFLA 5G30A 3TKSA 3TJJA 2GQMA 4XS4B 4K0GA 4LMWA 3VWVA 3HVNA 4EVMA 3ERWA 2C80A 1B4PA 2Z9SA 4V1Ag 1SKRB 2B5EA 5AISA 5LNKe 5KN2A 4PXOA 2QKEA 4ZXGA 2ON5A 1Z6MA 3HY2A 3VFIA 2JADA 5CRDA 4GF0A 4YAPA 4N11A 4XHMA 2GS3A 3M8NA 3WT2A 3IK7A 3F6DA 1ZL9A 1V57A 4PUAA 6GSVA 1GNWA 3NZNA 3D6IA 3LFLA 5IMZA 4IJIA 2PVOC 2VL9A 2WZ9A 2CVDA 3G7YA 3VWUA 1LU4A 2LS5A 4LMVA 2AV4A 4JR4A 2VAFA 3KH7A 2KHPA 3FW2A 1W4VA 3VK9A 1E6BA 1B48A 1AXDA 3TDGA 3DD3A 19GSA 1SENA 4XS6A 2OADA 4PGTA 4WF5A 2GZYA 2V6KA 2VD0A 3LXTA 3LYPA 4ZL7A 3FY7A 4MH3A 3J7Yk 4V2LA 4HZ4A 3M3MA 3A2VA 1V9WA 4OWYA 4TXOB 1N8JA 3TUEA 2LTKA 2CV4A 2LQQA 3M0FA 1HNBA 4O5UA 1URMA 3VPQA 2IL3A 4F82A 4ECCA 1JFUA 5CAXA 2H0GA 1BX9A 4GXZA 2DMLA 4GLTA 2GDRA 5HFKA 4ICYA 3R3EA 2XC2A 1ZYQB 3BJ5A 3FHKA 5L71A 2C3QA 4DEJA 4E8EA 4NHWA 4EIQA 1KNGA 1TP9A 3L78A 1N2AA 3A5WA 2HZFA 1MDIA 1DE2A 3I43A 3TKSC 2OBKA 2YCDA 2GTUA 2JACA 1XFLA 2HZEA 3GN3A 1NW2A 5CYYA 3QOUA 5BMUA 1X5CA 3GSTA 4Q5RA 4GQFA 2KUCA 3CSJA 2OKAA 1GULA 5ECLB 4MCUA 2HRFA 1EP7A 3UEMA 1ON4A 2RLIA 1OC3A 2L59A 3EVIA 3WD6A 3QCPA 1ZZYA 4EL1A 1F37A 2JL4A 4HU9A 2YP6A 2HSYA 2AAWA 4LLRA 2PN8A 2X49A 2YV9A 4BVYB 4Z2RA 4HQSA 3BCIA 2HZEB 2R2JA 1SYXA 1B4QA 4K2DA 2NVLA 4OFNA 1VF3A 3U5RE 4I97A 5LD0A 1EEMA 2X64A 1K0CA 2MBTA 2VCQA 1WRYA 4GSNA 4AJ8A 3O6TA 3FMWA 4LA1A 6GSWA 1I5GA 4L0UA 5J9CA 2FA4A 3LXZA 6GSSA 3IC4A 4DVCA 4X43A 3ME7A 2VCWA 2H70A 4PX1A 4BA7A 2B5XA 2MMAA 3I9V2 3UL3A 4F0BA 3EE2A 1TRUA 5G1LA 1Q98A 2OE3A 4WXTA 4G0KA 4OMVA 2C1YA 3W8JA 4NWYA 3C7MA 3TKPA 3P2AA 2IMEA 2K18A 3L0HA 1YF0A 3LQ7A 4WR5A 3ZMKA 2L4CA 4CDOA 1SK2A 4ML1A 4IJ3A 4F0CA 1EZKA 4O7HA 1FOHA 2YWMA 2K9FA 2F8AA 3GUSA 2PWJA 5DVBA 3EC3A 5CRGA 4TVEA 3UAPA 2L5OA 5CRHA 2YOIA 3CSHA 2HRAA 1M99A 3VPTA 4OFMA 1XWKA 1X5DA 1PKZA 5H5RA 1GTBA 2VCZA 2LKUA 1J9BA 2LJRA 4IW9A 1GTAA 4CHSA 3N5OA 3IK9A 3FR9A 2V1MA 3E9JB 2R3XA 1TJDA 4NXIA 4QL7A 1YY7A 4IKHA 2G2QA 3IR4A 2O87A 5IMAA 2DKIA 5F06A 5IOXA 3HKRA 3H93A 1GSEA 4MF7A 1WWJA 2M46A 1XBSA 1UA5A 4NV5A 2CVKA 4O32A 5DAKA 1TK5B 1EP8A 17GSA 4N30A 4WKWA 3LJRA 5FWGA 3KM6A 2FLSA 3LORA 2LRNA 4JEDA 4ZL9A 1HD2A 1MDJA 2VCVA 1JZWA 1UVZA 3P90A 4OCFA 2V2GA 2IWTA 2YWOA 3F3QA 4TR3A 3IOSA 1M9AA 4KW6A 4MZWA 3M1GA 2JZTA 1MDKA 3KXOA 4HJ2A 1ST9A 3KTLA 4FH8A 4K7NA 2ZNMA 1X0RA 2O7KA 3LEFA 5HR3A 4HSCX 5ECRB 3BD2A 3RDWA 1X9SB 2DJKA 2DMMA 1TOFA 2LUSA 16GSA 2H71A 4KCEA 3UARA 2GSRA 5G31A 2X8CA 4BWSA 3KD0A 1SL0B 1WOUA 4IN0A 3Q6OA 1M0UA 1OVNA 4I8BA 4HJMA 4KDUA 2XHFA 3HVXA 5D93A 3MSZA 5EVOA 1WE0A 5J41A 2N5BA 2C0FA 3O76A 4BVXA 4TKYA 4OD7A 2DLXA 1O6JA 2N5FA 4J2FA 2QSIA 1TU8A 3GTUA 3EU3A 4KGIA 4WR4A 5CNWA 2REMA 3Q74A 2EC4A 2YZUA 1PA3A 1VF2A 2EIRA 5GAND 3PPUA 1S3CA 1YF1A 4JZQA 2R0PA 1M2BA 4MLYA 3KEBA 1T3BA 4G10A 3KP9A 1B9XC 4ZL8A 1V58A 4K7OA 4LL4B 4EXJA 2OE0A 2FA8A 2H1DA 1A2LA 2CT6A 3L9SA 3FRCA 3TJKA 4K2XA 1R5AA 1AQXA 4MNNA 4BVXB 1TRWA 3K8NA 3MIXA 1LJRA 13GSA 3HJOA 4K0NA 4IGJA 4XTSA 1AW9A 3GTUB 1AQVA 1QXHA 4F9ZA 4V1Ap 3RAZA 4JR6A 1T8EB 4PNGA 3ZIVA 5F8BA 3TGZA 3ZVJD 3A2WA 3FKFA 3HJPA 4TXVA 2DSAA 1FB6A 1TRVA 5IO2A 1PX6A 2RIIA 1M2AA 5ID2A 2LEGA
chains in the Genus database with same CATH topology
4TR1A 3IAM2 3DYRA 4KCAA 3A2XA 4DSSB 2WGRA 4MPGA 1SJIA 2X8HA 3VI5A 2PERA 2H72A 1YEXA 1YJ6A 3FEUA 4J57E 2IPAA 2D2ZA 1XWBA 1TK8B 3TOUA 5DJLA 4IBPA 4ECBA 5HR2A 1K3LA 4V2NA 3QFBC 4X0XA 2TRCP 3GSSA 3U6VA 3IDVA 1SYRA 2HXKA 4Q5NA 2WRTA 1ZYEA 5IM9A 2CAIA 4MZCA 1CQHA 3GH6A 2YJ7A 1ZOFA 3EU4A 4GSSA 1R5PA 3ZYWA 1QUWA 3JCML 1Y25A 3GA4A 2LRCA 2JU5A 4K6XA 2X4AA 2YPMA 3VLNA 4KH7A 3D22A 1G0TA 4KB3A 3Q18A 3FR6A 2R0GA 4HI7A 1AAZA 4ULXA 2L6CA 1JLVA 4PUFC 2O8VB 5IMDA 4OO4A 5JWRB 4Q5FA 5FHIA 5IMVA 1XIYA 1EGOA 2ON7A 4EUYA 5IQYA 4X1UA 2WS2A 4TXOA 2KP1A 2DIZA 1SL2B 3ZITA 1B8XA 2L6DA 3D21A 2HT9A 2WDUA 1KBNA 3F3RA 5IMFA 5ELGA 3DVXA 1ZMAA 1QGVA 1IYIA 3EYTA 2OJLA 4MMMA 1IYHA 1NM3A 2C0EA 1Q4JA 4FYCA 1U3IA 2CZ3A 4Z7XA 2HLSA 1GSFA 4GCIA 5IOWA 2FNOA 2LRTA 4FQUA 3WGEA 3UBLA 2R37A 1BAYA 2IFQA 3M9KA 2GQKA 5IPHA 3HVSA 3FZ9A 9GSSA 4I6XA 3F4RA 5CP1A 4ML6A 2QA2A 2VL2A 3FZ4A 1A0FA 4EF0A 4EIPA 4XIHA 2RM5A 4MF6A 4MJEA 2H1AA 1K0DA 3DWVA 1OE8A 1ZYNA 1FHEA 4AGSA 4CY6A 3MAKA 1Z5YE 3WGDA 2L57A 4Z2UA 5IPGA 3LG6A 1F3BA 1T1VA 3QPMA 2FY6A 2H6XA 2X99A 3CYNA 4BVYA 3O3TA 4GSTA 2IFQB 4IQ1A 4EDYA 4JRRA 3I69A 3RPPA 3APSA 2O85A 4MJCA 1KEBA 1Z9HA 4OO5A 1GSUA 4POMA 1T00A 3GKNA 2PU9C 3G7IA 1S3AA 5F0GA 1MTCA 3KH9A 3GKKA 1A24A 1DUGA 5AIXA 3DKSA 2IMDA 2I1UA 4CW9A 1TDIA 3KMOA 4JE1A 3HZ8A 2P0GA 5HR1A 3TKSE 3H4KA 3SWLA 4MK3A 4PQ1A 3QD9A 5BRTA 2F3MA 1QFNA 3BOAA 2C8UA 3HJMA 4RUVA 4P3YB 3PR8A 2CVBA 2OE1A 2I81A 3GRXA 2DJJA 2WULA 4PTSA 2C3NA 4TRXA 4RQRA 1R7HA 2A4VA 1XW6A 1V40A 3C73A 1SKWB 2K8SA 2QA1A 1SU9A 4I5QA 2H74A 3RPNA 1TKDB 3A5IA 4KSMA 2GZZA 4KSOA 1YQ1A 3MYDA 2RUEA 3ZLPA 2J9HA 2IMKA 5GAPD 1SJ6A 4WBRD 3VWWA 2C0DA 3DGQA 1A23A 1PX7A 2GGTA 1EWXA 3A3TA 1KTEA 1G6WA 1OAZA 4MF5A 4HDEA 2VCTA 1HYUA 2I9HA 4EO3A 2I4AA 2MMZA 2FWHA 1SK0A 2AHEA 1AC1A 5GZZB 1J0FA 4AJ7A 5CO3A 2VL2C 2RUFA 1A2MA 4LL1B 1YKCA 1EV9A 1O8WA 1FOVA 1JZDA 2ALBA 3E0UA 3GURA 1ABAA 2CX3A 2DJ3A 5H5SA 5HFIA 3FYGA 4HU7A 2X8GA 2YV7A 2KOKA 4KA0A 4Z2TA 1GP1A 2IMIA 1EEJA 2TIRA 3M9JA 4IS0A 2I3YA 3N9JA 3TJBA 4ZB8A 1XXUA 3QR6A 1VF4A 1G7EA 4O5QA 4ZB6A 5J9BA 5ECNB 2FD3A 2R6KA 2E0QA 2TRXA 1CQGA 1U88A 2HRKA 2MMOA 4F03A 2A4HA 2VM2A 5DBQA 5JCUA 5FT3A 2KP2A 4N0ZA 1GUKA 2XBQA 2H19A 4ZILA 3FK8A 5ECQB 2VO4A 3IE3A 4KUNA 2V6OA 1ML6A 1MEKA 2WJUA 2NBSA 2L4QA 2UZ8A 2H6YA 4ILFA 3ZZXA 1VGLA 2H76A 4TR4A 3ZRDA 12GSA 1A0RP 10GSA 3RBTA 1SD8A 2H73A 3ZMLA 4YQMA 2WFCA 4BWQA 3GX0A 3PH9A 2YANA 4J56E 3WGXA 1VRSD 2HFDA 3UBKA 4ID0A 2GSTA 4NHZA 5B8AA 4TOPA 3ISOA 1GSYA 3BCKA 1HQOA 1T4ZA 4BL7B 2H0HA 1PRXA 5IMCA 2CA8A 1M9BA 1A2JA 3GL5A 2ES7A 2R4VA 4POBA 1K3YA 1F3AA 2CAQA 3GNJA 3KJYA 1ERWA 1U3AA 1DSBA 5D9TA 2PBJA 4PNFA 2H01A 3FZAA 4IELA 3OR5A 5G1KA 4MH2A 3EPTA 5JCGA 2H75A 2JSYA 4NPBA 1THOA 3W6GA 1BYEA 2HYXA 4FYUA 3TRPA 3US3A 4V2MA 1S3DA 5A4WA 2BTOT 1H75A 1QMVA 1BQ7A 1TI1A 2FUG2 2JZSA 3DIEA 1XW5A 3BBYA 1BG5A 5G5EA 2VL3A 2FHEA 1SJZA 2K8VA 1OE7A 2VOCA 3C1SA 2DJ2A 4HOJA 1PGTA 3MDKA 4K5SA 2A2PA 1OKDA 1THXA 3VI7A 4L5LA 4WBJA 2GT5A 4DSSA 3TKQA 2L5LA 2FWFA 3UIWA 5A5KA 4IVFA 5IO0A 2VD1A 2PMTA 3DVWA 2GZPA 1XVWA 1ZYPA 2PVQA 1R26A 3D5JA 3PINA 3GFKA 3IV4A 1GLPA 4TW5A 1XVQA 1K0AA 3GIXA 4MJAA 3QAWA 1DE1A 3ME8A 1FAAA 2H66A 4HS1A 1JZOA 2IN3A 4N10A 2LSTA 2H6ZA 3IXRA 4HEA2 2JZRA 2YWIA 1Z6NA 4YQUA 4D73A 2GSQA 2OBIA 5CRWA 1A8LA 7GSSA 1OYJA 4NMUA 3WT1A 2HE3A 4USSA 2C3TA 4ECJA 2P5RA 3DMLA 3KIJA 1FB0A 6GSYA 3ED3A 5D8IA 1WIKA 1MD3A 4K7IA 3GKMA 3TJFA 5KN1A 3GX8A 5B6NA 1ZGNA 4CY8A 1HNCA 2F51A 1O73A 5ELAA 2ZCTA 4ISDA 5KOWA 4FIWA 4D73B 3LGCA 1OC9B 4OFTA 2MYGA 4XRDA 2IMFA 4WETA 5DCGA 5ECSA 6GSXA 1XCCA 2N5AA 4RI6A 3F4TA 5HR0A 4K9ZA 3ZTLA 2RM6A 5G5FA 8GSSA 1SL1B 4DSQA 1NSWA 1RQMA 5G2ZA 2E7PA 5JCWA 1GNEA 4EDZA 2HSMA 2VUPA 3H79A 5A4VA 2HI7A 1Z7RA 3CSIA 3WYWA 4O5RA 1NHYA 3AY8A 1WMJA 2LJKA 1PN0A 5AGYA 4G0LA 2QC7A 5DQYA 5E4WA 1K0NA 1I9DA 4FO5A 4MDCA 1NHOA 1TK0B 3EINA 4KX4A 4KDYA 3F63A 1O8XA 3HCZA 2GVPA 1WP0A 4IHUA 1H4OA 2H30A 4ZIJA 2LQOA 1F2EA 4KF9A 5D96A 3L4NA 2XPEA 3GMFA 3P8WA 5EL8A 3ERFA 2B7KA 5GSTA 2LNTA 3GYKA 3QFAC 1SK1A 1G6YA 5D9XA 1K0OA 2MZCA 2JSZA 3DXBA 4H86A 4X4JA 3TB2A 2NTOA 3G7JA 5INYA 2P31A 4L0WA 3UVTA 3FZ5A 1XWAA 5ECKB 1M7TA 3EWLA 1QQ2A 1E2YA 2V41A 1XOAA 3NOFA 1O7UA 2GQLA 4F2IA 3RHBA 1MD4A 4ZBAA 4DSRA 2FWGA 4KDXA 5JWQB 2PUKC 1ERVA 4L8EA 2P5QA 3HA9A 2GLRA 5ECMB 5F05A 1XWGA 4G0IA 2LJAA 3GL3A 2PGTA 1SKSB 2HRNA 4K1FA 4EKZA 3KCMA 3ZL5A 1B9YC 2DKHA 4G19A 1O81A 1X5EA 5COHA 5EPFA 1TTZA 4YAVA 3CBUA 1LBKA 3HVVA 2B6MA 1DBYA 2YNXA 3Q19A 1XPVA 3HZ4A 5ECPB 3W8SA 3HXSA 3V1WA 2A2SA 1GWCA 1ERTA 1V2AA 2EIOA 5CREA 4QL9A 3QAVA 1K0MA 2CZ2A 3HHVA 1JZRA 4HUAA 4YKFA 3H1NA 1GSSA 1Z7PA 3NIVA 2VIMA 1GUMA 2YN1A 3CMIA 4PQHA 3GV1A 4GRFA 3P7XA 2YZHA 1YEPA 2HSHA 4GWRA 1GUHA 2DBCA 1SD9A 4IP1A 3UMAA 3LSZA 4MP4A 4MA9A 2VLTA 3F4SA 5F07A 1JLWA 1Z3EA 2QGVA 3EMXA 2GSSA 1F9MA 4AF2A 2B7JA 5DQSA 3ZFBA 1ILOA 4L5OA 1PMTA 4XS1A 4FYBA 1PL1A 3RHCA 5EY6A 3CRTA 3L9VA 4NV2A 3UOMA 1AQWA 4E8HA 3LW9A 4XRAA 3C8EA 5C04A 5AIVA 5IIZA 4K8MA 1PD21 3J7Yb 1PSQA 4HQZA 1O85A 1QK8A 4QQ7A 1EV4A 5JWOB 5E59A 1XW9A 2CQ9A 4POKA 4AJ6A 4A5PA 5KEJA 2F9SA 4YKGA 1GSQA 2R5GA 2KLXA 5ECHB 3MNGA 4GQCA 3MWHA 2XBIA 3QAGA 4WF4A 3KGKA 2K6VA 3IHGA 1TXXA 4RQXA 3TRXA 3VWXA 5KN0A 4OCEA 1X9MB 5DALA 5J3RA 3I6AA 2J23A 2ZUPA 3APQA 1WJKA 5AN1A 2MBSA 3D0ZA 3EURA 1R4WA 3D4TA 3TRQA 2DIYA 2VM1A 4I2UA 2O89A 1EOHA 2DJ1A 3UVHA 1RK4A 3FR3A 2NPBA 1W89A 2BJXA 1K0BA 1WPIA 4Q5QA 2B3SA 1OC8A 3C71A 2PPTA 5DALB 3QMXA 1GSDA 1AUCA 4G2EA 2C0GA 3CRUA 1FVKA 5KN3A 4PQIA 4YQVA 1ERUA 1GLQA 1G7OA 3L9UA 4GTUA 4BL7A 1JHBA 3IHQA 2M80A 3IRAA 3GHAA 2H0IA 5DJMA 4MZBA 3KMNA 2MMNA 4WEYA 3HDCA 1YDKA 2H1GA 2OACA 1GTUA 2OA7A 4K5RA 3PGTA 2HNLA 3HD5A 3DEXA 1YZXA 2LNSA 4O92A 3IC8A 3F0IA 1PQNA 4KAEA 3F8UA 4TR0A 4BPYA 5D9VA 2B1KA 2E2GA 1C72A 2DC5A 2G0FA 5ECOB 20GSA 1AIUA 3TJGA 5C00A 4MPFA 2AYTA 3DRNA 14GSA 1XWCA 4RI7A 5J5NA 3G9BA 11GSA 18GSA 2FGXA 3EMPA 5DDLA 1VF1A 1Y6EA 2E2MA 5ENUA 1USBA 2AJQB 3UJ1A 5DAKB 3IA1A 3SBCA 5B6MA 3CTFA 5HFGA 2AUVA 3VURA 1F6MC 1BEDA 1TI3A 4KNDA 4PURA 3KZQA 2EIQA 4JBBA 1XOBA 1U6TA 5GSSA 4NAXA 1PN9A 3S9FA 2VCXA 2CX4A 1XZOA 3C1RA 5HQPA 1BJXA 2H8LA 2H1BA 2NDOA 1ACVA 4POLA 2C4JA 3LWAA 3APOA 5J4UA 1UN2A 4XCSA 3IAS2 1PKWA 5D73A 4IP6A 6GSTA 2M72A 2AB6A 2R0CA 1FVJA 1J08A 1TW9A 3TCOA 5B7CA 3ZIJA 1FG4A 3GH9A 4KE3A 1K3OA 4G9HA 3R2QA 1V98A 2VLVA 2FCHA 3HYPA 1T4YA 4ECIA 5LCZA 1YKAA 3ERGA 1EOGA 2WCIA 2XPDA 2FWEA 2VLUA 3KP8A 1GRXA 3KTBA 3ZVJA 5KOXA 1UC7A 3F9UA 4HZ2A 4EC0A 4EE0A 3LYKA 2GT6A 4ZB9A 2IJYA 5ABRA 1GL8A 4N0VA 5H5QA 2B1LA 2A2RA 3IPZA 3TKRA 4JU5A 1HNAA 4MJBA 4ZBDA 2V32A 3E3EA 4I2TA 4TN8A 3QDNA 2BMXA 1RW1A 6GSUA 3GKXA 1U87A 1OC9A 1FW1A 1GH2A 4MABA 2YWNA 5DCHA 3ZREA 1OKTA 2LV3A 1PL2A 3H8QA 1M2DA 3F6FA 4YH2A 4XS4A 5D9WA 1TRSA 5B8BA 2IIYA 5ECIB 1GTIA 3TOTA 1A8YA 2WB9A 4ZBBA 2DJ0A 1TU7A 3IBHA 2F8FA 3CXGA 1EGRA 2YJHA 4ACSA 4IQAA 5A4UA 1ZCPA 5ID2B 1T7PB 4TR1B 1FO5A 3CTGA 1X9WB 3D4MA 22GSA 2B5YA 3ZFLA 5G30A 3TKSA 3TJJA 2GQMA 4XS4B 4K0GA 4LMWA 3VWVA 4EVMA 3ERWA 2C80A 1B4PA 2Z9SA 4V1Ag 1SKRB 2B5EA 5AISA 5LNKe 5KN2A 4PXOA 2QKEA 4ZXGA 2ON5A 1Z6MA 3HY2A 3VFIA 2JADA 5CRDA 4GF0A 4YAPA 4N11A 4XHMA 2GS3A 3M8NA 3WT2A 3IK7A 3F6DA 1ZL9A 1V57A 4PUAA 6GSVA 1GNWA 3NZNA 3D6IA 3LFLA 5IMZA 4IJIA 2PVOC 2VL9A 2WZ9A 2CVDA 3G7YA 3VWUA 1LU4A 2LS5A 4LMVA 2AV4A 4JR4A 2VAFA 3KH7A 2KHPA 3FW2A 1W4VA 3VK9A 1E6BA 1B48A 1AXDA 3TDGA 3DD3A 19GSA 1SENA 4XS6A 2OADA 4PGTA 4WF5A 2GZYA 2V6KA 2VD0A 3LXTA 3LYPA 4ZL7A 3FY7A 4MH3A 3J7Yk 4V2LA 4HZ4A 3M3MA 3A2VA 1V9WA 4OWYA 4TXOB 1N8JA 3TUEA 2LTKA 2CV4A 2LQQA 3M0FA 1HNBA 4O5UA 1URMA 3VPQA 2IL3A 4F82A 4ECCA 1JFUA 5CAXA 2H0GA 1BX9A 4GXZA 2DMLA 4GLTA 2GDRA 5HFKA 4ICYA 3R3EA 2XC2A 1ZYQB 3BJ5A 3FHKA 5L71A 2C3QA 4DEJA 4E8EA 4NHWA 4EIQA 1KNGA 1TP9A 3L78A 1N2AA 3A5WA 2HZFA 1MDIA 1DE2A 3I43A 3TKSC 2OBKA 2YCDA 2GTUA 2JACA 1XFLA 2HZEA 3GN3A 1NW2A 5CYYA 3QOUA 5BMUA 1X5CA 3GSTA 4Q5RA 4GQFA 2KUCA 3CSJA 2OKAA 1GULA 5ECLB 4MCUA 2HRFA 1EP7A 3UEMA 1ON4A 2RLIA 1OC3A 2L59A 3EVIA 3WD6A 3QCPA 1ZZYA 4EL1A 1F37A 2JL4A 4HU9A 2YP6A 2HSYA 2AAWA 4LLRA 2PN8A 2X49A 2YV9A 4BVYB 4Z2RA 4HQSA 3BCIA 2HZEB 2R2JA 1SYXA 1B4QA 4K2DA 2NVLA 4OFNA 1VF3A 3U5RE 4I97A 5LD0A 1EEMA 2X64A 1K0CA 2MBTA 2VCQA 1WRYA 4GSNA 4AJ8A 3O6TA 3FMWA 4LA1A 6GSWA 1I5GA 4L0UA 5J9CA 2FA4A 3LXZA 6GSSA 3IC4A 4DVCA 4X43A 3ME7A 2VCWA 2H70A 4PX1A 4BA7A 2B5XA 2MMAA 3I9V2 3UL3A 4F0BA 3EE2A 1TRUA 5G1LA 1Q98A 2OE3A 4WXTA 4G0KA 4OMVA 2C1YA 3W8JA 4NWYA 3C7MA 3TKPA 3P2AA 2IMEA 2K18A 3L0HA 1YF0A 3LQ7A 4WR5A 3ZMKA 2L4CA 4CDOA 1SK2A 4ML1A 4IJ3A 4F0CA 1EZKA 4O7HA 1FOHA 2YWMA 2K9FA 2F8AA 3GUSA 2PWJA 5DVBA 3EC3A 5CRGA 4TVEA 3UAPA 2L5OA 5CRHA 2YOIA 3CSHA 2HRAA 1M99A 3VPTA 4OFMA 1XWKA 1X5DA 1PKZA 5H5RA 1GTBA 2VCZA 2LKUA 1J9BA 2LJRA 4IW9A 1GTAA 4CHSA 3N5OA 3IK9A 3FR9A 2V1MA 3E9JB 2R3XA 1TJDA 4NXIA 4QL7A 1YY7A 4IKHA 2G2QA 3IR4A 2O87A 5IMAA 2DKIA 5F06A 5IOXA 3HKRA 3H93A 1GSEA 4MF7A 1WWJA 2M46A 1XBSA 1UA5A 4NV5A 2CVKA 4O32A 5DAKA 1TK5B 1EP8A 17GSA 4N30A 4WKWA 3LJRA 5FWGA 3KM6A 2FLSA 3LORA 2LRNA 4JEDA 4ZL9A 1HD2A 1MDJA 2VCVA 1JZWA 1UVZA 3P90A 4OCFA 2V2GA 2IWTA 2YWOA 3F3QA 4TR3A 3IOSA 1M9AA 4KW6A 4MZWA 3M1GA 2JZTA 1MDKA 3KXOA 4HJ2A 1ST9A 3KTLA 4FH8A 4K7NA 2ZNMA 1X0RA 2O7KA 3LEFA 5HR3A 5ECRB 3BD2A 3RDWA 1X9SB 2DJKA 2DMMA 1TOFA 2LUSA 16GSA 2H71A 4KCEA 3UARA 2GSRA 5G31A 2X8CA 4BWSA 3KD0A 1SL0B 1WOUA 4IN0A 3Q6OA 1M0UA 1OVNA 4I8BA 4HJMA 4KDUA 2XHFA 3HVXA 5D93A 3MSZA 5EVOA 1WE0A 5J41A 2N5BA 2C0FA 3O76A 4BVXA 4TKYA 4OD7A 2DLXA 1O6JA 2N5FA 4J2FA 2QSIA 1TU8A 3GTUA 3EU3A 4KGIA 4WR4A 5CNWA 2REMA 3Q74A 2EC4A 2YZUA 1PA3A 1VF2A 2EIRA 5GAND 3PPUA 1S3CA 1YF1A 4JZQA 2R0PA 1M2BA 4MLYA 3KEBA 1T3BA 4G10A 3KP9A 1B9XC 4ZL8A 1V58A 4K7OA 4LL4B 4EXJA 2OE0A 2FA8A 2H1DA 1A2LA 2CT6A 3L9SA 3FRCA 3TJKA 4K2XA 1R5AA 1AQXA 4MNNA 4BVXB 1TRWA 3K8NA 3MIXA 1LJRA 13GSA 3HJOA 4K0NA 4IGJA 4XTSA 1AW9A 3GTUB 1AQVA 1QXHA 4F9ZA 4V1Ap 3RAZA 4JR6A 1T8EB 4PNGA 3ZIVA 5F8BA 3TGZA 3ZVJD 3A2WA 3FKFA 3HJPA 4TXVA 2DSAA 1FB6A 1TRVA 5IO2A 1PX6A 2RIIA 1M2AA 5ID2A 2LEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TR1 A;  3IAM 2;  3DYR A;  4KCA A;  3A2X A;  4DSS B;  2WGR A;  4MPG A;  1SJI A;  2X8H A;  3VI5 A;  2PER A;  2H72 A;  1YEX A;  1YJ6 A;  3FEU A;  4J57 E;  2IPA A;  2D2Z A;  1XWB A;  1TK8 B;  3TOU A;  5DJL A;  4IBP A;  4ECB A;  5HR2 A;  1K3L A;  4V2N A;  3QFB C;  4X0X A;  2TRC P;  3GSS A;  3U6V A;  3IDV A;  1SYR A;  2HXK A;  4Q5N A;  2WRT A;  1ZYE A;  5IM9 A;  2CAI A;  4MZC A;  1CQH A;  3GH6 A;  2YJ7 A;  1ZOF A;  3EU4 A;  4GSS A;  1R5P A;  3ZYW A;  1QUW A;  3JCM L;  1Y25 A;  3GA4 A;  2LRC A;  2JU5 A;  4K6X A;  2YPM A;  3VLN A;  4KH7 A;  3D22 A;  1G0T A;  4KB3 A;  3Q18 A;  3FR6 A;  4HI7 A;  1AAZ A;  4ULX A;  2L6C A;  1JLV A;  4PUF C;  2O8V B;  5IMD A;  4OO4 A;  5JWR B;  4Q5F A;  5FHI A;  5IMV A;  1XIY A;  1EGO A;  2ON7 A;  4EUY A;  5IQY A;  4X1U A;  2WS2 A;  4TXO A;  2KP1 A;  2DIZ A;  1SL2 B;  3ZIT A;  1B8X A;  2L6D A;  3D21 A;  2HT9 A;  2WDU A;  1KBN A;  3F3R A;  5IMF A;  5ELG A;  3DVX A;  1ZMA A;  1QGV A;  1IYI A;  3EYT A;  2OJL A;  4MMM A;  1IYH A;  1NM3 A;  2C0E A;  1Q4J A;  4FYC A;  1U3I A;  2CZ3 A;  4Z7X A;  2HLS A;  1GSF A;  4GCI A;  5IOW A;  2FNO A;  2LRT A;  3WGE A;  3UBL A;  2R37 A;  1BAY A;  2IFQ A;  3M9K A;  2GQK A;  5IPH A;  3HVS A;  3FZ9 A;  9GSS A;  4I6X A;  3F4R A;  5CP1 A;  4ML6 A;  2VL2 A;  3FZ4 A;  1A0F A;  4EF0 A;  4XIH A;  2RM5 A;  4MF6 A;  4MJE A;  2H1A A;  1K0D A;  3DWV A;  1OE8 A;  1FHE A;  4AGS A;  3MAK A;  1Z5Y E;  3WGD A;  2L57 A;  5IPG A;  3LG6 A;  1F3B A;  1T1V A;  3QPM A;  2FY6 A;  2H6X A;  2X99 A;  3CYN A;  4BVY A;  3O3T A;  4GST A;  2IFQ B;  4IQ1 A;  4EDY A;  4JRR A;  3I69 A;  3RPP A;  3APS A;  2O85 A;  4MJC A;  1KEB A;  1Z9H A;  4OO5 A;  1GSU A;  4POM A;  1T00 A;  3GKN A;  2PU9 C;  3G7I A;  1S3A A;  5F0G A;  1MTC A;  3KH9 A;  3GKK A;  1A24 A;  1DUG A;  5AIX A;  3DKS A;  2IMD A;  2I1U A;  4CW9 A;  1TDI A;  3KMO A;  4JE1 A;  3HZ8 A;  2P0G A;  5HR1 A;  3TKS E;  3H4K A;  3SWL A;  4MK3 A;  4PQ1 A;  3QD9 A;  2F3M A;  1QFN A;  3BOA A;  2C8U A;  3HJM A;  4RUV A;  4P3Y B;  3PR8 A;  2CVB A;  2OE1 A;  2I81 A;  3GRX A;  2DJJ A;  2WUL A;  2C3N A;  4TRX A;  4RQR A;  1R7H A;  2A4V A;  1XW6 A;  1V40 A;  3C73 A;  1SKW B;  2K8S A;  1SU9 A;  4I5Q A;  2H74 A;  3RPN A;  1TKD B;  4KSM A;  2GZZ A;  4KSO A;  1YQ1 A;  2RUE A;  3ZLP A;  2J9H A;  2IMK A;  5GAP D;  1SJ6 A;  4WBR D;  3VWW A;  2C0D A;  3DGQ A;  1A23 A;  1PX7 A;  2GGT A;  1EWX A;  3A3T A;  1KTE A;  1G6W A;  1OAZ A;  4MF5 A;  4HDE A;  2VCT A;  1HYU A;  2I9H A;  4EO3 A;  2I4A A;  2MMZ A;  2FWH A;  1SK0 A;  2AHE A;  1AC1 A;  5GZZ B;  1J0F A;  4AJ7 A;  5CO3 A;  2VL2 C;  2RUF A;  1A2M A;  4LL1 B;  1YKC A;  1EV9 A;  1O8W A;  1FOV A;  1JZD A;  2ALB A;  3E0U A;  3GUR A;  1ABA A;  2CX3 A;  2DJ3 A;  5H5S A;  5HFI A;  3FYG A;  4HU7 A;  2X8G A;  2YV7 A;  2KOK A;  4KA0 A;  1GP1 A;  2IMI A;  1EEJ A;  2TIR A;  3M9J A;  4IS0 A;  2I3Y A;  3N9J A;  3TJB A;  4ZB8 A;  1XXU A;  3QR6 A;  1VF4 A;  1G7E A;  4ZB6 A;  5J9B A;  5ECN B;  2FD3 A;  2R6K A;  2E0Q A;  2TRX A;  1CQG A;  1U88 A;  2MMO A;  4F03 A;  2VM2 A;  5DBQ A;  5JCU A;  5FT3 A;  2KP2 A;  4N0Z A;  1GUK A;  2XBQ A;  2H19 A;  4ZIL A;  3FK8 A;  5ECQ B;  2VO4 A;  3IE3 A;  4KUN A;  2V6O A;  1ML6 A;  1MEK A;  2WJU A;  2NBS A;  2L4Q A;  4ILF A;  2H6Y A;  3ZZX A;  1VGL A;  2H76 A;  4TR4 A;  3ZRD A;  12GS A;  1A0R P;  10GS A;  3RBT A;  1SD8 A;  2H73 A;  3ZML A;  4YQM A;  2WFC A;  4BWQ A;  3GX0 A;  3PH9 A;  2YAN A;  4J56 E;  3WGX A;  1VRS D;  2HFD A;  3UBK A;  4ID0 A;  2GST A;  4NHZ A;  5B8A A;  4TOP A;  3ISO A;  1GSY A;  3BCK A;  1HQO A;  1T4Z A;  2H0H A;  1PRX A;  5IMC A;  2CA8 A;  1M9B A;  1A2J A;  3GL5 A;  2ES7 A;  2R4V A;  4POB A;  1K3Y A;  1F3A A;  2CAQ A;  3GNJ A;  3KJY A;  1ERW A;  1U3A A;  1DSB A;  5D9T A;  2PBJ A;  4PNF A;  2H01 A;  3FZA A;  4IEL A;  3OR5 A;  5G1K A;  4MH2 A;  5JCG A;  2H75 A;  2JSY A;  4NPB A;  1THO A;  3W6G A;  1BYE A;  2HYX A;  4FYU A;  3TRP A;  3US3 A;  4V2M A;  1S3D A;  5A4W A;  2BTO T;  1H75 A;  1QMV A;  1BQ7 A;  1TI1 A;  2FUG 2;  2JZS A;  3DIE A;  1XW5 A;  3BBY A;  1BG5 A;  5G5E A;  2VL3 A;  2FHE A;  1SJZ A;  2K8V A;  1OE7 A;  2VOC A;  3C1S A;  2DJ2 A;  4HOJ A;  1PGT A;  3MDK A;  1OKD A;  1THX A;  3VI7 A;  4L5L A;  4WBJ A;  2GT5 A;  4DSS A;  3TKQ A;  2L5L A;  2FWF A;  3UIW A;  5A5K A;  4IVF A;  5IO0 A;  2VD1 A;  2PMT A;  3DVW A;  2GZP A;  1XVW A;  2PVQ A;  1R26 A;  3D5J A;  3PIN A;  3GFK A;  3IV4 A;  1GLP A;  4TW5 A;  1XVQ A;  1K0A A;  3GIX A;  4MJA A;  3QAW A;  1DE1 A;  3ME8 A;  1FAA A;  2H66 A;  4HS1 A;  1JZO A;  2IN3 A;  4N10 A;  2LST A;  2H6Z A;  3IXR A;  4HEA 2;  2JZR A;  2YWI A;  1Z6N A;  4YQU A;  4D73 A;  2GSQ A;  2OBI A;  5CRW A;  1A8L A;  7GSS A;  1OYJ A;  4NMU A;  3WT1 A;  2HE3 A;  2C3T A;  4ECJ A;  2P5R A;  3DML A;  3KIJ A;  1FB0 A;  6GSY A;  3ED3 A;  5D8I A;  1WIK A;  1MD3 A;  4K7I A;  3GKM A;  3TJF A;  5KN1 A;  3GX8 A;  5B6N A;  1ZGN A;  1HNC A;  2F51 A;  1O73 A;  5ELA A;  2ZCT A;  4ISD A;  4FIW A;  4D73 B;  3LGC A;  1OC9 B;  4OFT A;  2MYG A;  4XRD A;  2IMF A;  4WET A;  5DCG A;  5ECS A;  6GSX A;  1XCC A;  2N5A A;  4RI6 A;  3F4T A;  5HR0 A;  4K9Z A;  3ZTL A;  2RM6 A;  5G5F A;  8GSS A;  1SL1 B;  4DSQ A;  1NSW A;  1RQM A;  5G2Z A;  2E7P A;  5JCW A;  1GNE A;  4EDZ A;  2VUP A;  3H79 A;  5A4V A;  2HI7 A;  1Z7R A;  3CSI A;  3WYW A;  4O5R A;  1NHY A;  3AY8 A;  1WMJ A;  2LJK A;  5AGY A;  2QC7 A;  5DQY A;  5E4W A;  1K0N A;  1I9D A;  4FO5 A;  4MDC A;  1NHO A;  1TK0 B;  3EIN A;  4KX4 A;  4KDY A;  3F63 A;  1O8X A;  3HCZ A;  2GVP A;  1WP0 A;  4IHU A;  1H4O A;  2H30 A;  4ZIJ A;  2LQO A;  1F2E A;  5D96 A;  3L4N A;  2XPE A;  3GMF A;  3P8W A;  5EL8 A;  3ERF A;  2B7K A;  5GST A;  2LNT A;  3GYK A;  3QFA C;  1SK1 A;  1G6Y A;  5D9X A;  1K0O A;  2MZC A;  2JSZ A;  3DXB A;  4H86 A;  3TB2 A;  2NTO A;  3G7J A;  5INY A;  2P31 A;  4L0W A;  3UVT A;  3FZ5 A;  1XWA A;  5ECK B;  1M7T A;  3EWL A;  1QQ2 A;  1E2Y A;  2V41 A;  1XOA A;  3NOF A;  1O7U A;  2GQL A;  4F2I A;  3RHB A;  1MD4 A;  4ZBA A;  4DSR A;  2FWG A;  4KDX A;  5JWQ B;  2PUK C;  1ERV A;  4L8E A;  2P5Q A;  3HA9 A;  2GLR A;  5ECM B;  5F05 A;  1XWG A;  2LJA A;  3GL3 A;  2PGT A;  1SKS B;  2HRN A;  4K1F A;  4EKZ A;  3KCM A;  3ZL5 A;  1B9Y C;  4G19 A;  1O81 A;  1X5E A;  5COH A;  5EPF A;  1TTZ A;  4YAV A;  3CBU A;  1LBK A;  3HVV A;  2B6M A;  1DBY A;  2YNX A;  3Q19 A;  1XPV A;  5ECP B;  3HZ4 A;  3W8S A;  3HXS A;  3V1W A;  2A2S A;  1GWC A;  1ERT A;  1V2A A;  2EIO A;  5CRE A;  4QL9 A;  3QAV A;  1K0M A;  2CZ2 A;  3HHV A;  1JZR A;  4HUA A;  3H1N A;  1GSS A;  1Z7P A;  3NIV A;  2VIM A;  1GUM A;  2YN1 A;  3CMI A;  4PQH A;  3GV1 A;  4GRF A;  3P7X A;  2YZH A;  1YEP A;  2HSH A;  4GWR A;  1GUH A;  2DBC A;  1SD9 A;  4IP1 A;  3UMA A;  3LSZ A;  4MP4 A;  4MA9 A;  2VLT A;  3F4S A;  5F07 A;  1JLW A;  1Z3E A;  2QGV A;  3EMX A;  2GSS A;  1F9M A;  4AF2 A;  2B7J A;  5DQS A;  3ZFB A;  1ILO A;  4L5O A;  1PMT A;  4XS1 A;  4FYB A;  1PL1 A;  3RHC A;  5EY6 A;  3CRT A;  3L9V A;  4NV2 A;  3UOM A;  1AQW A;  4E8H A;  4XRA A;  3C8E A;  5C04 A;  5AIV A;  5IIZ A;  4K8M A;  1PD2 1;  3J7Y b;  1PSQ A;  4HQZ A;  1O85 A;  1QK8 A;  4QQ7 A;  1EV4 A;  5JWO B;  5E59 A;  1XW9 A;  2CQ9 A;  4POK A;  4AJ6 A;  5KEJ A;  2F9S A;  1GSQ A;  2R5G A;  2KLX A;  5ECH B;  3MNG A;  4GQC A;  3MWH A;  2XBI A;  3QAG A;  4WF4 A;  3KGK A;  2K6V A;  1TXX A;  4RQX A;  3TRX A;  3VWX A;  5KN0 A;  4OCE A;  1X9M B;  5DAL A;  5J3R A;  3I6A A;  2J23 A;  2ZUP A;  3APQ A;  1WJK A;  5AN1 A;  2MBS A;  3D0Z A;  3EUR A;  1R4W A;  3D4T A;  3TRQ A;  2DIY A;  2VM1 A;  4I2U A;  2O89 A;  1EOH A;  2DJ1 A;  3UVH A;  1RK4 A;  3FR3 A;  2NPB A;  1W89 A;  2BJX A;  1K0B A;  1WPI A;  4Q5Q A;  2B3S A;  1OC8 A;  3C71 A;  2PPT A;  5DAL B;  3QMX A;  1GSD A;  1AUC A;  4G2E A;  2C0G A;  3CRU A;  1FVK A;  5KN3 A;  4PQI A;  4YQV A;  1ERU A;  1GLQ A;  1G7O A;  3L9U A;  4GTU A;  4BL7 A;  1JHB A;  3IHQ A;  2M80 A;  3IRA A;  3GHA A;  2H0I A;  5DJM A;  4MZB A;  3KMN A;  2MMN A;  4WEY A;  3HDC A;  1YDK A;  2H1G A;  2OAC A;  1GTU A;  2OA7 A;  3PGT A;  2HNL A;  3HD5 A;  3DEX A;  1YZX A;  2LNS A;  4O92 A;  3F0I A;  1PQN A;  4KAE A;  3F8U A;  4TR0 A;  4BPY A;  5D9V A;  2B1K A;  2E2G A;  1C72 A;  2DC5 A;  2G0F A;  5ECO B;  20GS A;  1AIU A;  3TJG A;  5C00 A;  4MPF A;  2AYT A;  3DRN A;  14GS A;  1XWC A;  4RI7 A;  5J5N A;  3G9B A;  11GS A;  18GS A;  2FGX A;  3EMP A;  5DDL A;  1VF1 A;  1Y6E A;  2E2M A;  5ENU A;  1USB A;  2AJQ B;  3UJ1 A;  5DAK B;  3IA1 A;  3SBC A;  5B6M A;  3CTF A;  5HFG A;  2AUV A;  3VUR A;  1F6M C;  1BED A;  1TI3 A;  4KND A;  4PUR A;  3KZQ A;  2EIQ A;  4JBB A;  1XOB A;  1U6T A;  5GSS A;  4NAX A;  1PN9 A;  3S9F A;  2VCX A;  2CX4 A;  1XZO A;  3C1R A;  5HQP A;  1BJX A;  2H8L A;  2H1B A;  2NDO A;  1ACV A;  4POL A;  2C4J A;  3LWA A;  3APO A;  5J4U A;  1UN2 A;  4XCS A;  3IAS 2;  1PKW A;  5D73 A;  4IP6 A;  6GST A;  2M72 A;  2AB6 A;  1FVJ A;  1J08 A;  1TW9 A;  3TCO A;  5B7C A;  3ZIJ A;  1FG4 A;  3GH9 A;  4KE3 A;  1K3O A;  4G9H A;  3R2Q A;  1V98 A;  2VLV A;  2FCH A;  3HYP A;  1T4Y A;  4ECI A;  5LCZ A;  1YKA A;  3ERG A;  1EOG A;  2WCI A;  2XPD A;  2FWE A;  2VLU A;  3KP8 A;  1GRX A;  3KTB A;  3ZVJ A;  1UC7 A;  3F9U A;  4HZ2 A;  4EC0 A;  4EE0 A;  3LYK A;  2GT6 A;  4ZB9 A;  2IJY A;  5ABR A;  1GL8 A;  4N0V A;  5H5Q A;  2B1L A;  2A2R A;  3IPZ A;  3TKR A;  4JU5 A;  1HNA A;  4MJB A;  4ZBD A;  2V32 A;  3E3E A;  4I2T A;  4TN8 A;  3QDN A;  2BMX A;  1RW1 A;  6GSU A;  3GKX A;  1U87 A;  1OC9 A;  1FW1 A;  1GH2 A;  4MAB A;  2YWN A;  5DCH A;  3ZRE A;  1OKT A;  2LV3 A;  1PL2 A;  3H8Q A;  1M2D A;  3F6F A;  4YH2 A;  4XS4 A;  5D9W A;  1TRS A;  5B8B A;  2IIY A;  5ECI B;  1GTI A;  3TOT A;  1A8Y A;  2WB9 A;  4ZBB A;  2DJ0 A;  1TU7 A;  3IBH A;  2F8F A;  3CXG A;  1EGR A;  2YJH A;  4ACS A;  4IQA A;  5A4U A;  1ZCP A;  5ID2 B;  1T7P B;  4TR1 B;  1FO5 A;  3CTG A;  1X9W B;  3D4M A;  22GS A;  2B5Y A;  3ZFL A;  5G30 A;  3TKS A;  3TJJ A;  2GQM A;  4XS4 B;  4K0G A;  4LMW A;  3VWV A;  4EVM A;  3ERW A;  2C80 A;  1B4P A;  2Z9S A;  4V1A g;  1SKR B;  2B5E A;  5AIS A;  5LNK e;  5KN2 A;  4PXO A;  2QKE A;  4ZXG A;  2ON5 A;  1Z6M A;  3HY2 A;  3VFI A;  2JAD A;  5CRD A;  4GF0 A;  4YAP A;  4N11 A;  4XHM A;  2GS3 A;  3M8N A;  3WT2 A;  3IK7 A;  3F6D A;  1ZL9 A;  1V57 A;  4PUA A;  6GSV A;  1GNW A;  3NZN A;  3D6I A;  3LFL A;  5IMZ A;  4IJI A;  2PVO C;  2VL9 A;  2WZ9 A;  2CVD A;  3G7Y A;  3VWU A;  1LU4 A;  2LS5 A;  4LMV A;  2AV4 A;  4JR4 A;  2VAF A;  3KH7 A;  2KHP A;  3FW2 A;  1W4V A;  3VK9 A;  1E6B A;  1B48 A;  1AXD A;  3TDG A;  3DD3 A;  19GS A;  1SEN A;  4XS6 A;  2OAD A;  4PGT A;  4WF5 A;  2GZY A;  2V6K A;  2VD0 A;  3LXT A;  3LYP A;  4ZL7 A;  3FY7 A;  4MH3 A;  3J7Y k;  4V2L A;  4HZ4 A;  3M3M A;  3A2V A;  1V9W A;  4OWY A;  4TXO B;  1N8J A;  3TUE A;  2LTK A;  2CV4 A;  2LQQ A;  3M0F A;  1HNB A;  1URM A;  3VPQ A;  2IL3 A;  4F82 A;  4ECC A;  1JFU A;  5CAX A;  2H0G A;  1BX9 A;  4GXZ A;  2DML A;  4GLT A;  2GDR A;  5HFK A;  2XC2 A;  1ZYQ B;  3BJ5 A;  3FHK A;  5L71 A;  2C3Q A;  4DEJ A;  4E8E A;  4NHW A;  1KNG A;  1TP9 A;  3L78 A;  1N2A A;  3A5W A;  2HZF A;  1MDI A;  1DE2 A;  3I43 A;  3TKS C;  2OBK A;  2YCD A;  2GTU A;  2JAC A;  1XFL A;  2HZE A;  3GN3 A;  1NW2 A;  5CYY A;  3QOU A;  1X5C A;  3GST A;  4Q5R A;  4GQF A;  2KUC A;  3CSJ A;  2OKA A;  1GUL A;  5ECL B;  4MCU A;  2HRF A;  1EP7 A;  3UEM A;  1ON4 A;  2RLI A;  1OC3 A;  2L59 A;  3EVI A;  3WD6 A;  3QCP A;  1ZZY A;  4EL1 A;  1F37 A;  2JL4 A;  4HU9 A;  2YP6 A;  2HSY A;  2AAW A;  4LLR A;  2PN8 A;  2YV9 A;  4HQS A;  3BCI A;  2HZE B;  2R2J A;  1SYX A;  1B4Q A;  4K2D A;  2NVL A;  4OFN A;  1VF3 A;  3U5R E;  4I97 A;  5LD0 A;  1EEM A;  2X64 A;  1K0C A;  2MBT A;  2VCQ A;  1WRY A;  4GSN A;  4AJ8 A;  3O6T A;  4LA1 A;  6GSW A;  1I5G A;  4L0U A;  5J9C A;  2FA4 A;  3LXZ A;  6GSS A;  3IC4 A;  4DVC A;  4X43 A;  3ME7 A;  2VCW A;  2H70 A;  4PX1 A;  4BA7 A;  2B5X A;  2MMA A;  3I9V 2;  3UL3 A;  4F0B A;  3EE2 A;  1TRU A;  5G1L A;  1Q98 A;  2OE3 A;  4WXT A;  4OMV A;  2C1Y A;  3W8J A;  4NWY A;  3C7M A;  3TKP A;  3P2A A;  2IME A;  2K18 A;  3L0H A;  1YF0 A;  3LQ7 A;  4WR5 A;  3ZMK A;  2L4C A;  4CDO A;  1SK2 A;  4ML1 A;  4IJ3 A;  4F0C A;  1EZK A;  4O7H A;  2YWM A;  2K9F A;  2F8A A;  3GUS A;  2PWJ A;  5DVB A;  3EC3 A;  5CRG A;  4TVE A;  3UAP A;  2L5O A;  5CRH A;  2YOI A;  3CSH A;  1M99 A;  3VPT A;  4OFM A;  1XWK A;  1X5D A;  1PKZ A;  5H5R A;  1GTB A;  2VCZ A;  2LKU A;  1J9B A;  2LJR A;  4IW9 A;  1GTA A;  4CHS A;  3N5O A;  3IK9 A;  3FR9 A;  2V1M A;  3E9J B;  2R3X A;  1TJD A;  4NXI A;  4QL7 A;  1YY7 A;  4IKH A;  2G2Q A;  3IR4 A;  2O87 A;  5IMA A;  5F06 A;  5IOX A;  3HKR A;  3H93 A;  1GSE A;  4MF7 A;  1WWJ A;  2M46 A;  1XBS A;  1UA5 A;  4NV5 A;  2CVK A;  4O32 A;  5DAK A;  1TK5 B;  1EP8 A;  17GS A;  4N30 A;  4WKW A;  3LJR A;  5FWG A;  3KM6 A;  2FLS A;  3LOR A;  2LRN A;  4JED A;  4ZL9 A;  1HD2 A;  1MDJ A;  2VCV A;  1JZW A;  1UVZ A;  3P90 A;  4OCF A;  2V2G A;  2IWT A;  2YWO A;  3F3Q A;  4TR3 A;  3IOS A;  1M9A A;  4KW6 A;  4MZW A;  3M1G A;  2JZT A;  1MDK A;  3KXO A;  4HJ2 A;  1ST9 A;  3KTL A;  4FH8 A;  4K7N A;  2ZNM A;  1X0R A;  2O7K A;  3LEF A;  5HR3 A;  5ECR B;  3BD2 A;  3RDW A;  1X9S B;  2DJK A;  2DMM A;  1TOF A;  2LUS A;  16GS A;  2H71 A;  4KCE A;  3UAR A;  2GSR A;  5G31 A;  2X8C A;  4BWS A;  3KD0 A;  1SL0 B;  1WOU A;  4IN0 A;  3Q6O A;  1M0U A;  1OVN A;  4I8B A;  4HJM A;  4KDU A;  2XHF A;  3HVX A;  5D93 A;  3MSZ A;  5EVO A;  1WE0 A;  5J41 A;  2N5B A;  2C0F A;  3O76 A;  4BVX A;  4TKY A;  4OD7 A;  2DLX A;  1O6J A;  2N5F A;  4J2F A;  2QSI A;  1TU8 A;  3GTU A;  3EU3 A;  4KGI A;  4WR4 A;  5CNW A;  2REM A;  3Q74 A;  2EC4 A;  2YZU A;  1PA3 A;  1VF2 A;  2EIR A;  5GAN D;  1S3C A;  1YF1 A;  4JZQ A;  1M2B A;  4MLY A;  3KEB A;  1T3B A;  4G10 A;  3KP9 A;  1B9X C;  4ZL8 A;  1V58 A;  4K7O A;  4LL4 B;  4EXJ A;  2OE0 A;  2FA8 A;  2H1D A;  1A2L A;  2CT6 A;  3L9S A;  3FRC A;  3TJK A;  1R5A A;  1AQX A;  1TRW A;  3K8N A;  1LJR A;  13GS A;  3HJO A;  4K0N A;  4IGJ A;  4XTS A;  1AW9 A;  3GTU B;  1AQV A;  1QXH A;  4F9Z A;  4V1A p;  3RAZ A;  4JR6 A;  1T8E B;  4PNG A;  3ZIV A;  5F8B A;  3TGZ A;  3ZVJ D;  3A2W A;  3FKF A;  3HJP A;  4TXV A;  2DSA A;  1FB6 A;  1TRV A;  5IO2 A;  1PX6 A;  2RII A;  1M2A A;  5ID2 A;  2LEG A; 
#chains in the Genus database with same CATH topology
 4TR1 A;  3IAM 2;  3DYR A;  4KCA A;  3A2X A;  4DSS B;  2WGR A;  4MPG A;  1SJI A;  2X8H A;  3VI5 A;  2PER A;  2H72 A;  1YEX A;  1YJ6 A;  3FEU A;  4J57 E;  2IPA A;  2D2Z A;  1XWB A;  1TK8 B;  3TOU A;  5DJL A;  4IBP A;  4ECB A;  5HR2 A;  1K3L A;  4V2N A;  3QFB C;  4X0X A;  2TRC P;  3GSS A;  3U6V A;  3IDV A;  1SYR A;  2HXK A;  4Q5N A;  2WRT A;  1ZYE A;  5IM9 A;  2CAI A;  4MZC A;  1CQH A;  3GH6 A;  2YJ7 A;  1ZOF A;  3EU4 A;  4GSS A;  1R5P A;  3ZYW A;  1QUW A;  3JCM L;  1Y25 A;  3GA4 A;  2LRC A;  2JU5 A;  4K6X A;  2X4A A;  2YPM A;  3VLN A;  4KH7 A;  3D22 A;  1G0T A;  4KB3 A;  3Q18 A;  3FR6 A;  2R0G A;  4HI7 A;  1AAZ A;  4ULX A;  2L6C A;  1JLV A;  4PUF C;  2O8V B;  5IMD A;  4OO4 A;  5JWR B;  4Q5F A;  5FHI A;  5IMV A;  1XIY A;  1EGO A;  2ON7 A;  4EUY A;  5IQY A;  4X1U A;  2WS2 A;  4TXO A;  2KP1 A;  2DIZ A;  1SL2 B;  3ZIT A;  1B8X A;  2L6D A;  3D21 A;  2HT9 A;  2WDU A;  1KBN A;  3F3R A;  5IMF A;  5ELG A;  3DVX A;  1ZMA A;  1QGV A;  4BIK A;  1IYI A;  3EYT A;  2OJL A;  4MMM A;  1IYH A;  1NM3 A;  2C0E A;  1Q4J A;  4FYC A;  1U3I A;  2CZ3 A;  4Z7X A;  2HLS A;  1GSF A;  4GCI A;  5IOW A;  2FNO A;  2LRT A;  4FQU A;  3WGE A;  3UBL A;  2R37 A;  1BAY A;  2IFQ A;  3M9K A;  2GQK A;  5IPH A;  3HVS A;  3FZ9 A;  9GSS A;  4I6X A;  3F4R A;  5CP1 A;  4ML6 A;  2QA2 A;  2VL2 A;  3FZ4 A;  1A0F A;  4EF0 A;  4EIP A;  4XIH A;  2RM5 A;  4MF6 A;  4MJE A;  2H1A A;  1K0D A;  3DWV A;  1OE8 A;  1ZYN A;  1FHE A;  4AGS A;  4CY6 A;  3MAK A;  1Z5Y E;  3WGD A;  2L57 A;  4Z2U A;  5IPG A;  3LG6 A;  1F3B A;  1T1V A;  3QPM A;  2FY6 A;  2H6X A;  2X99 A;  3CYN A;  4BVY A;  3O3T A;  4GST A;  2IFQ B;  4IQ1 A;  4EDY A;  4JRR A;  3I69 A;  3RPP A;  3APS A;  2O85 A;  4MJC A;  1KEB A;  1Z9H A;  4OO5 A;  1GSU A;  4POM A;  1T00 A;  3GKN A;  2PU9 C;  3G7I A;  1S3A A;  5F0G A;  1MTC A;  3KH9 A;  3GKK A;  1A24 A;  1DUG A;  5AIX A;  3DKS A;  2IMD A;  2I1U A;  4CW9 A;  1TDI A;  3KMO A;  4JE1 A;  3HZ8 A;  2P0G A;  5HR1 A;  3TKS E;  3H4K A;  3SWL A;  4MK3 A;  4PQ1 A;  3QD9 A;  5BRT A;  2F3M A;  1QFN A;  3BOA A;  2C8U A;  3HJM A;  4RUV A;  4P3Y B;  3PR8 A;  2CVB A;  2OE1 A;  2I81 A;  3GRX A;  2DJJ A;  2WUL A;  4PTS A;  2C3N A;  4TRX A;  4RQR A;  1R7H A;  2A4V A;  1XW6 A;  1V40 A;  3C73 A;  1SKW B;  2K8S A;  2QA1 A;  1SU9 A;  4I5Q A;  1PFO A;  2H74 A;  3RPN A;  1TKD B;  3A5I A;  4KSM A;  2GZZ A;  4KSO A;  1YQ1 A;  3MYD A;  2RUE A;  3ZLP A;  2J9H A;  2IMK A;  5GAP D;  1SJ6 A;  4WBR D;  3VWW A;  1M3I A;  2C0D A;  3DGQ A;  1A23 A;  1PX7 A;  2GGT A;  1EWX A;  3A3T A;  1KTE A;  1G6W A;  1OAZ A;  4MF5 A;  4HDE A;  2VCT A;  1HYU A;  2I9H A;  4EO3 A;  2I4A A;  2MMZ A;  2FWH A;  1SK0 A;  2AHE A;  1AC1 A;  5GZZ B;  1J0F A;  4AJ7 A;  5CO3 A;  2VL2 C;  2RUF A;  1A2M A;  4LL1 B;  1YKC A;  1EV9 A;  1O8W A;  1FOV A;  1JZD A;  2ALB A;  3E0U A;  3GUR A;  1ABA A;  2CX3 A;  2DJ3 A;  5H5S A;  5HFI A;  3FYG A;  4HU7 A;  2X8G A;  2YV7 A;  2KOK A;  4KA0 A;  4Z2T A;  1GP1 A;  2IMI A;  1EEJ A;  2TIR A;  3M9J A;  4IS0 A;  2I3Y A;  3N9J A;  3TJB A;  4ZB8 A;  1XXU A;  3QR6 A;  1VF4 A;  1G7E A;  4O5Q A;  4ZB6 A;  5J9B A;  5ECN B;  2FD3 A;  2R6K A;  2E0Q A;  2TRX A;  1CQG A;  1U88 A;  2HRK A;  2MMO A;  4F03 A;  2A4H A;  2VM2 A;  5DBQ A;  5JCU A;  5FT3 A;  2KP2 A;  4N0Z A;  1GUK A;  2XBQ A;  2H19 A;  4ZIL A;  3FK8 A;  5ECQ B;  2VO4 A;  3IE3 A;  4KUN A;  2V6O A;  1ML6 A;  1MEK A;  2WJU A;  2NBS A;  2L4Q A;  2UZ8 A;  2H6Y A;  4ILF A;  3ZZX A;  1VGL A;  2H76 A;  4TR4 A;  3ZRD A;  12GS A;  1A0R P;  10GS A;  3RBT A;  1SD8 A;  2H73 A;  3ZML A;  4YQM A;  2WFC A;  4BWQ A;  3GX0 A;  3PH9 A;  2YAN A;  4J56 E;  3WGX A;  1VRS D;  2HFD A;  3UBK A;  4ID0 A;  2GST A;  4NHZ A;  5B8A A;  4TOP A;  3ISO A;  1GSY A;  3BCK A;  1HQO A;  1T4Z A;  4BL7 B;  2H0H A;  1PRX A;  5IMC A;  2CA8 A;  1M9B A;  1A2J A;  3GL5 A;  2ES7 A;  2R4V A;  4POB A;  1K3Y A;  1F3A A;  2CAQ A;  3GNJ A;  3KJY A;  1XG8 A;  1ERW A;  1U3A A;  1DSB A;  5D9T A;  2PBJ A;  4PNF A;  2H01 A;  3FZA A;  4IEL A;  3OR5 A;  5G1K A;  4MH2 A;  3EPT A;  5JCG A;  1S3R A;  2H75 A;  2JSY A;  4NPB A;  1THO A;  3W6G A;  1BYE A;  2HYX A;  4FYU A;  3TRP A;  3US3 A;  4V2M A;  1S3D A;  5A4W A;  2BTO T;  1H75 A;  1QMV A;  1BQ7 A;  3CQF A;  1TI1 A;  2FUG 2;  2JZS A;  3DIE A;  1XW5 A;  3BBY A;  1BG5 A;  5G5E A;  2VL3 A;  2FHE A;  1SJZ A;  2K8V A;  1OE7 A;  2VOC A;  3C1S A;  2DJ2 A;  4HOJ A;  1PGT A;  3MDK A;  4K5S A;  2A2P A;  1OKD A;  1THX A;  3VI7 A;  4L5L A;  4WBJ A;  2GT5 A;  4DSS A;  3TKQ A;  2L5L A;  2FWF A;  3UIW A;  5A5K A;  4IVF A;  5IO0 A;  2VD1 A;  2PMT A;  3DVW A;  2GZP A;  1XVW A;  1ZYP A;  2PVQ A;  1R26 A;  3D5J A;  3PIN A;  3GFK A;  3IV4 A;  1GLP A;  4TW5 A;  1XVQ A;  1K0A A;  3GIX A;  4MJA A;  3QAW A;  1DE1 A;  3ME8 A;  1FAA A;  2H66 A;  4HS1 A;  1JZO A;  2IN3 A;  4N10 A;  2LST A;  2H6Z A;  3IXR A;  4HEA 2;  2JZR A;  2YWI A;  1Z6N A;  4YQU A;  4D73 A;  2GSQ A;  2OBI A;  5CRW A;  1A8L A;  7GSS A;  1OYJ A;  4NMU A;  3WT1 A;  2HE3 A;  4USS A;  2C3T A;  4ECJ A;  2P5R A;  3DML A;  3KIJ A;  1FB0 A;  6GSY A;  3ED3 A;  5D8I A;  1WIK A;  1MD3 A;  4K7I A;  3GKM A;  3TJF A;  5KN1 A;  3GX8 A;  5B6N A;  1ZGN A;  4CY8 A;  1HNC A;  2F51 A;  1O73 A;  5ELA A;  2ZCT A;  4ISD A;  5KOW A;  4FIW A;  4D73 B;  3LGC A;  1OC9 B;  4OFT A;  2MYG A;  4XRD A;  2IMF A;  4WET A;  5DCG A;  5ECS A;  6GSX A;  1XCC A;  2N5A A;  4RI6 A;  3F4T A;  5HR0 A;  4K9Z A;  3ZTL A;  2RM6 A;  5G5F A;  8GSS A;  1SL1 B;  4DSQ A;  1NSW A;  1RQM A;  5G2Z A;  2E7P A;  5JCW A;  1GNE A;  4EDZ A;  2HSM A;  2VUP A;  3H79 A;  5A4V A;  2HI7 A;  1Z7R A;  3CSI A;  3WYW A;  4O5R A;  1NHY A;  3AY8 A;  1WMJ A;  2LJK A;  1PN0 A;  5AGY A;  4G0L A;  2QC7 A;  5DQY A;  5E4W A;  1K0N A;  1I9D A;  4FO5 A;  4MDC A;  1NHO A;  1TK0 B;  3EIN A;  4KX4 A;  4KDY A;  3F63 A;  1O8X A;  3HCZ A;  2GVP A;  1WP0 A;  4IHU A;  1H4O A;  2H30 A;  4ZIJ A;  2LQO A;  1F2E A;  4KF9 A;  5D96 A;  3L4N A;  2XPE A;  3GMF A;  3P8W A;  5EL8 A;  3ERF A;  2B7K A;  5GST A;  2LNT A;  3GYK A;  3QFA C;  1SK1 A;  1G6Y A;  5D9X A;  1K0O A;  2MZC A;  2JSZ A;  1M3J A;  3DXB A;  4H86 A;  4X4J A;  3TB2 A;  2NTO A;  3G7J A;  5INY A;  2P31 A;  4L0W A;  3UVT A;  3FZ5 A;  1XWA A;  5ECK B;  1M7T A;  3EWL A;  1QQ2 A;  1E2Y A;  2V41 A;  1XOA A;  3NOF A;  1O7U A;  2GQL A;  4F2I A;  3RHB A;  1MD4 A;  4ZBA A;  4DSR A;  2FWG A;  4KDX A;  5JWQ B;  2PUK C;  1ERV A;  4L8E A;  2P5Q A;  3HA9 A;  2GLR A;  5ECM B;  5F05 A;  1XWG A;  4G0I A;  2LJA A;  3GL3 A;  2PGT A;  1SKS B;  2HRN A;  4K1F A;  4EKZ A;  3KCM A;  3ZL5 A;  1B9Y C;  2DKH A;  4G19 A;  1O81 A;  1X5E A;  5COH A;  5EPF A;  1TTZ A;  4YAV A;  3CBU A;  1LBK A;  3HVV A;  2B6M A;  1DBY A;  2YNX A;  3Q19 A;  1XPV A;  3HZ4 A;  5ECP B;  3W8S A;  3HXS A;  3V1W A;  2A2S A;  1GWC A;  1ERT A;  1V2A A;  2EIO A;  5CRE A;  4QL9 A;  3QAV A;  1K0M A;  2CZ2 A;  3HHV A;  1JZR A;  4HUA A;  4YKF A;  3H1N A;  1GSS A;  1Z7P A;  3NIV A;  2VIM A;  1GUM A;  2YN1 A;  3CMI A;  4PQH A;  3GV1 A;  4GRF A;  3P7X A;  2YZH A;  1YEP A;  2HSH A;  4GWR A;  1GUH A;  2DBC A;  1SD9 A;  4IP1 A;  3UMA A;  3LSZ A;  4MP4 A;  4MA9 A;  2VLT A;  3F4S A;  5F07 A;  1JLW A;  1Z3E A;  2QGV A;  3EMX A;  2GSS A;  1F9M A;  4AF2 A;  2B7J A;  5DQS A;  3ZFB A;  1ILO A;  4L5O A;  1PMT A;  4XS1 A;  4FYB A;  1PL1 A;  3RHC A;  5EY6 A;  3CRT A;  3L9V A;  4NV2 A;  3UOM A;  1AQW A;  4E8H A;  3LW9 A;  4XRA A;  3C8E A;  5C04 A;  5AIV A;  5IIZ A;  4K8M A;  1PD2 1;  3J7Y b;  1PSQ A;  4HQZ A;  1O85 A;  1QK8 A;  4QQ7 A;  1EV4 A;  5JWO B;  5E59 A;  1XW9 A;  2CQ9 A;  4POK A;  4AJ6 A;  4A5P A;  5KEJ A;  2F9S A;  4YKG A;  1GSQ A;  2R5G A;  2KLX A;  5ECH B;  3MNG A;  4GQC A;  3MWH A;  2XBI A;  3QAG A;  4WF4 A;  3KGK A;  2K6V A;  3IHG A;  1TXX A;  4RQX A;  3TRX A;  3VWX A;  5KN0 A;  4OCE A;  1X9M B;  5DAL A;  5J3R A;  3I6A A;  2J23 A;  2ZUP A;  3APQ A;  1WJK A;  5AN1 A;  2MBS A;  3D0Z A;  3EUR A;  1R4W A;  3D4T A;  3TRQ A;  2DIY A;  2VM1 A;  4I2U A;  2O89 A;  1EOH A;  2DJ1 A;  3UVH A;  1RK4 A;  3FR3 A;  2NPB A;  1W89 A;  2BJX A;  1K0B A;  1WPI A;  4Q5Q A;  2B3S A;  1OC8 A;  3C71 A;  2PPT A;  5DAL B;  3QMX A;  1GSD A;  1AUC A;  4G2E A;  2C0G A;  3CRU A;  1FVK A;  5KN3 A;  4PQI A;  4YQV A;  1ERU A;  1GLQ A;  1G7O A;  3L9U A;  4GTU A;  4BL7 A;  1JHB A;  3IHQ A;  2M80 A;  3IRA A;  3GHA A;  2H0I A;  5DJM A;  4MZB A;  3KMN A;  2MMN A;  4WEY A;  3HDC A;  1YDK A;  2H1G A;  2OAC A;  1GTU A;  2OA7 A;  4K5R A;  3PGT A;  2HNL A;  3HD5 A;  3DEX A;  1YZX A;  2LNS A;  4O92 A;  3IC8 A;  3F0I A;  1PQN A;  4KAE A;  3F8U A;  4TR0 A;  4BPY A;  5D9V A;  2B1K A;  2E2G A;  1C72 A;  2DC5 A;  2G0F A;  5ECO B;  20GS A;  1AIU A;  3TJG A;  5C00 A;  4MPF A;  2AYT A;  3DRN A;  14GS A;  1XWC A;  4RI7 A;  5J5N A;  3G9B A;  11GS A;  18GS A;  2FGX A;  3EMP A;  5DDL A;  1VF1 A;  1Y6E A;  2E2M A;  5ENU A;  1USB A;  2AJQ B;  3UJ1 A;  5DAK B;  3IA1 A;  3SBC A;  5B6M A;  3CTF A;  5HFG A;  2AUV A;  3VUR A;  1F6M C;  1BED A;  1TI3 A;  4KND A;  4PUR A;  3KZQ A;  2EIQ A;  4JBB A;  1XOB A;  1U6T A;  5GSS A;  4NAX A;  1PN9 A;  3S9F A;  2VCX A;  2CX4 A;  1XZO A;  3C1R A;  5HQP A;  1BJX A;  2H8L A;  2H1B A;  2NDO A;  1ACV A;  4POL A;  2C4J A;  3LWA A;  3APO A;  5J4U A;  1UN2 A;  4XCS A;  3IAS 2;  1PKW A;  5D73 A;  4IP6 A;  6GST A;  2M72 A;  2AB6 A;  2R0C A;  1FVJ A;  1J08 A;  1TW9 A;  3TCO A;  5B7C A;  3ZIJ A;  1FG4 A;  3GH9 A;  4KE3 A;  1K3O A;  4G9H A;  3R2Q A;  1V98 A;  2VLV A;  2FCH A;  3HYP A;  1T4Y A;  4ECI A;  5LCZ A;  1YKA A;  3ERG A;  1EOG A;  2WCI A;  2XPD A;  2FWE A;  2VLU A;  3KP8 A;  1GRX A;  3KTB A;  3ZVJ A;  5KOX A;  1UC7 A;  3F9U A;  4HZ2 A;  4EC0 A;  4EE0 A;  3LYK A;  2GT6 A;  4ZB9 A;  2IJY A;  5ABR A;  1GL8 A;  4N0V A;  5H5Q A;  2B1L A;  2A2R A;  3IPZ A;  3TKR A;  4JU5 A;  1HNA A;  4MJB A;  4ZBD A;  2V32 A;  3E3E A;  4I2T A;  4TN8 A;  3QDN A;  2BMX A;  1RW1 A;  6GSU A;  3GKX A;  1U87 A;  1OC9 A;  1FW1 A;  1GH2 A;  4MAB A;  2YWN A;  5DCH A;  3ZRE A;  1OKT A;  2LV3 A;  1PL2 A;  3H8Q A;  1M2D A;  3F6F A;  4YH2 A;  4XS4 A;  5D9W A;  1TRS A;  5B8B A;  2IIY A;  5ECI B;  1GTI A;  3TOT A;  1A8Y A;  2WB9 A;  4ZBB A;  2DJ0 A;  1TU7 A;  3IBH A;  2F8F A;  3CXG A;  1EGR A;  2YJH A;  4ACS A;  4IQA A;  5A4U A;  1ZCP A;  5ID2 B;  1T7P B;  4TR1 B;  1FO5 A;  3CTG A;  1X9W B;  3D4M A;  22GS A;  2B5Y A;  3ZFL A;  5G30 A;  3TKS A;  3TJJ A;  2GQM A;  4XS4 B;  4K0G A;  4LMW A;  3VWV A;  3HVN A;  4EVM A;  3ERW A;  2C80 A;  1B4P A;  2Z9S A;  4V1A g;  1SKR B;  2B5E A;  5AIS A;  5LNK e;  5KN2 A;  4PXO A;  2QKE A;  4ZXG A;  2ON5 A;  1Z6M A;  3HY2 A;  3VFI A;  2JAD A;  5CRD A;  4GF0 A;  4YAP A;  4N11 A;  4XHM A;  2GS3 A;  3M8N A;  3WT2 A;  3IK7 A;  3F6D A;  1ZL9 A;  1V57 A;  4PUA A;  6GSV A;  1GNW A;  3NZN A;  3D6I A;  3LFL A;  5IMZ A;  4IJI A;  2PVO C;  2VL9 A;  2WZ9 A;  2CVD A;  3G7Y A;  3VWU A;  1LU4 A;  2LS5 A;  4LMV A;  2AV4 A;  4JR4 A;  2VAF A;  3KH7 A;  2KHP A;  3FW2 A;  1W4V A;  3VK9 A;  1E6B A;  1B48 A;  1AXD A;  3TDG A;  3DD3 A;  19GS A;  1SEN A;  4XS6 A;  2OAD A;  4PGT A;  4WF5 A;  2GZY A;  2V6K A;  2VD0 A;  3LXT A;  3LYP A;  4ZL7 A;  3FY7 A;  4MH3 A;  3J7Y k;  4V2L A;  4HZ4 A;  3M3M A;  3A2V A;  1V9W A;  4OWY A;  4TXO B;  1N8J A;  3TUE A;  2LTK A;  2CV4 A;  2LQQ A;  3M0F A;  1HNB A;  4O5U A;  1URM A;  3VPQ A;  2IL3 A;  4F82 A;  4ECC A;  1JFU A;  5CAX A;  2H0G A;  1BX9 A;  4GXZ A;  2DML A;  4GLT A;  2GDR A;  5HFK A;  4ICY A;  3R3E A;  2XC2 A;  1ZYQ B;  3BJ5 A;  3FHK A;  5L71 A;  2C3Q A;  4DEJ A;  4E8E A;  4NHW A;  4EIQ A;  1KNG A;  1TP9 A;  3L78 A;  1N2A A;  3A5W A;  2HZF A;  1MDI A;  1DE2 A;  3I43 A;  3TKS C;  2OBK A;  2YCD A;  2GTU A;  2JAC A;  1XFL A;  2HZE A;  3GN3 A;  1NW2 A;  5CYY A;  3QOU A;  5BMU A;  1X5C A;  3GST A;  4Q5R A;  4GQF A;  2KUC A;  3CSJ A;  2OKA A;  1GUL A;  5ECL B;  4MCU A;  2HRF A;  1EP7 A;  3UEM A;  1ON4 A;  2RLI A;  1OC3 A;  2L59 A;  3EVI A;  3WD6 A;  3QCP A;  1ZZY A;  4EL1 A;  1F37 A;  2JL4 A;  4HU9 A;  2YP6 A;  2HSY A;  2AAW A;  4LLR A;  2PN8 A;  2X49 A;  2YV9 A;  4BVY B;  4Z2R A;  4HQS A;  3BCI A;  2HZE B;  2R2J A;  1SYX A;  1B4Q A;  4K2D A;  2NVL A;  4OFN A;  1VF3 A;  3U5R E;  4I97 A;  5LD0 A;  1EEM A;  2X64 A;  1K0C A;  2MBT A;  2VCQ A;  1WRY A;  4GSN A;  4AJ8 A;  3O6T A;  3FMW A;  4LA1 A;  6GSW A;  1I5G A;  4L0U A;  5J9C A;  2FA4 A;  3LXZ A;  6GSS A;  3IC4 A;  4DVC A;  4X43 A;  3ME7 A;  2VCW A;  2H70 A;  4PX1 A;  4BA7 A;  2B5X A;  2MMA A;  3I9V 2;  3UL3 A;  4F0B A;  3EE2 A;  1TRU A;  5G1L A;  1Q98 A;  2OE3 A;  4WXT A;  4G0K A;  4OMV A;  2C1Y A;  3W8J A;  4NWY A;  3C7M A;  3TKP A;  3P2A A;  2IME A;  2K18 A;  3L0H A;  1YF0 A;  3LQ7 A;  4WR5 A;  3ZMK A;  2L4C A;  4CDO A;  1SK2 A;  4ML1 A;  4IJ3 A;  4F0C A;  1EZK A;  4O7H A;  1FOH A;  2YWM A;  2K9F A;  2F8A A;  3GUS A;  2PWJ A;  5DVB A;  3EC3 A;  5CRG A;  4TVE A;  3UAP A;  2L5O A;  5CRH A;  2YOI A;  3CSH A;  2HRA A;  1M99 A;  3VPT A;  4OFM A;  1XWK A;  1X5D A;  1PKZ A;  5H5R A;  1GTB A;  2VCZ A;  2LKU A;  1J9B A;  2LJR A;  4IW9 A;  1GTA A;  4CHS A;  3N5O A;  3IK9 A;  3FR9 A;  2V1M A;  3E9J B;  2R3X A;  1TJD A;  4NXI A;  4QL7 A;  1YY7 A;  4IKH A;  2G2Q A;  3IR4 A;  2O87 A;  5IMA A;  2DKI A;  5F06 A;  5IOX A;  3HKR A;  3H93 A;  1GSE A;  4MF7 A;  1WWJ A;  2M46 A;  1XBS A;  1UA5 A;  4NV5 A;  2CVK A;  4O32 A;  5DAK A;  1TK5 B;  1EP8 A;  17GS A;  4N30 A;  4WKW A;  3LJR A;  5FWG A;  3KM6 A;  2FLS A;  3LOR A;  2LRN A;  4JED A;  4ZL9 A;  1HD2 A;  1MDJ A;  2VCV A;  1JZW A;  1UVZ A;  3P90 A;  4OCF A;  2V2G A;  2IWT A;  2YWO A;  3F3Q A;  4TR3 A;  3IOS A;  1M9A A;  4KW6 A;  4MZW A;  3M1G A;  2JZT A;  1MDK A;  3KXO A;  4HJ2 A;  1ST9 A;  3KTL A;  4FH8 A;  4K7N A;  2ZNM A;  1X0R A;  2O7K A;  3LEF A;  5HR3 A;  4HSC X;  5ECR B;  3BD2 A;  3RDW A;  1X9S B;  2DJK A;  2DMM A;  1TOF A;  2LUS A;  16GS A;  2H71 A;  4KCE A;  3UAR A;  2GSR A;  5G31 A;  2X8C A;  4BWS A;  3KD0 A;  1SL0 B;  1WOU A;  4IN0 A;  3Q6O A;  1M0U A;  1OVN A;  4I8B A;  4HJM A;  4KDU A;  2XHF A;  3HVX A;  5D93 A;  3MSZ A;  5EVO A;  1WE0 A;  5J41 A;  2N5B A;  2C0F A;  3O76 A;  4BVX A;  4TKY A;  4OD7 A;  2DLX A;  1O6J A;  2N5F A;  4J2F A;  2QSI A;  1TU8 A;  3GTU A;  3EU3 A;  4KGI A;  4WR4 A;  5CNW A;  2REM A;  3Q74 A;  2EC4 A;  2YZU A;  1PA3 A;  1VF2 A;  2EIR A;  5GAN D;  3PPU A;  1S3C A;  1YF1 A;  4JZQ A;  2R0P A;  1M2B A;  4MLY A;  3KEB A;  1T3B A;  4G10 A;  3KP9 A;  1B9X C;  4ZL8 A;  1V58 A;  4K7O A;  4LL4 B;  4EXJ A;  2OE0 A;  2FA8 A;  2H1D A;  1A2L A;  2CT6 A;  3L9S A;  3FRC A;  3TJK A;  4K2X A;  1R5A A;  1AQX A;  4MNN A;  4BVX B;  1TRW A;  3K8N A;  3MIX A;  1LJR A;  13GS A;  3HJO A;  4K0N A;  4IGJ A;  4XTS A;  1AW9 A;  3GTU B;  1AQV A;  1QXH A;  4F9Z A;  4V1A p;  3RAZ A;  4JR6 A;  1T8E B;  4PNG A;  3ZIV A;  5F8B A;  3TGZ A;  3ZVJ D;  3A2W A;  3FKF A;  3HJP A;  4TXV A;  2DSA A;  1FB6 A;  1TRV A;  5IO2 A;  1PX6 A;  2RII A;  1M2A A;  5ID2 A;  2LEG A; 
#chains in the Genus database with same CATH homology
 4TR1 A;  3IAM 2;  3DYR A;  4KCA A;  3A2X A;  4DSS B;  2WGR A;  4MPG A;  1SJI A;  2X8H A;  3VI5 A;  2PER A;  2H72 A;  1YEX A;  1YJ6 A;  3FEU A;  4J57 E;  2IPA A;  2D2Z A;  1XWB A;  1TK8 B;  3TOU A;  5DJL A;  4IBP A;  4ECB A;  5HR2 A;  1K3L A;  4V2N A;  3QFB C;  4X0X A;  2TRC P;  3GSS A;  3U6V A;  3IDV A;  1SYR A;  2HXK A;  4Q5N A;  2WRT A;  1ZYE A;  5IM9 A;  2CAI A;  4MZC A;  1CQH A;  3GH6 A;  2YJ7 A;  1ZOF A;  3EU4 A;  4GSS A;  1R5P A;  3ZYW A;  1QUW A;  3JCM L;  1Y25 A;  3GA4 A;  2LRC A;  2JU5 A;  4K6X A;  2X4A A;  2YPM A;  3VLN A;  4KH7 A;  3D22 A;  1G0T A;  4KB3 A;  3Q18 A;  3FR6 A;  2R0G A;  4HI7 A;  1AAZ A;  4ULX A;  2L6C A;  1JLV A;  4PUF C;  2O8V B;  5IMD A;  4OO4 A;  5JWR B;  4Q5F A;  5FHI A;  5IMV A;  1XIY A;  1EGO A;  2ON7 A;  4EUY A;  5IQY A;  4X1U A;  2WS2 A;  4TXO A;  2KP1 A;  2DIZ A;  1SL2 B;  3ZIT A;  1B8X A;  2L6D A;  3D21 A;  2HT9 A;  2WDU A;  1KBN A;  3F3R A;  5IMF A;  5ELG A;  3DVX A;  1ZMA A;  1QGV A;  1IYI A;  3EYT A;  2OJL A;  4MMM A;  1IYH A;  1NM3 A;  2C0E A;  1Q4J A;  4FYC A;  1U3I A;  2CZ3 A;  4Z7X A;  2HLS A;  1GSF A;  4GCI A;  5IOW A;  2FNO A;  2LRT A;  4FQU A;  3WGE A;  3UBL A;  2R37 A;  1BAY A;  2IFQ A;  3M9K A;  2GQK A;  5IPH A;  3HVS A;  3FZ9 A;  9GSS A;  4I6X A;  3F4R A;  5CP1 A;  4ML6 A;  2QA2 A;  2VL2 A;  3FZ4 A;  1A0F A;  4EF0 A;  4EIP A;  4XIH A;  2RM5 A;  4MF6 A;  4MJE A;  2H1A A;  1K0D A;  3DWV A;  1OE8 A;  1ZYN A;  1FHE A;  4AGS A;  4CY6 A;  3MAK A;  1Z5Y E;  3WGD A;  2L57 A;  4Z2U A;  5IPG A;  3LG6 A;  1F3B A;  1T1V A;  3QPM A;  2FY6 A;  2H6X A;  2X99 A;  3CYN A;  4BVY A;  3O3T A;  4GST A;  2IFQ B;  4IQ1 A;  4EDY A;  4JRR A;  3I69 A;  3RPP A;  3APS A;  2O85 A;  4MJC A;  1KEB A;  1Z9H A;  4OO5 A;  1GSU A;  4POM A;  1T00 A;  3GKN A;  2PU9 C;  3G7I A;  1S3A A;  5F0G A;  1MTC A;  3KH9 A;  3GKK A;  1A24 A;  1DUG A;  5AIX A;  3DKS A;  2IMD A;  2I1U A;  4CW9 A;  1TDI A;  3KMO A;  4JE1 A;  3HZ8 A;  2P0G A;  5HR1 A;  3TKS E;  3H4K A;  3SWL A;  4MK3 A;  4PQ1 A;  3QD9 A;  5BRT A;  2F3M A;  1QFN A;  3BOA A;  2C8U A;  3HJM A;  4RUV A;  4P3Y B;  3PR8 A;  2CVB A;  2OE1 A;  2I81 A;  3GRX A;  2DJJ A;  2WUL A;  4PTS A;  2C3N A;  4TRX A;  4RQR A;  1R7H A;  2A4V A;  1XW6 A;  1V40 A;  3C73 A;  1SKW B;  2K8S A;  2QA1 A;  1SU9 A;  4I5Q A;  2H74 A;  3RPN A;  1TKD B;  3A5I A;  4KSM A;  2GZZ A;  4KSO A;  1YQ1 A;  3MYD A;  2RUE A;  3ZLP A;  2J9H A;  2IMK A;  5GAP D;  1SJ6 A;  4WBR D;  3VWW A;  2C0D A;  3DGQ A;  1A23 A;  1PX7 A;  2GGT A;  1EWX A;  3A3T A;  1KTE A;  1G6W A;  1OAZ A;  4MF5 A;  4HDE A;  2VCT A;  1HYU A;  2I9H A;  4EO3 A;  2I4A A;  2MMZ A;  2FWH A;  1SK0 A;  2AHE A;  1AC1 A;  5GZZ B;  1J0F A;  4AJ7 A;  5CO3 A;  2VL2 C;  2RUF A;  1A2M A;  4LL1 B;  1YKC A;  1EV9 A;  1O8W A;  1FOV A;  1JZD A;  2ALB A;  3E0U A;  3GUR A;  1ABA A;  2CX3 A;  2DJ3 A;  5H5S A;  5HFI A;  3FYG A;  4HU7 A;  2X8G A;  2YV7 A;  2KOK A;  4KA0 A;  4Z2T A;  1GP1 A;  2IMI A;  1EEJ A;  2TIR A;  3M9J A;  4IS0 A;  2I3Y A;  3N9J A;  3TJB A;  4ZB8 A;  1XXU A;  3QR6 A;  1VF4 A;  1G7E A;  4O5Q A;  4ZB6 A;  5J9B A;  5ECN B;  2FD3 A;  2R6K A;  2E0Q A;  2TRX A;  1CQG A;  1U88 A;  2HRK A;  2MMO A;  4F03 A;  2A4H A;  2VM2 A;  5DBQ A;  5JCU A;  5FT3 A;  2KP2 A;  4N0Z A;  1GUK A;  2XBQ A;  2H19 A;  4ZIL A;  3FK8 A;  5ECQ B;  2VO4 A;  3IE3 A;  4KUN A;  2V6O A;  1ML6 A;  1MEK A;  2WJU A;  2NBS A;  2L4Q A;  2UZ8 A;  2H6Y A;  4ILF A;  3ZZX A;  1VGL A;  2H76 A;  4TR4 A;  3ZRD A;  12GS A;  1A0R P;  10GS A;  3RBT A;  1SD8 A;  2H73 A;  3ZML A;  4YQM A;  2WFC A;  4BWQ A;  3GX0 A;  3PH9 A;  2YAN A;  4J56 E;  3WGX A;  1VRS D;  2HFD A;  3UBK A;  4ID0 A;  2GST A;  4NHZ A;  5B8A A;  4TOP A;  3ISO A;  1GSY A;  3BCK A;  1HQO A;  1T4Z A;  4BL7 B;  2H0H A;  1PRX A;  5IMC A;  2CA8 A;  1M9B A;  1A2J A;  3GL5 A;  2ES7 A;  2R4V A;  4POB A;  1K3Y A;  1F3A A;  2CAQ A;  3GNJ A;  3KJY A;  1ERW A;  1U3A A;  1DSB A;  5D9T A;  2PBJ A;  4PNF A;  2H01 A;  3FZA A;  4IEL A;  3OR5 A;  5G1K A;  4MH2 A;  3EPT A;  5JCG A;  2H75 A;  2JSY A;  4NPB A;  1THO A;  3W6G A;  1BYE A;  2HYX A;  4FYU A;  3TRP A;  3US3 A;  4V2M A;  1S3D A;  5A4W A;  2BTO T;  1H75 A;  1QMV A;  1BQ7 A;  1TI1 A;  2FUG 2;  2JZS A;  3DIE A;  1XW5 A;  3BBY A;  1BG5 A;  5G5E A;  2VL3 A;  2FHE A;  1SJZ A;  2K8V A;  1OE7 A;  2VOC A;  3C1S A;  2DJ2 A;  4HOJ A;  1PGT A;  3MDK A;  4K5S A;  2A2P A;  1OKD A;  1THX A;  3VI7 A;  4L5L A;  4WBJ A;  2GT5 A;  4DSS A;  3TKQ A;  2L5L A;  2FWF A;  3UIW A;  5A5K A;  4IVF A;  5IO0 A;  2VD1 A;  2PMT A;  3DVW A;  2GZP A;  1XVW A;  1ZYP A;  2PVQ A;  1R26 A;  3D5J A;  3PIN A;  3GFK A;  3IV4 A;  1GLP A;  4TW5 A;  1XVQ A;  1K0A A;  3GIX A;  4MJA A;  3QAW A;  1DE1 A;  3ME8 A;  1FAA A;  2H66 A;  4HS1 A;  1JZO A;  2IN3 A;  4N10 A;  2LST A;  2H6Z A;  3IXR A;  4HEA 2;  2JZR A;  2YWI A;  1Z6N A;  4YQU A;  4D73 A;  2GSQ A;  2OBI A;  5CRW A;  1A8L A;  7GSS A;  1OYJ A;  4NMU A;  3WT1 A;  2HE3 A;  4USS A;  2C3T A;  4ECJ A;  2P5R A;  3DML A;  3KIJ A;  1FB0 A;  6GSY A;  3ED3 A;  5D8I A;  1WIK A;  1MD3 A;  4K7I A;  3GKM A;  3TJF A;  5KN1 A;  3GX8 A;  5B6N A;  1ZGN A;  4CY8 A;  1HNC A;  2F51 A;  1O73 A;  5ELA A;  2ZCT A;  4ISD A;  5KOW A;  4FIW A;  4D73 B;  3LGC A;  1OC9 B;  4OFT A;  2MYG A;  4XRD A;  2IMF A;  4WET A;  5DCG A;  5ECS A;  6GSX A;  1XCC A;  2N5A A;  4RI6 A;  3F4T A;  5HR0 A;  4K9Z A;  3ZTL A;  2RM6 A;  5G5F A;  8GSS A;  1SL1 B;  4DSQ A;  1NSW A;  1RQM A;  5G2Z A;  2E7P A;  5JCW A;  1GNE A;  4EDZ A;  2HSM A;  2VUP A;  3H79 A;  5A4V A;  2HI7 A;  1Z7R A;  3CSI A;  3WYW A;  4O5R A;  1NHY A;  3AY8 A;  1WMJ A;  2LJK A;  1PN0 A;  5AGY A;  4G0L A;  2QC7 A;  5DQY A;  5E4W A;  1K0N A;  1I9D A;  4FO5 A;  4MDC A;  1NHO A;  1TK0 B;  3EIN A;  4KX4 A;  4KDY A;  3F63 A;  1O8X A;  3HCZ A;  2GVP A;  1WP0 A;  4IHU A;  1H4O A;  2H30 A;  4ZIJ A;  2LQO A;  1F2E A;  4KF9 A;  5D96 A;  3L4N A;  2XPE A;  3GMF A;  3P8W A;  5EL8 A;  3ERF A;  2B7K A;  5GST A;  2LNT A;  3GYK A;  3QFA C;  1SK1 A;  1G6Y A;  5D9X A;  1K0O A;  2MZC A;  2JSZ A;  3DXB A;  4H86 A;  4X4J A;  3TB2 A;  2NTO A;  3G7J A;  5INY A;  2P31 A;  4L0W A;  3UVT A;  3FZ5 A;  1XWA A;  5ECK B;  1M7T A;  3EWL A;  1QQ2 A;  1E2Y A;  2V41 A;  1XOA A;  3NOF A;  1O7U A;  2GQL A;  4F2I A;  3RHB A;  1MD4 A;  4ZBA A;  4DSR A;  2FWG A;  4KDX A;  5JWQ B;  2PUK C;  1ERV A;  4L8E A;  2P5Q A;  3HA9 A;  2GLR A;  5ECM B;  5F05 A;  1XWG A;  4G0I A;  2LJA A;  3GL3 A;  2PGT A;  1SKS B;  2HRN A;  4K1F A;  4EKZ A;  3KCM A;  3ZL5 A;  1B9Y C;  2DKH A;  4G19 A;  1O81 A;  1X5E A;  5COH A;  5EPF A;  1TTZ A;  4YAV A;  3CBU A;  1LBK A;  3HVV A;  2B6M A;  1DBY A;  2YNX A;  3Q19 A;  1XPV A;  3HZ4 A;  5ECP B;  3W8S A;  3HXS A;  3V1W A;  2A2S A;  1GWC A;  1ERT A;  1V2A A;  2EIO A;  5CRE A;  4QL9 A;  3QAV A;  1K0M A;  2CZ2 A;  3HHV A;  1JZR A;  4HUA A;  4YKF A;  3H1N A;  1GSS A;  1Z7P A;  3NIV A;  2VIM A;  1GUM A;  2YN1 A;  3CMI A;  4PQH A;  3GV1 A;  4GRF A;  3P7X A;  2YZH A;  1YEP A;  2HSH A;  4GWR A;  1GUH A;  2DBC A;  1SD9 A;  4IP1 A;  3UMA A;  3LSZ A;  4MP4 A;  4MA9 A;  2VLT A;  3F4S A;  5F07 A;  1JLW A;  1Z3E A;  2QGV A;  3EMX A;  2GSS A;  1F9M A;  4AF2 A;  2B7J A;  5DQS A;  3ZFB A;  1ILO A;  4L5O A;  1PMT A;  4XS1 A;  4FYB A;  1PL1 A;  3RHC A;  5EY6 A;  3CRT A;  3L9V A;  4NV2 A;  3UOM A;  1AQW A;  4E8H A;  3LW9 A;  4XRA A;  3C8E A;  5C04 A;  5AIV A;  5IIZ A;  4K8M A;  1PD2 1;  3J7Y b;  1PSQ A;  4HQZ A;  1O85 A;  1QK8 A;  4QQ7 A;  1EV4 A;  5JWO B;  5E59 A;  1XW9 A;  2CQ9 A;  4POK A;  4AJ6 A;  4A5P A;  5KEJ A;  2F9S A;  4YKG A;  1GSQ A;  2R5G A;  2KLX A;  5ECH B;  3MNG A;  4GQC A;  3MWH A;  2XBI A;  3QAG A;  4WF4 A;  3KGK A;  2K6V A;  3IHG A;  1TXX A;  4RQX A;  3TRX A;  3VWX A;  5KN0 A;  4OCE A;  1X9M B;  5DAL A;  5J3R A;  3I6A A;  2J23 A;  2ZUP A;  3APQ A;  1WJK A;  5AN1 A;  2MBS A;  3D0Z A;  3EUR A;  1R4W A;  3D4T A;  3TRQ A;  2DIY A;  2VM1 A;  4I2U A;  2O89 A;  1EOH A;  2DJ1 A;  3UVH A;  1RK4 A;  3FR3 A;  2NPB A;  1W89 A;  2BJX A;  1K0B A;  1WPI A;  4Q5Q A;  2B3S A;  1OC8 A;  3C71 A;  2PPT A;  5DAL B;  3QMX A;  1GSD A;  1AUC A;  4G2E A;  2C0G A;  3CRU A;  1FVK A;  5KN3 A;  4PQI A;  4YQV A;  1ERU A;  1GLQ A;  1G7O A;  3L9U A;  4GTU A;  4BL7 A;  1JHB A;  3IHQ A;  2M80 A;  3IRA A;  3GHA A;  2H0I A;  5DJM A;  4MZB A;  3KMN A;  2MMN A;  4WEY A;  3HDC A;  1YDK A;  2H1G A;  2OAC A;  1GTU A;  2OA7 A;  4K5R A;  3PGT A;  2HNL A;  3HD5 A;  3DEX A;  1YZX A;  2LNS A;  4O92 A;  3IC8 A;  3F0I A;  1PQN A;  4KAE A;  3F8U A;  4TR0 A;  4BPY A;  5D9V A;  2B1K A;  2E2G A;  1C72 A;  2DC5 A;  2G0F A;  5ECO B;  20GS A;  1AIU A;  3TJG A;  5C00 A;  4MPF A;  2AYT A;  3DRN A;  14GS A;  1XWC A;  4RI7 A;  5J5N A;  3G9B A;  11GS A;  18GS A;  2FGX A;  3EMP A;  5DDL A;  1VF1 A;  1Y6E A;  2E2M A;  5ENU A;  1USB A;  2AJQ B;  3UJ1 A;  5DAK B;  3IA1 A;  3SBC A;  5B6M A;  3CTF A;  5HFG A;  2AUV A;  3VUR A;  1F6M C;  1BED A;  1TI3 A;  4KND A;  4PUR A;  3KZQ A;  2EIQ A;  4JBB A;  1XOB A;  1U6T A;  5GSS A;  4NAX A;  1PN9 A;  3S9F A;  2VCX A;  2CX4 A;  1XZO A;  3C1R A;  5HQP A;  1BJX A;  2H8L A;  2H1B A;  2NDO A;  1ACV A;  4POL A;  2C4J A;  3LWA A;  3APO A;  5J4U A;  1UN2 A;  4XCS A;  3IAS 2;  1PKW A;  5D73 A;  4IP6 A;  6GST A;  2M72 A;  2AB6 A;  2R0C A;  1FVJ A;  1J08 A;  1TW9 A;  3TCO A;  5B7C A;  3ZIJ A;  1FG4 A;  3GH9 A;  4KE3 A;  1K3O A;  4G9H A;  3R2Q A;  1V98 A;  2VLV A;  2FCH A;  3HYP A;  1T4Y A;  4ECI A;  5LCZ A;  1YKA A;  3ERG A;  1EOG A;  2WCI A;  2XPD A;  2FWE A;  2VLU A;  3KP8 A;  1GRX A;  3KTB A;  3ZVJ A;  5KOX A;  1UC7 A;  3F9U A;  4HZ2 A;  4EC0 A;  4EE0 A;  3LYK A;  2GT6 A;  4ZB9 A;  2IJY A;  5ABR A;  1GL8 A;  4N0V A;  5H5Q A;  2B1L A;  2A2R A;  3IPZ A;  3TKR A;  4JU5 A;  1HNA A;  4MJB A;  4ZBD A;  2V32 A;  3E3E A;  4I2T A;  4TN8 A;  3QDN A;  2BMX A;  1RW1 A;  6GSU A;  3GKX A;  1U87 A;  1OC9 A;  1FW1 A;  1GH2 A;  4MAB A;  2YWN A;  5DCH A;  3ZRE A;  1OKT A;  2LV3 A;  1PL2 A;  3H8Q A;  1M2D A;  3F6F A;  4YH2 A;  4XS4 A;  5D9W A;  1TRS A;  5B8B A;  2IIY A;  5ECI B;  1GTI A;  3TOT A;  1A8Y A;  2WB9 A;  4ZBB A;  2DJ0 A;  1TU7 A;  3IBH A;  2F8F A;  3CXG A;  1EGR A;  2YJH A;  4ACS A;  4IQA A;  5A4U A;  1ZCP A;  5ID2 B;  1T7P B;  4TR1 B;  1FO5 A;  3CTG A;  1X9W B;  3D4M A;  22GS A;  2B5Y A;  3ZFL A;  5G30 A;  3TKS A;  3TJJ A;  2GQM A;  4XS4 B;  4K0G A;  4LMW A;  3VWV A;  4EVM A;  3ERW A;  2C80 A;  1B4P A;  2Z9S A;  4V1A g;  1SKR B;  2B5E A;  5AIS A;  5LNK e;  5KN2 A;  4PXO A;  2QKE A;  4ZXG A;  2ON5 A;  1Z6M A;  3HY2 A;  3VFI A;  2JAD A;  5CRD A;  4GF0 A;  4YAP A;  4N11 A;  4XHM A;  2GS3 A;  3M8N A;  3WT2 A;  3IK7 A;  3F6D A;  1ZL9 A;  1V57 A;  4PUA A;  6GSV A;  1GNW A;  3NZN A;  3D6I A;  3LFL A;  5IMZ A;  4IJI A;  2PVO C;  2VL9 A;  2WZ9 A;  2CVD A;  3G7Y A;  3VWU A;  1LU4 A;  2LS5 A;  4LMV A;  2AV4 A;  4JR4 A;  2VAF A;  3KH7 A;  2KHP A;  3FW2 A;  1W4V A;  3VK9 A;  1E6B A;  1B48 A;  1AXD A;  3TDG A;  3DD3 A;  19GS A;  1SEN A;  4XS6 A;  2OAD A;  4PGT A;  4WF5 A;  2GZY A;  2V6K A;  2VD0 A;  3LXT A;  3LYP A;  4ZL7 A;  3FY7 A;  4MH3 A;  3J7Y k;  4V2L A;  4HZ4 A;  3M3M A;  3A2V A;  1V9W A;  4OWY A;  4TXO B;  1N8J A;  3TUE A;  2LTK A;  2CV4 A;  2LQQ A;  3M0F A;  1HNB A;  4O5U A;  1URM A;  3VPQ A;  2IL3 A;  4F82 A;  4ECC A;  1JFU A;  5CAX A;  2H0G A;  1BX9 A;  4GXZ A;  2DML A;  4GLT A;  2GDR A;  5HFK A;  4ICY A;  3R3E A;  2XC2 A;  1ZYQ B;  3BJ5 A;  3FHK A;  5L71 A;  2C3Q A;  4DEJ A;  4E8E A;  4NHW A;  4EIQ A;  1KNG A;  1TP9 A;  3L78 A;  1N2A A;  3A5W A;  2HZF A;  1MDI A;  1DE2 A;  3I43 A;  3TKS C;  2OBK A;  2YCD A;  2GTU A;  2JAC A;  1XFL A;  2HZE A;  3GN3 A;  1NW2 A;  5CYY A;  3QOU A;  5BMU A;  1X5C A;  3GST A;  4Q5R A;  4GQF A;  2KUC A;  3CSJ A;  2OKA A;  1GUL A;  5ECL B;  4MCU A;  2HRF A;  1EP7 A;  3UEM A;  1ON4 A;  2RLI A;  1OC3 A;  2L59 A;  3EVI A;  3WD6 A;  3QCP A;  1ZZY A;  4EL1 A;  1F37 A;  2JL4 A;  4HU9 A;  2YP6 A;  2HSY A;  2AAW A;  4LLR A;  2PN8 A;  2X49 A;  2YV9 A;  4BVY B;  4Z2R A;  4HQS A;  3BCI A;  2HZE B;  2R2J A;  1SYX A;  1B4Q A;  4K2D A;  2NVL A;  4OFN A;  1VF3 A;  3U5R E;  4I97 A;  5LD0 A;  1EEM A;  2X64 A;  1K0C A;  2MBT A;  2VCQ A;  1WRY A;  4GSN A;  4AJ8 A;  3O6T A;  3FMW A;  4LA1 A;  6GSW A;  1I5G A;  4L0U A;  5J9C A;  2FA4 A;  3LXZ A;  6GSS A;  3IC4 A;  4DVC A;  4X43 A;  3ME7 A;  2VCW A;  2H70 A;  4PX1 A;  4BA7 A;  2B5X A;  2MMA A;  3I9V 2;  3UL3 A;  4F0B A;  3EE2 A;  1TRU A;  5G1L A;  1Q98 A;  2OE3 A;  4WXT A;  4G0K A;  4OMV A;  2C1Y A;  3W8J A;  4NWY A;  3C7M A;  3TKP A;  3P2A A;  2IME A;  2K18 A;  3L0H A;  1YF0 A;  3LQ7 A;  4WR5 A;  3ZMK A;  2L4C A;  4CDO A;  1SK2 A;  4ML1 A;  4IJ3 A;  4F0C A;  1EZK A;  4O7H A;  1FOH A;  2YWM A;  2K9F A;  2F8A A;  3GUS A;  2PWJ A;  5DVB A;  3EC3 A;  5CRG A;  4TVE A;  3UAP A;  2L5O A;  5CRH A;  2YOI A;  3CSH A;  2HRA A;  1M99 A;  3VPT A;  4OFM A;  1XWK A;  1X5D A;  1PKZ A;  5H5R A;  1GTB A;  2VCZ A;  2LKU A;  1J9B A;  2LJR A;  4IW9 A;  1GTA A;  4CHS A;  3N5O A;  3IK9 A;  3FR9 A;  2V1M A;  3E9J B;  2R3X A;  1TJD A;  4NXI A;  4QL7 A;  1YY7 A;  4IKH A;  2G2Q A;  3IR4 A;  2O87 A;  5IMA A;  2DKI A;  5F06 A;  5IOX A;  3HKR A;  3H93 A;  1GSE A;  4MF7 A;  1WWJ A;  2M46 A;  1XBS A;  1UA5 A;  4NV5 A;  2CVK A;  4O32 A;  5DAK A;  1TK5 B;  1EP8 A;  17GS A;  4N30 A;  4WKW A;  3LJR A;  5FWG A;  3KM6 A;  2FLS A;  3LOR A;  2LRN A;  4JED A;  4ZL9 A;  1HD2 A;  1MDJ A;  2VCV A;  1JZW A;  1UVZ A;  3P90 A;  4OCF A;  2V2G A;  2IWT A;  2YWO A;  3F3Q A;  4TR3 A;  3IOS A;  1M9A A;  4KW6 A;  4MZW A;  3M1G A;  2JZT A;  1MDK A;  3KXO A;  4HJ2 A;  1ST9 A;  3KTL A;  4FH8 A;  4K7N A;  2ZNM A;  1X0R A;  2O7K A;  3LEF A;  5HR3 A;  5ECR B;  3BD2 A;  3RDW A;  1X9S B;  2DJK A;  2DMM A;  1TOF A;  2LUS A;  16GS A;  2H71 A;  4KCE A;  3UAR A;  2GSR A;  5G31 A;  2X8C A;  4BWS A;  3KD0 A;  1SL0 B;  1WOU A;  4IN0 A;  3Q6O A;  1M0U A;  1OVN A;  4I8B A;  4HJM A;  4KDU A;  2XHF A;  3HVX A;  5D93 A;  3MSZ A;  5EVO A;  1WE0 A;  5J41 A;  2N5B A;  2C0F A;  3O76 A;  4BVX A;  4TKY A;  4OD7 A;  2DLX A;  1O6J A;  2N5F A;  4J2F A;  2QSI A;  1TU8 A;  3GTU A;  3EU3 A;  4KGI A;  4WR4 A;  5CNW A;  2REM A;  3Q74 A;  2EC4 A;  2YZU A;  1PA3 A;  1VF2 A;  2EIR A;  5GAN D;  3PPU A;  1S3C A;  1YF1 A;  4JZQ A;  2R0P A;  1M2B A;  4MLY A;  3KEB A;  1T3B A;  4G10 A;  3KP9 A;  1B9X C;  4ZL8 A;  1V58 A;  4K7O A;  4LL4 B;  4EXJ A;  2OE0 A;  2FA8 A;  2H1D A;  1A2L A;  2CT6 A;  3L9S A;  3FRC A;  3TJK A;  4K2X A;  1R5A A;  1AQX A;  4MNN A;  4BVX B;  1TRW A;  3K8N A;  3MIX A;  1LJR A;  13GS A;  3HJO A;  4K0N A;  4IGJ A;  4XTS A;  1AW9 A;  3GTU B;  1AQV A;  1QXH A;  4F9Z A;  4V1A p;  3RAZ A;  4JR6 A;  1T8E B;  4PNG A;  3ZIV A;  5F8B A;  3TGZ A;  3ZVJ D;  3A2W A;  3FKF A;  3HJP A;  4TXV A;  2DSA A;  1FB6 A;  1TRV A;  5IO2 A;  1PX6 A;  2RII A;  1M2A A;  5ID2 A;  2LEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...