3MNGA

Wild type human prxv with dtt bound as a competitive inhibitor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
161
structure length
161
Chain Sequence
APIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin-5, mitochondrial
publication title Structural Evidence that Peroxiredoxin Catalytic Power Is Based on Transition-State Stabilization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 47
structure length 161
sequence length 161
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2010-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3mngA00
4ZBBA 1GSUA 2FWFA 3KP9A 2GVPA 2IIYA 3A5WA 1ACVA 5B7CA 4XIHA 3HJOA 2DJJA 2DJ1A 3HDCA 5AGYA 4PNGA 4ECBA 3ZIVA 4EDYA 4N0ZA 3M0FA 3M3MA 4HS1A 4GLTA 4HZ2A 4NWYA 2HFDA 1TRUA 4TN8A 5ELAA 2ZCTA 4KA0A 5G31A 5D9TA 4J56E 1Z6MA 2IFQA 2OBKA 1FW1A 3FKFA 3DRNA 4ULXA 3F3QA 3Q18A 1XOAA 2GT5A 3ZVJA 4ZB6A 3ZFBA 3ZRDA 1R7HA 5DJLA 2C0EA 2HZFA 4NV2A 2VL2C 2EIQA 5A4WA 5A5KA 4ECIA 1Z7PA 2C0GA 3A2XA 2AJQB 3G7JA 1OAZA 3A2VA 1USBA 2WULA 3VI7A 2I9HA 4EF0A 1WE0A 3IE3A 2LRNA 2MBTA 1K0AA 2K8VA 1VRSD 2C0DA 4MZWA 3CBUA 2PUKC 3ME8A 3CRTA 4TVEA 3GKXA 5COHA 2WRTA 2LRTA 4MA9A 2NBSA 3IDVA 3FR3A 5DDLA 3ZITA 4IN0A 1BAYA 3GYKA 2ZUPA 4BL7A 4WXTA 2DJ3A 4EC0A 1URMA 5F07A 3MNGA 1GTBA 4L0WA 4GQCA 3GSSA 2GGTA 1GSFA 1XWBA 4LL1B 2K6VA 4DSSB 1GTIA 5KN3A 2XPEA 2O85A 5LD0A 2IPAA 1ZYQB 3KCMA 1XFLA 4NHWA 4TXVA 5IMVA 1M2DA 5CAXA 4GTUA 3WT1A 2H66A 4K2DA 5B8BA 1SYRA 1G7EA 4ILFA 4G10A 1GWCA 1GLPA 5JWRB 2LJRA 4BWQA 3HZ4A 1GTUA 2YZUA 3D21A 4CDOA 5HFGA 3HVXA 4Q5FA 12GSA 1FO5A 2VD0A 5AIVA 2TRXA 1O85A 3TKSA 2KUCA 4POKA 3ZFLA 2L5OA 1K0NA 1QXHA 4IKHA 1S3AA 3O6TA 2ES7A 2C8UA 5HR1A 2N5AA 10GSA 1XCCA 3APSA 2FY6A 2C0FA 1GSSA 1GL8A 3I6AA 3HHVA 1GSDA 2LJKA 3H4KA 3PR8A 5ABRA 3M9KA 5ECSA 1X9SB 1BQ7A 1V57A 3PGTA 4TR1A 1JZDA 1O7UA 4DVCA 3KMOA 4G9HA 4X43A 5LNKe 5G1KA 2B6MA 1XXUA 4L0UA 3TKPA 3MWHA 4IVFA 2OA7A 3QD9A 3HY2A 3C71A 4EE0A 2PMTA 1F3BA 1M0UA 1KTEA 4WEYA 2B7KA 1EZKA 2YWMA 1Z9HA 4OO5A 5G2ZA 4TXOA 3KD0A 1AUCA 3GHAA 5IMDA 2TIRA 5JWQB 3UARA 5D73A 2YWOA 4ML6A 5A4UA 1HNAA 1GSQA 2R4VA 2J9HA 3AY8A 1HQOA 2JADA 4KUNA 4LMWA 1SL2B 2V1MA 1FB0A 1EOHA 3VWWA 1OE8A 5J9CA 2A2RA 3GRXA 1LU4A 2HXKA 4KSOA 2I4AA 4K8MA 3J7Yk 3GL3A 3LEFA 3IK9A 1PN9A 1EEJA 2F9SA 5HQPA 1ABAA 1PSQA 4E8HA 4GSSA 4JZQA 2PVQA 4HJMA 2C3TA 3I9V2 1KBNA 1OKDA 2WCIA 3QR6A 1X5DA 4V2NA 3F4RA 3F63A 1X9MB 4HOJA 3FHKA 1PD21 4BPYA 2PU9C 4YAPA 1Q98A 3PH9A 1XPVA 3L9VA 3FR9A 3DKSA 2FGXA 2AYTA 2WB9A 6GSYA 4RQRA 4QL7A 2E7PA 3TKRA 4Z7XA 1IYIA 2P5RA 1TW9A 1TK0B 1EGOA 4IGJA 2FD3A 4PGTA 1U88A 5G5FA 2IFQB 2F51A 2MMNA 1TOFA 5DCGA 5CNWA 2H1AA 2B1KA 2QSIA 3UEMA 1K3LA 2YCDA 2HSYA 1GSYA 3L9UA 3HVSA 1M2AA 2O87A 3O76A 4OCFA 4K0NA 3WT2A 3D6IA 1PKWA 1TK8B 4WR4A 3ZREA 1Y25A 4BVYA 2H0HA 4OCEA 2FCHA 1A0RP 2PERA 4GF0A 18GSA 4PUFC 4YQUA 2H30A 4ECCA 2CVBA 2LNTA 2DMLA 3IPZA 3VURA 3NIVA 2CVDA 19GSA 2VCQA 4LL4B 3I43A 3KH9A 3EVIA 1U87A 2D2ZA 1EWXA 1FVJA 5E4WA 2YN1A 3SWLA 2P0GA 2CZ3A 4XRAA 4EKZA 4XS4A 4F0CA 3GKMA 1UA5A 1NHYA 3BCIA 5DVBA 1GSEA 5G30A 4EL1A 4WKWA 2DJKA 3QFBC 3FW2A 3KM6A 3QPMA 2MBSA 2LTKA 1S3CA 2YV7A 3KIJA 1Z6NA 3PINA 3M9JA 4V2MA 4ZXGA 3M1GA 5IPGA 1O8WA 5ENUA 2VCVA 1QGVA 2H1BA 3D4MA 2GQKA 2I3YA 5ELGA 4YH2A 3EC3A 2E2GA 1T4ZA 3DGQA 3RBTA 5DAKA 4POLA 1OYJA 1AQXA 5D9XA 3L9SA 5CRGA 2AAWA 3BD2A 3VI5A 2LEGA 3BCKA 5KN1A 3EU4A 3D22A 1K0CA 1FAAA 1PGTA 3VK9A 2B5EA 1GH2A 4GQFA 2HYXA 4ML1A 5G1LA 2VO4A 4K7IA 2CX4A 3M8NA 2HSHA 1PRXA 4WETA 4HQSA 1XZOA 2VLVA 5ECLB 4TR1B 2KP1A 3FK8A 3DWVA 3DXBA 2H8LA 3KTBA 2LQQA 2V6KA 2KOKA 8GSSA 5B6MA 6GSVA 3EURA 3G7IA 3ERFA 4MJEA 1HNBA 2LUSA 3C1RA 3C8EA 3W6GA 1BG5A 2N5BA 4BA7A 1U6TA 4KW6A 3RHBA 1XVQA 2YV9A 4HZ4A 5ECPB 4OD7A 5AN1A 1TDIA 4TXOB 4L5LA 1TRWA 1UVZA 2GQMA 1JLWA 4X1UA 2O89A 1VF3A 3P90A 2O8VB 3QCPA 3L4NA 16GSA 4AJ6A 2YWNA 1ST9A 5J5NA 1AAZA 1GP1A 4Q5QA 4TKYA 6GSTA 1W4VA 2B3SA 14GSA 3QAWA 1YKAA 4YQMA 3UBKA 2JZSA 1VF4A 3Q19A 4MZBA 5JCUA 2X8CA 4CW9A 1V58A 1X5CA 3UMAA 4QQ7A 4KH7A 5DQSA 1G6YA 3UVHA 2GDRA 3RPNA 3GIXA 5GSTA 5IMFA 4HQZA 1XOBA 3WD6A 2FA8A 3IAM2 3UVTA 5ECRB 5HFKA 1HYUA 3CTFA 4IJIA 4LMVA 1N8JA 1V98A 4MF5A 2XBIA 1X5EA 2M80A 4HJ2A 4K0GA 3FY7A 3IXRA 1MTCA 1DSBA 5IOWA 4EUYA 2R2JA 3ZTLA 1TXXA 4IQ1A 4XS1A 4PUAA 4V1Ag 2YNXA 3E0UA 3A3TA 1B9YC 1TRVA 2GS3A 4N11A 1K3YA 5EY6A 1YJ6A 3VPQA 3KTLA 1XWGA 1O73A 2QKEA 4EVMA 3BBYA 4AJ8A 4TOPA 2PN8A 3WGDA 1A0FA 1YF0A 1TKDB 1A2MA 2YJ7A 1EP7A 1PX6A 4O7HA 5IO0A 1OE7A 3EMPA 5IMAA 4JU5A 1YDKA 4E8EA 1SK1A 5J9BA 3TJBA 1GULA 3GTUA 2VLTA 1XVWA 2DC5A 2RM6A 3HCZA 4JEDA 4I97A 2H74A 4KE3A 1SK0A 2DJ2A 2BTOT 3TKQA 4PXOA 3SBCA 3VFIA 1AIUA 2PWJA 5E59A 1GUKA 3IOSA 2R3XA 5J4UA 2DIYA 2CA8A 1BYEA 4XS4B 3IC4A 4HU7A 2GTUA 1B4PA 4XRDA 4MDCA 4G19A 1TTZA 2HZEA 3CTGA 4PX1A 5FHIA 3U6VA 2QC7A 5FWGA 2B5YA 4KB3A 2L5LA 3TUEA 4AJ7A 4IQAA 2BMXA 2H6ZA 2OBIA 1T3BA 4MK3A 4OFMA 3UIWA 1WIKA 2BJXA 1FG4A 4IP1A 1KEBA 3LGCA 5ID2A 3G7YA 3C1SA 1QQ2A 1E2YA 4LA1A 1KNGA 4V2LA 3D5JA 3ZLPA 1XWCA 1ZGNA 1O8XA 2B5XA 4NV5A 2C3QA 3GMFA 5IIZA 5IMCA 4J2FA 4L8EA 2H01A 3OR5A 1O81A 4K1FA 3QAGA 4WF5A 2PPTA 2VLUA 2KP2A 1SJIA 3ERGA 1J0FA 17GSA 2GT6A 1EV4A 1F3AA 1ZL9A 1B9XC 1A2LA 4MJAA 2AV4A 4IELA 1M9AA 2YWIA 1WWJA 1WP0A 4OO4A 4WBJA 2L4QA 2P31A 2KLXA 3V1WA 4N10A 4NMUA 5GAND 4F9ZA 3C73A 3DIEA 1X9WB 3DVXA 5ECHB 4MZCA 4RQXA 1S3DA 2VL9A 6GSWA 1V9WA 4HI7A 2MMZA 4ZB9A 3IHQA 5D9VA 3GX0A 2WFCA 5D9WA 4JRRA 5EL8A 4XTSA 2RM5A 2O7KA 5ECIB 4QL9A 3KEBA 1ZYEA 1GNEA 2M72A 1DUGA 5B8AA 4PQ1A 2XC2A 2H0GA 3ISOA 5IPHA 5AIXA 4ZL7A 4DEJA 2XHFA 3TRXA 2GZZA 1I5GA 1V2AA 3K8NA 3RHCA 1FB6A 4FIWA 2OADA 3LJRA 2VM2A 3KH7A 3QOUA 4I5QA 1HNCA 5B6NA 3GSTA 4ZBAA 1LBKA 2VCWA 2CV4A 4CHSA 4K7NA 2PGTA 4O32A 1EV9A 1C72A 4F0BA 1PKZA 3F6DA 3BJ5A 2DMMA 3EINA 3HYPA 3GH6A 3H8QA 3TCOA 1GNWA 1YZXA 1GUMA 2VL2A 1THXA 4Q5RA 3EU3A 5JCWA 3WGXA 3TKSE 2H73A 20GSA 5KEJA 4X0XA 4PQHA 2V2GA 4XS6A 1OC9A 2IWTA 3ZVJD 2JACA 2DIZA 1HD2A 3ERWA 2R37A 1PL1A 1ZOFA 1TK5B 4TRXA 1G0TA 4KSMA 3GTUB 1DBYA 3F4TA 3ED3A 3FZ5A 3FZ4A 5CYYA 1SKWB 1H4OA 5C00A 1SJZA 4AGSA 2NDOA 2JSZA 5IMZA 3KJYA 2K18A 3KXOA 3KGKA 5G5EA 2JZTA 2YOIA 2L6DA 3TKSC 2H72A 1Q4JA 4POMA 2VCZA 2YANA 3NZNA 4RI7A 4FYUA 3IV4A 3H93A 4KDYA 2IMIA 2H6XA 2L59A 3QFAC 3HJMA 2HZEB 2Z9SA 4IW9A 5D96A 2IMFA 4ZL8A 4ZB8A 2OE1A 4YAVA 6GSSA 2CVKA 2VUPA 1PA3A 3UL3A 1XW6A 4KCAA 2YJHA 1PL2A 2DBCA 3DYRA 4WBRD 1O6JA 4ZBDA 4H86A 2YPMA 1VF2A 1H75A 3J7Yb 7GSSA 2PBJA 2FWGA 5ID2B 1SYXA 2N5FA 5CREA 2JZRA 1U3AA 3P7XA 2H19A 1SD9A 2K9FA 1MDKA 1T8EB 2HRNA 4P3YB 2C3NA 2C4JA 1YF1A 2VCXA 3HA9A 3APOA 1TP9A 2XBQA 2WDUA 4HEA2 2REMA 1K0MA 3IK7A 3TJGA 2L6CA 1UN2A 5DBQA 4ZL9A 2GSQA 3VWVA 2L4CA 4Q5NA 2HI7A 2NPBA 1SL0B 1QFNA 3MSZA 1WJKA 1BJXA 1ZZYA 2M46A 5J3RA 2H6YA 1A2JA 3GL5A 3EE2A 4KAEA 3ZZXA 11GSA 2LQOA 4GRFA 2VD1A 2H1GA 4OWYA 2YP6A 3TRQA 2DJ0A 5IO2A 1XIYA 2LNSA 4ID0A 4ISDA 5L71A 1Y6EA 5HR3A 5D93A 5H5RA 1WMJA 1YQ1A 4OFNA 1N2AA 3F9UA 1Z7RA 5GSSA 1TI3A 3GNJA 3TJFA 4NPBA 1JZOA 2LKUA 3QAVA 1GTAA 1MD4A 2CQ9A 2R6KA 3Q6OA 5J41A 1JFUA 1K3OA 2IL3A 3E3EA 4NHZA 1BX9A 1A8LA 2MMAA 3TJKA 4N30A 1PMTA 3HVVA 1VGLA 1BEDA 1OC8A 3DD3A 4ZIJA 1ZMAA 1M99A 2VIMA 5EPFA 1ERVA 1SJ6A 2X8GA 4F2IA 5HR0A 1XW5A 1GRXA 1W89A 2IMEA 4JBBA 4POBA 1NSWA 4D73A 4RI6A 2HRFA 2LSTA 4I2UA 1G7OA 4I2TA 1YY7A 3KZQA 2YZHA 1EP8A 2CAIA 4ECJA 4IP6A 2X99A 4IS0A 4N0VA 1VF1A 1F9MA 1T00A 5ECOB 2GLRA 3IRAA 1RQMA 4PURA 4XCSA 3JCML 3GKNA 4TR4A 2X64A 2EIRA 2LRCA 3TGZA 1QUWA 1YEXA 3QMXA 4J57E 4EO3A 1T1VA 4MPGA 3LFLA 3MDKA 3IAS2 4FO5A 22GSA 2E0QA 1OC9B 3CRUA 5FT3A 1OVNA 3RPPA 1SD8A 1Z5YE 1V40A 3VWXA 4GSTA 2AB6A 4O5RA 3EYTA 1FHEA 2IN3A 1QMVA 3EMXA 1T7PB 2V6OA 2EIOA 2B1LA 3HD5A 2F8AA 4HUAA 1MEKA 2VCTA 3FZAA 1PQNA 2C80A 1TJDA 2RIIA 4GXZA 2OKAA 5DJMA 3GV1A 1YEPA 3CSIA 2WS2A 2FHEA 4FYCA 5F0GA 3TOUA 4NXIA 4DSRA 5GAPD 4OFTA 1MDIA 2CZ2A 1B4QA 4GSNA 5DALA 4I6XA 3ZMKA 3UAPA 3ME7A 3DMLA 4K9ZA 2H0IA 1K0OA 3D4TA 5ECQB 4K6XA 2IMKA 1TU8A 4KCEA 4KX4A 3F3RA 4IHUA 3IR4A 2JL4A 5JCGA 3F4SA 2OJLA 3LQ7A 2F8FA 2C1YA 4HDEA 4GCIA 2DSAA 2H76A 3MAKA 1GLQA 1J08A 2FNOA 2A4VA 3LXZA 1QK8A 5DAKB 3I69A 1UC7A 2LS5A 1Z3EA 1ERUA 2CAQA 1NHOA 1PX7A 3GX8A 3GN3A 1SENA 3APQA 3W8SA 2H1DA 3F0IA 3VLNA 3VWUA 2HE3A 3GFKA 2XPDA 3RDWA 4ZILA 5CO3A 5KN2A 2VOCA 2A2SA 5ECMB 2FA4A 1EEMA 2L57A 2WJUA 2HNLA 2NVLA 1R4WA 3HKRA 5HFIA 2VM1A 4TR0A 3A2WA 4NAXA 4DSQA 2H70A 3CSHA 3P2AA 3WGEA 2AHEA 2RLIA 1K0BA 2TRCP 2E2MA 1B8XA 4MABA 2GSSA 3FRCA 1ERTA 1T4YA 4V1Ap 3UOMA 2VAFA 1A23A 1B48A 3CYNA 1R5PA 1K0DA 2NTOA 1R26A 1FOVA 4F03A 1ML6A 3ZL5A 1M2BA 3ZIJA 5CRDA 4FYBA 3L78A 3LXTA 2RUFA 2G2QA 2OE3A 2QGVA 2CX3A 4YQVA 1JZRA 2LJAA 1TU7A 3P8WA 6GSXA 3H79A 1ERWA 1NW2A 1RW1A 5F8BA 2GQLA 1CQGA 2VL3A 2DLXA 2FLSA 3GURA 1SL1B 2EC4A 1LJRA 2PVOC 3DVWA 3UJ1A 3FZ9A 1EOGA 3CSJA 2MMOA 9GSSA 1XWAA 2WZ9A 1DE2A 3LG6A 5H5SA 3F8UA 1M9BA 2FUG2 1AC1A 4MF6A 4PQIA 2V32A 3C7MA 4L5OA 3UBLA 1XWKA 3TB2A 1WOUA 1AQWA 3HJPA 4MPFA 4MP4A 3GUSA 5H5QA 4BWSA 5INYA 5KN0A 3LWAA 5ECNB 2P5QA 3F6FA 3TRPA 1R5AA 3KMNA 1E6BA 3LORA 3ZYWA 1WRYA 3FEUA 5C04A 5LCZA 4GWRA 1JHBA 1A24A 2F3MA 2RUEA 2I81A 2OE0A 2H75A 3Q74A 3GA4A 1SU9A 5DQYA 4D73B 5GZZB 1MD3A 1CQHA 4F82A 1SKRB 3GH9A 5CP1A 3RAZA 2ALBA 3L0HA 1RK4A 2FWEA 4MCUA 3TDGA 4AF2A 1SK2A 2GSRA 4XHMA 1XBSA 1XW9A 4MH2A 1TRSA 4ACSA 5ECKB 3N5OA 2JU5A 3LYPA 4O92A 3HXSA 3U5RE 2JSYA 1GUHA 4DSSA 3W8JA 3R2QA 1JLVA 2KHPA 3LYKA 2AUVA 2IJYA 1IYHA 3TJJA 4HU9A 3NOFA 1EGRA 4JR6A 1AQVA 4IBPA 4IJ3A 1X0RA 2WGRA 5D8IA 3KP8A 2R5GA 1WPIA 1JZWA 2IMDA 1NM3A 4TW5A 3DEXA 1U3IA 3IA1A 6GSUA 3G9BA 3D0ZA 2ZNMA 2OACA 5CRWA 4OMVA 4BVXA 3BOAA 2GSTA 4TR3A 4WF4A 3VPTA 1FVKA 5EVOA 2ON5A 3CMIA 2K8SA 1THOA 5DALB 4KGIA 4MF7A 1ZCPA 3HZ8A 2G0FA 2LV3A 3LSZA 1G6WA 4LLRA 1SKSB 5F05A 1AW9A 5DCHA 2ON7A 3IBHA 3FR6A 4RUVA 2FWHA 5IOXA 1OC3A 1F37A 4MLYA 3O3TA 4KNDA 2MYGA 2GZPA 2GZYA 1MDJA 2CT6A 4PNFA 4FH8A 1J9BA 3TOTA 4EDZA 1TI1A 3US3A 1YKCA 4MMMA 1ON4A 4JE1A 3E9JB 2B7JA 1ILOA 5CRHA 2HLSA 5AISA 1AXDA 1F6MC 1F2EA 2I1UA 5IQYA 3QDNA 3GKKA 3FYGA 4G2EA 3EWLA 4K7OA 5HR2A 1OKTA 1DE1A 2V41A 3H1NA 3WYWA 3CXGA 2X8HA 3ZMLA 1M7TA 5JWOB 5IM9A 4MJBA 4WR5A 2MZCA 2HT9A 2J23A 3S9FA 4MJCA 4JR4A 3N9JA 4KDUA 2H71A 4MH3A 4EXJA 4KDXA 1A8YA 5A4VA 13GSA 5F06A 1I9DA 4I8BA
chains in the Genus database with same CATH superfamily
4ZBBA 1GSUA 2FWFA 2HSMA 3KP9A 2GVPA 2IIYA 3A5WA 1ACVA 5B7CA 1M3JA 4XIHA 3HJOA 2DJJA 2DJ1A 3HDCA 5AGYA 4PNGA 4ECBA 3ZIVA 4EDYA 4N0ZA 3M0FA 3M3MA 4HS1A 4GLTA 4HZ2A 4NWYA 2HFDA 1TRUA 4TN8A 5ELAA 2ZCTA 4KA0A 4Z2UA 5G31A 5D9TA 4J56E 1Z6MA 2IFQA 2OBKA 1FW1A 3FKFA 3DRNA 4ULXA 3F3QA 3Q18A 1XOAA 2GT5A 3ZVJA 4ZB6A 3ZFBA 3ZRDA 1R7HA 5DJLA 2C0EA 2HZFA 4NV2A 2VL2C 2EIQA 5A4WA 5A5KA 4ECIA 1Z7PA 2C0GA 3A2XA 2AJQB 3G7JA 1OAZA 3A2VA 1USBA 2WULA 3VI7A 2I9HA 4EF0A 1WE0A 3IE3A 2LRNA 2MBTA 1K0AA 2K8VA 1VRSD 2C0DA 4MZWA 3CBUA 2PUKC 3ME8A 3CRTA 4TVEA 3GKXA 5COHA 2WRTA 2LRTA 4MA9A 2NBSA 3IDVA 3FR3A 5DDLA 3ZITA 4IN0A 1BAYA 3GYKA 2ZUPA 4BL7A 4WXTA 4O5QA 2DJ3A 4EC0A 1URMA 5F07A 3MNGA 1GTBA 4L0WA 4GQCA 3GSSA 2GGTA 1GSFA 1XWBA 2QA2A 4LL1B 2K6VA 4DSSB 1GTIA 5KN3A 2XPEA 2O85A 5LD0A 2IPAA 1ZYQB 3KCMA 1XFLA 4NHWA 4TXVA 5IMVA 1M2DA 5CAXA 4GTUA 3WT1A 2H66A 4K2DA 5B8BA 1SYRA 1G7EA 4ILFA 4G10A 1GWCA 1GLPA 5JWRB 2LJRA 4BWQA 3HZ4A 1GTUA 2YZUA 3D21A 4CDOA 5HFGA 3HVXA 4Q5FA 12GSA 1FO5A 2VD0A 5AIVA 2TRXA 1O85A 3TKSA 2KUCA 4POKA 3ZFLA 4BVXB 2L5OA 1K0NA 1QXHA 4IKHA 1S3AA 3O6TA 2ES7A 2C8UA 5HR1A 2N5AA 10GSA 1XCCA 3APSA 2FY6A 2C0FA 1GSSA 4A5PA 1GL8A 3I6AA 3HHVA 1GSDA 2LJKA 3H4KA 3PR8A 5ABRA 3M9KA 5ECSA 1X9SB 1BQ7A 1V57A 3PGTA 4TR1A 1JZDA 1O7UA 4DVCA 3KMOA 4G9HA 4X43A 5LNKe 5G1KA 2B6MA 1XXUA 4L0UA 3TKPA 3MWHA 4IVFA 2OA7A 3QD9A 3HY2A 3C71A 1XG8A 4EE0A 2PMTA 1F3BA 2A2PA 1M0UA 1KTEA 4WEYA 2B7KA 1EZKA 2YWMA 1Z9HA 4OO5A 5G2ZA 4TXOA 3KD0A 1AUCA 3GHAA 5IMDA 2TIRA 5JWQB 3UARA 5D73A 2YWOA 4ML6A 5A4UA 4CY8A 1HNAA 1GSQA 2R4VA 2J9HA 3AY8A 1HQOA 2JADA 4KUNA 4LMWA 1SL2B 2V1MA 1FB0A 1EOHA 3VWWA 1OE8A 5J9CA 2A2RA 3GRXA 1LU4A 2HXKA 4KSOA 2I4AA 4K8MA 3J7Yk 3GL3A 3MIXA 3LEFA 3IK9A 1PN9A 1EEJA 2F9SA 5HQPA 1ABAA 1PSQA 4E8HA 4GSSA 4JZQA 2PVQA 4HJMA 2C3TA 3I9V2 1KBNA 1OKDA 2WCIA 3QR6A 1X5DA 4V2NA 3F4RA 3F63A 1X9MB 4HOJA 3FHKA 1PD21 4BPYA 3A5IA 2PU9C 4G0LA 4YAPA 1Q98A 3PH9A 1XPVA 3L9VA 3FR9A 3DKSA 2FGXA 2AYTA 2WB9A 6GSYA 4RQRA 4QL7A 2E7PA 3TKRA 4Z7XA 1IYIA 2P5RA 1TW9A 1TK0B 1EGOA 4IGJA 2FD3A 4PGTA 1U88A 5G5FA 2IFQB 2F51A 2MMNA 1TOFA 5DCGA 5CNWA 2H1AA 2B1KA 2QSIA 3UEMA 1K3LA 4FQUA 2YCDA 2HSYA 1GSYA 3L9UA 3HVSA 1M2AA 2O87A 3O76A 4OCFA 4K0NA 3WT2A 3D6IA 1PKWA 1TK8B 4WR4A 3ZREA 1Y25A 4BVYA 2H0HA 4OCEA 2FCHA 1A0RP 2PERA 4GF0A 18GSA 4PUFC 4YQUA 2H30A 4ECCA 2CVBA 2LNTA 2DMLA 3IPZA 3VURA 3NIVA 2CVDA 2A4HA 19GSA 2VCQA 4LL4B 3I43A 3KH9A 3EVIA 1U87A 2D2ZA 1EWXA 1FVJA 5E4WA 2YN1A 3SWLA 2P0GA 2CZ3A 4XRAA 4BL7B 4EKZA 4XS4A 4PTSA 4F0CA 3GKMA 1UA5A 1NHYA 3BCIA 5DVBA 1GSEA 5G30A 4EL1A 2R0GA 4WKWA 2DJKA 3QFBC 3CQFA 3FW2A 3KM6A 3QPMA 2MBSA 2LTKA 1S3CA 2YV7A 3KIJA 1Z6NA 3PINA 3M9JA 4V2MA 4ZXGA 3M1GA 3FMWA 5IPGA 1O8WA 5ENUA 2VCVA 1QGVA 2H1BA 3D4MA 2GQKA 2I3YA 5ELGA 4YH2A 3EC3A 2E2GA 1T4ZA 3DGQA 3RBTA 5DAKA 4POLA 1OYJA 1AQXA 5D9XA 3L9SA 5CRGA 2AAWA 3BD2A 3VI5A 2LEGA 3LW9A 3BCKA 5KN1A 3EU4A 2X49A 3D22A 1K0CA 1FAAA 1PGTA 3VK9A 2B5EA 1GH2A 4GQFA 2HYXA 4ML1A 5G1LA 2VO4A 4K7IA 2CX4A 3M8NA 2HSHA 1PRXA 3EPTA 4HQSA 4WETA 1XZOA 2VLVA 5ECLB 4TR1B 2KP1A 3FK8A 3DWVA 3DXBA 2H8LA 3KTBA 2LQQA 2V6KA 2KOKA 8GSSA 5B6MA 6GSVA 3EURA 3G7IA 3ERFA 4MJEA 1HNBA 2LUSA 3C1RA 3C8EA 3W6GA 1BG5A 2N5BA 4BA7A 1U6TA 4KW6A 4YKFA 3RHBA 1XVQA 2YV9A 4HZ4A 5ECPB 4OD7A 5AN1A 1TDIA 4TXOB 4L5LA 1TRWA 1UVZA 2GQMA 1JLWA 4X1UA 2O89A 1VF3A 3P90A 2O8VB 3QCPA 3L4NA 16GSA 4AJ6A 2YWNA 1ST9A 5J5NA 1AAZA 1GP1A 4Q5QA 4TKYA 6GSTA 1W4VA 2B3SA 14GSA 3QAWA 1YKAA 4YQMA 3UBKA 2JZSA 1VF4A 3Q19A 4MZBA 5JCUA 2X8CA 4CW9A 1V58A 1X5CA 3UMAA 4QQ7A 4KH7A 5DQSA 1G6YA 3UVHA 2GDRA 3RPNA 3GIXA 5GSTA 5IMFA 4HQZA 1XOBA 3WD6A 2FA8A 3IAM2 3UVTA 5ECRB 5HFKA 1HYUA 3CTFA 4IJIA 4LMVA 1N8JA 1V98A 4MF5A 2XBIA 1X5EA 2M80A 4HJ2A 4K0GA 3FY7A 3IXRA 1MTCA 1DSBA 5IOWA 4EUYA 2R2JA 3ZTLA 1TXXA 4IQ1A 4XS1A 4PUAA 4V1Ag 2YNXA 3E0UA 3A3TA 1B9YC 1TRVA 2GS3A 4N11A 1K3YA 5EY6A 1YJ6A 3VPQA 4K5RA 3KTLA 1XWGA 1O73A 2QKEA 4EVMA 3BBYA 4AJ8A 4TOPA 2PN8A 3WGDA 1A0FA 1YF0A 1TKDB 1A2MA 2YJ7A 1EP7A 1PX6A 4O7HA 5IO0A 1OE7A 3EMPA 3R3EA 5IMAA 4JU5A 1YDKA 4E8EA 1SK1A 5J9BA 3TJBA 1GULA 4BVYB 3GTUA 2VLTA 1PFOA 1XVWA 2DC5A 4EIPA 2RM6A 3HCZA 4JEDA 4I97A 2H74A 4KE3A 1SK0A 2DJ2A 2BTOT 3TKQA 4PXOA 3SBCA 3VFIA 1AIUA 2PWJA 5E59A 1GUKA 3IOSA 2R3XA 5J4UA 2DIYA 2CA8A 1BYEA 4XS4B 3IC4A 4HU7A 2GTUA 1B4PA 4XRDA 4MDCA 4G19A 3IHGA 1TTZA 2HZEA 3CTGA 4PX1A 5FHIA 3U6VA 2QC7A 5FWGA 2B5YA 4KB3A 2L5LA 3TUEA 4AJ7A 4IQAA 2BMXA 2H6ZA 2OBIA 1T3BA 4MK3A 4OFMA 3UIWA 1WIKA 2BJXA 1FG4A 4IP1A 1KEBA 3LGCA 5ID2A 3G7YA 3C1SA 1QQ2A 1E2YA 4LA1A 1KNGA 4V2LA 3D5JA 3ZLPA 1XWCA 1ZGNA 1O8XA 2B5XA 4NV5A 2C3QA 3GMFA 5IIZA 4EIQA 5IMCA 4J2FA 4L8EA 2H01A 3OR5A 1O81A 2DKIA 4K1FA 3QAGA 4WF5A 4O5UA 2PPTA 2VLUA 2KP2A 1SJIA 3ERGA 1J0FA 17GSA 2GT6A 1EV4A 1F3AA 1ZL9A 1B9XC 1A2LA 4MJAA 2AV4A 4IELA 1M9AA 2YWIA 1WWJA 1WP0A 4OO4A 4WBJA 2L4QA 2P31A 2KLXA 3V1WA 4N10A 4NMUA 5GAND 4F9ZA 3C73A 3DIEA 1X9WB 3DVXA 5ECHB 4MZCA 4RQXA 1S3DA 2VL9A 6GSWA 1V9WA 4HI7A 2MMZA 4ZB9A 3IHQA 5D9VA 3GX0A 2WFCA 5D9WA 4JRRA 5EL8A 4XTSA 2RM5A 2O7KA 5ECIB 4QL9A 3KEBA 1ZYEA 1GNEA 2M72A 1DUGA 5B8AA 4PQ1A 2XC2A 2H0GA 3ISOA 5IPHA 5AIXA 4ZL7A 4DEJA 2XHFA 3TRXA 2GZZA 1I5GA 1V2AA 3K8NA 3RHCA 1FB6A 4FIWA 2OADA 3LJRA 2VM2A 3KH7A 3QOUA 4I5QA 1HNCA 5B6NA 1S3RA 3GSTA 4ZBAA 1LBKA 2VCWA 2CV4A 4CHSA 4K7NA 2PGTA 4O32A 1EV9A 1C72A 4F0BA 1PKZA 3F6DA 3BJ5A 2DMMA 3EINA 3HYPA 3GH6A 1FOHA 3H8QA 3TCOA 1GNWA 1YZXA 1GUMA 2VL2A 1THXA 4Q5RA 3EU3A 5JCWA 3WGXA 3TKSE 2H73A 20GSA 5KEJA 4X0XA 4PQHA 2V2GA 4XS6A 1OC9A 2IWTA 3ZVJD 2JACA 5BRTA 2DIZA 1HD2A 3ERWA 2R37A 1PL1A 1ZOFA 1TK5B 4TRXA 1G0TA 4KSMA 3GTUB 1DBYA 3F4TA 3ED3A 3FZ5A 3FZ4A 5CYYA 1SKWB 1H4OA 5C00A 1SJZA 4AGSA 5KOXA 2NDOA 2JSZA 5IMZA 3KJYA 2K18A 3KXOA 3KGKA 5G5EA 2JZTA 2YOIA 2L6DA 3TKSC 2H72A 1Q4JA 1M3IA 4POMA 2VCZA 2YANA 3NZNA 4RI7A 4FYUA 3IV4A 3H93A 4KDYA 2IMIA 2H6XA 4Z2RA 2L59A 3QFAC 3HJMA 2HZEB 2Z9SA 4IW9A 5D96A 2IMFA 4ZL8A 4ZB8A 2OE1A 4YAVA 6GSSA 2CVKA 2VUPA 1PA3A 3UL3A 1XW6A 4KCAA 2YJHA 1PL2A 2DBCA 3DYRA 4WBRD 1O6JA 4ZBDA 4H86A 2YPMA 1VF2A 1H75A 3J7Yb 7GSSA 2PBJA 2FWGA 5ID2B 1SYXA 2N5FA 5CREA 2JZRA 1U3AA 3P7XA 2H19A 3PPUA 1SD9A 2K9FA 1MDKA 1T8EB 2HRNA 4P3YB 2C3NA 2C4JA 1YF1A 2VCXA 3HA9A 3APOA 1TP9A 2XBQA 2WDUA 4HEA2 2REMA 1K0MA 3IK7A 3TJGA 2L6CA 1UN2A 5DBQA 4ZL9A 2GSQA 3VWVA 2L4CA 4Q5NA 2HI7A 2NPBA 1SL0B 1QFNA 3MSZA 1WJKA 1BJXA 1ZZYA 2M46A 5J3RA 2H6YA 1A2JA 3GL5A 3EE2A 4KAEA 3ZZXA 11GSA 2LQOA 4GRFA 2VD1A 2H1GA 4OWYA 2YP6A 3TRQA 2DJ0A 5IO2A 1XIYA 2LNSA 4ID0A 4ISDA 5L71A 1Y6EA 5HR3A 2HRAA 5D93A 5H5RA 1WMJA 4K5SA 1YQ1A 4OFNA 1N2AA 3F9UA 1Z7RA 5GSSA 1TI3A 3GNJA 3TJFA 4NPBA 1JZOA 2LKUA 3QAVA 1GTAA 1MD4A 2CQ9A 2R6KA 3Q6OA 5J41A 2QA1A 1JFUA 1K3OA 2IL3A 3E3EA 4NHZA 1BX9A 1A8LA 2MMAA 3TJKA 4N30A 1PMTA 3HVVA 1VGLA 1BEDA 1OC8A 3DD3A 4ZIJA 1ZMAA 1M99A 2VIMA 5EPFA 1ERVA 1SJ6A 2X8GA 4F2IA 5HR0A 1XW5A 1GRXA 1PN0A 1W89A 2IMEA 4JBBA 4POBA 1NSWA 4D73A 4RI6A 2HRFA 2LSTA 4I2UA 1G7OA 4I2TA 1YY7A 3KZQA 2YZHA 1EP8A 2CAIA 4ECJA 3IC8A 4IP6A 2X99A 4IS0A 4N0VA 1VF1A 1F9MA 1T00A 5ECOB 2GLRA 3IRAA 1RQMA 1ZYPA 4PURA 4XCSA 3JCML 3GKNA 4TR4A 2X64A 2EIRA 2LRCA 3TGZA 1QUWA 1YEXA 3QMXA 4J57E 4EO3A 1T1VA 4MPGA 3LFLA 3MDKA 3IAS2 4FO5A 22GSA 4YKGA 2E0QA 4K2XA 1OC9B 3CRUA 5FT3A 1OVNA 3RPPA 1SD8A 1Z5YE 1V40A 3VWXA 4GSTA 2AB6A 2X4AA 4O5RA 3EYTA 1FHEA 2IN3A 1QMVA 3EMXA 1T7PB 2V6OA 2EIOA 2B1LA 3HD5A 2F8AA 4HUAA 1MEKA 2VCTA 3FZAA 1PQNA 2C80A 1TJDA 2RIIA 4GXZA 2OKAA 5DJMA 3GV1A 1YEPA 3CSIA 2WS2A 2FHEA 4FYCA 5F0GA 3TOUA 4NXIA 4DSRA 5GAPD 4OFTA 1MDIA 2CZ2A 1B4QA 4GSNA 5DALA 4I6XA 3ZMKA 3UAPA 3ME7A 3DMLA 1ZYNA 4K9ZA 2H0IA 1K0OA 3D4TA 5ECQB 4K6XA 2IMKA 1TU8A 4KCEA 4KX4A 3F3RA 4IHUA 3IR4A 2JL4A 5JCGA 2R0CA 3F4SA 2OJLA 3LQ7A 2F8FA 2C1YA 4HDEA 4GCIA 2DSAA 2H76A 3MAKA 1GLQA 1J08A 2FNOA 2A4VA 3LXZA 1QK8A 5DAKB 3I69A 1UC7A 2LS5A 4CY6A 1Z3EA 1ERUA 2CAQA 1NHOA 1PX7A 3GX8A 3GN3A 1SENA 3APQA 3W8SA 2H1DA 3F0IA 3VLNA 3VWUA 2HE3A 3GFKA 2XPDA 3RDWA 4ZILA 5CO3A 5KN2A 2VOCA 2A2SA 5ECMB 2FA4A 1EEMA 2L57A 2WJUA 2HNLA 2NVLA 1R4WA 4KF9A 3HKRA 5HFIA 2VM1A 4TR0A 3A2WA 4NAXA 4DSQA 2H70A 3CSHA 3P2AA 3WGEA 2AHEA 2RLIA 1K0BA 2TRCP 2E2MA 1B8XA 4MABA 2GSSA 3FRCA 1ERTA 1T4YA 4V1Ap 3UOMA 2VAFA 1A23A 1B48A 3CYNA 1R5PA 1K0DA 2NTOA 1R26A 1FOVA 4F03A 1ML6A 3ZL5A 1M2BA 3ZIJA 5CRDA 4FYBA 3L78A 3LXTA 2RUFA 2G2QA 2OE3A 2QGVA 2CX3A 4YQVA 1JZRA 2LJAA 1TU7A 3P8WA 6GSXA 3H79A 1ERWA 1NW2A 5F06A 1RW1A 5F8BA 2GQLA 1CQGA 2VL3A 2DLXA 2FLSA 3GURA 1SL1B 2EC4A 4HSCX 1LJRA 2PVOC 3DVWA 3UJ1A 3FZ9A 1EOGA 3MYDA 3CSJA 2MMOA 9GSSA 1XWAA 2WZ9A 1DE2A 3LG6A 5H5SA 3F8UA 1M9BA 2FUG2 1AC1A 4MF6A 4PQIA 2V32A 3C7MA 4L5OA 3UBLA 1XWKA 3TB2A 1WOUA 1AQWA 3HJPA 4MPFA 4MP4A 3GUSA 5H5QA 4BWSA 5INYA 4ICYA 5KN0A 3LWAA 5ECNB 2P5QA 3F6FA 3TRPA 4G0IA 1R5AA 3KMNA 1E6BA 3LORA 3ZYWA 1WRYA 3FEUA 5C04A 5KOWA 5LCZA 4GWRA 1JHBA 1A24A 2F3MA 2RUEA 2I81A 2OE0A 2H75A 3Q74A 3GA4A 1SU9A 5DQYA 4D73B 5GZZB 1MD3A 1CQHA 4F82A 1SKRB 4BIKA 3GH9A 5CP1A 3RAZA 2ALBA 3L0HA 1RK4A 2FWEA 4MCUA 3TDGA 4AF2A 1SK2A 2GSRA 4USSA 4XHMA 1XW9A 4MH2A 1TRSA 4ACSA 5ECKB 3N5OA 2JU5A 3LYPA 4O92A 3HXSA 3U5RE 2JSYA 1GUHA 4DSSA 3W8JA 3R2QA 1JLVA 2KHPA 3LYKA 2AUVA 2IJYA 1IYHA 3TJJA 4HU9A 3NOFA 1EGRA 4JR6A 1AQVA 4IBPA 4IJ3A 1X0RA 2WGRA 5D8IA 4G0KA 3KP8A 2R5GA 1WPIA 1JZWA 2IMDA 1NM3A 4TW5A 3DEXA 1U3IA 5BMUA 3IA1A 6GSUA 3G9BA 3D0ZA 2ZNMA 2OACA 5CRWA 4OMVA 4BVXA 2R0PA 3BOAA 2GSTA 4TR3A 4WF4A 3VPTA 1FVKA 5EVOA 2ON5A 3CMIA 2K8SA 1THOA 5DALB 4KGIA 4MF7A 1ZCPA 3HZ8A 2G0FA 2LV3A 3LSZA 1G6WA 2HRKA 4LLRA 1SKSB 5F05A 1AW9A 5DCHA 2UZ8A 2ON7A 3IBHA 3FR6A 4RUVA 2FWHA 5IOXA 1OC3A 1F37A 4MLYA 3O3TA 4KNDA 2MYGA 2GZPA 2GZYA 1MDJA 2CT6A 4PNFA 4FH8A 1J9BA 3TOTA 4MNNA 1TI1A 4EDZA 3US3A 1YKCA 2DKHA 4MMMA 1ON4A 4JE1A 3E9JB 2B7JA 1ILOA 5CRHA 2HLSA 5AISA 1AXDA 1F6MC 1F2EA 2I1UA 5IQYA 3QDNA 3GKKA 3FYGA 4G2EA 3EWLA 4K7OA 5HR2A 4Z2TA 1OKTA 1DE1A 2V41A 3H1NA 3WYWA 3CXGA 2X8HA 3ZMLA 1M7TA 5JWOB 5IM9A 4MJBA 4WR5A 2MZCA 3HVNA 2HT9A 2J23A 3S9FA 4MJCA 4JR4A 3N9JA 4KDUA 2H71A 4MH3A 4EXJA 4KDXA 4X4JA 1A8YA 5A4VA 13GSA 1XBSA 1I9DA 4I8BA
chains in the Genus database with same CATH topology
4ZBBA 1GSUA 2FWFA 2HSMA 3KP9A 2GVPA 2IIYA 3A5WA 1ACVA 5B7CA 4XIHA 3HJOA 2DJJA 2DJ1A 3HDCA 5AGYA 4PNGA 4ECBA 3ZIVA 4EDYA 4N0ZA 3M0FA 3M3MA 4HS1A 4GLTA 4HZ2A 4NWYA 2HFDA 1TRUA 4TN8A 5ELAA 2ZCTA 4KA0A 4Z2UA 5G31A 5D9TA 4J56E 1Z6MA 2IFQA 2OBKA 1FW1A 3FKFA 3DRNA 4ULXA 3F3QA 3Q18A 1XOAA 2GT5A 3ZVJA 4ZB6A 3ZFBA 3ZRDA 1R7HA 5DJLA 2C0EA 2HZFA 4NV2A 2VL2C 2EIQA 5A4WA 5A5KA 4ECIA 1Z7PA 2C0GA 3A2XA 2AJQB 3G7JA 1OAZA 3A2VA 1USBA 2WULA 3VI7A 2I9HA 4EF0A 1WE0A 3IE3A 2LRNA 2MBTA 1K0AA 2K8VA 1VRSD 2C0DA 4MZWA 3CBUA 2PUKC 3ME8A 3CRTA 4TVEA 3GKXA 5COHA 2WRTA 2LRTA 4MA9A 2NBSA 3IDVA 3FR3A 5DDLA 3ZITA 4IN0A 1BAYA 3GYKA 2ZUPA 4BL7A 4WXTA 4O5QA 2DJ3A 4EC0A 1URMA 5F07A 3MNGA 1GTBA 4L0WA 4GQCA 3GSSA 2GGTA 1GSFA 1XWBA 2QA2A 4LL1B 2K6VA 4DSSB 1GTIA 5KN3A 2XPEA 2O85A 5LD0A 2IPAA 1ZYQB 3KCMA 1XFLA 4NHWA 4TXVA 5IMVA 1M2DA 5CAXA 4GTUA 3WT1A 2H66A 4K2DA 5B8BA 1SYRA 1G7EA 4ILFA 4G10A 1GWCA 1GLPA 5JWRB 2LJRA 4BWQA 3HZ4A 1GTUA 2YZUA 3D21A 4CDOA 5HFGA 3HVXA 4Q5FA 12GSA 1FO5A 2VD0A 5AIVA 2TRXA 1O85A 3TKSA 2KUCA 4POKA 3ZFLA 4BVXB 2L5OA 1K0NA 1QXHA 4IKHA 1S3AA 3O6TA 2ES7A 2C8UA 5HR1A 2N5AA 10GSA 1XCCA 3APSA 2FY6A 2C0FA 1GSSA 4A5PA 1GL8A 3I6AA 3HHVA 1GSDA 2LJKA 3H4KA 3PR8A 5ABRA 3M9KA 5ECSA 1X9SB 1BQ7A 1V57A 3PGTA 4TR1A 1JZDA 1O7UA 4DVCA 3KMOA 4G9HA 4X43A 5LNKe 5G1KA 2B6MA 1XXUA 4L0UA 3TKPA 3MWHA 4IVFA 2OA7A 3QD9A 3HY2A 3C71A 4EE0A 2PMTA 1F3BA 2A2PA 1M0UA 1KTEA 4WEYA 2B7KA 1EZKA 2YWMA 1Z9HA 4OO5A 5G2ZA 4TXOA 3KD0A 1AUCA 3GHAA 5IMDA 2TIRA 5JWQB 3UARA 5D73A 2YWOA 4ML6A 5A4UA 4CY8A 1HNAA 1GSQA 2R4VA 2J9HA 3AY8A 1HQOA 2JADA 4KUNA 4LMWA 1SL2B 2V1MA 1FB0A 1EOHA 3VWWA 1OE8A 5J9CA 2A2RA 3GRXA 1LU4A 2HXKA 4KSOA 2I4AA 4K8MA 3J7Yk 3GL3A 3MIXA 3LEFA 3IK9A 1PN9A 1EEJA 2F9SA 5HQPA 1ABAA 1PSQA 4E8HA 4GSSA 4JZQA 2PVQA 4HJMA 2C3TA 3I9V2 1KBNA 1OKDA 2WCIA 3QR6A 1X5DA 4V2NA 3F4RA 3F63A 1X9MB 4HOJA 3FHKA 1PD21 4BPYA 3A5IA 2PU9C 4G0LA 4YAPA 1Q98A 3PH9A 1XPVA 3L9VA 3FR9A 3DKSA 2FGXA 2AYTA 2WB9A 6GSYA 4RQRA 4QL7A 2E7PA 3TKRA 4Z7XA 1IYIA 2P5RA 1TW9A 1TK0B 1EGOA 4IGJA 2FD3A 4PGTA 1U88A 5G5FA 2IFQB 2F51A 2MMNA 1TOFA 5DCGA 5CNWA 2H1AA 2B1KA 2QSIA 3UEMA 1K3LA 4FQUA 2YCDA 2HSYA 1GSYA 3L9UA 3HVSA 1M2AA 2O87A 3O76A 4OCFA 4K0NA 3WT2A 3D6IA 1PKWA 1TK8B 4WR4A 3ZREA 1Y25A 4BVYA 2H0HA 4OCEA 2FCHA 1A0RP 2PERA 4GF0A 18GSA 4PUFC 4YQUA 2H30A 4ECCA 2CVBA 2LNTA 2DMLA 3IPZA 3VURA 3NIVA 2CVDA 2A4HA 19GSA 2VCQA 4LL4B 3I43A 3KH9A 3EVIA 1U87A 2D2ZA 1EWXA 1FVJA 5E4WA 2YN1A 3SWLA 2P0GA 2CZ3A 4XRAA 4BL7B 4EKZA 4XS4A 4PTSA 4F0CA 3GKMA 1UA5A 1NHYA 3BCIA 5DVBA 1GSEA 5G30A 4EL1A 2R0GA 4WKWA 2DJKA 3QFBC 3FW2A 3KM6A 3QPMA 2MBSA 2LTKA 1S3CA 2YV7A 3KIJA 1Z6NA 3PINA 3M9JA 4V2MA 4ZXGA 3M1GA 3FMWA 5IPGA 1O8WA 5ENUA 2VCVA 1QGVA 2H1BA 3D4MA 2GQKA 2I3YA 5ELGA 4YH2A 3EC3A 2E2GA 1T4ZA 3DGQA 3RBTA 5DAKA 4POLA 1OYJA 1AQXA 5D9XA 3L9SA 5CRGA 2AAWA 3BD2A 3VI5A 2LEGA 3LW9A 3BCKA 5KN1A 3EU4A 2X49A 3D22A 1K0CA 1FAAA 1PGTA 3VK9A 2B5EA 1GH2A 4GQFA 2HYXA 4ML1A 5G1LA 2VO4A 4K7IA 2CX4A 3M8NA 2HSHA 1PRXA 3EPTA 4HQSA 4WETA 1XZOA 2VLVA 5ECLB 4TR1B 2KP1A 3FK8A 3DWVA 3DXBA 2H8LA 3KTBA 2LQQA 2V6KA 2KOKA 8GSSA 5B6MA 6GSVA 3EURA 3G7IA 3ERFA 4MJEA 1HNBA 2LUSA 3C1RA 3C8EA 3W6GA 1BG5A 2N5BA 4BA7A 1U6TA 4KW6A 4YKFA 3RHBA 1XVQA 2YV9A 4HZ4A 5ECPB 4OD7A 5AN1A 1TDIA 4TXOB 4L5LA 1TRWA 1UVZA 2GQMA 1JLWA 4X1UA 2O89A 1VF3A 3P90A 2O8VB 3QCPA 3L4NA 16GSA 4AJ6A 2YWNA 1ST9A 5J5NA 1AAZA 1GP1A 4Q5QA 4TKYA 6GSTA 1W4VA 2B3SA 14GSA 3QAWA 1YKAA 4YQMA 3UBKA 2JZSA 1VF4A 3Q19A 4MZBA 5JCUA 2X8CA 4CW9A 1V58A 1X5CA 3UMAA 4QQ7A 4KH7A 5DQSA 1G6YA 3UVHA 2GDRA 3RPNA 3GIXA 5GSTA 5IMFA 4HQZA 1XOBA 3WD6A 2FA8A 3IAM2 3UVTA 5ECRB 5HFKA 1HYUA 3CTFA 4IJIA 4LMVA 1N8JA 1V98A 4MF5A 2XBIA 1X5EA 2M80A 4HJ2A 4K0GA 3FY7A 3IXRA 1MTCA 1DSBA 5IOWA 4EUYA 2R2JA 3ZTLA 1TXXA 4IQ1A 4XS1A 4PUAA 4V1Ag 2YNXA 3E0UA 3A3TA 1B9YC 1TRVA 2GS3A 4N11A 1K3YA 5EY6A 1YJ6A 3VPQA 4K5RA 3KTLA 1XWGA 1O73A 2QKEA 4EVMA 3BBYA 4AJ8A 4TOPA 2PN8A 3WGDA 1A0FA 1YF0A 1TKDB 1A2MA 2YJ7A 1EP7A 1PX6A 4O7HA 5IO0A 1OE7A 3EMPA 3R3EA 5IMAA 4JU5A 1YDKA 4E8EA 1SK1A 5J9BA 3TJBA 1GULA 4BVYB 3GTUA 2VLTA 1XVWA 2DC5A 4EIPA 2RM6A 3HCZA 4JEDA 4I97A 2H74A 4KE3A 1SK0A 2DJ2A 2BTOT 3TKQA 4PXOA 3SBCA 3VFIA 1AIUA 2PWJA 5E59A 1GUKA 3IOSA 2R3XA 5J4UA 2DIYA 2CA8A 1BYEA 4XS4B 3IC4A 4HU7A 2GTUA 1B4PA 4XRDA 4MDCA 4G19A 3IHGA 1TTZA 2HZEA 3CTGA 4PX1A 5FHIA 3U6VA 2QC7A 5FWGA 2B5YA 4KB3A 2L5LA 3TUEA 4AJ7A 4IQAA 2BMXA 2H6ZA 2OBIA 1T3BA 4MK3A 4OFMA 3UIWA 1WIKA 2BJXA 1FG4A 4IP1A 1KEBA 3LGCA 5ID2A 3G7YA 3C1SA 1QQ2A 1E2YA 4LA1A 1KNGA 4V2LA 3D5JA 3ZLPA 1XWCA 1ZGNA 1O8XA 2B5XA 4NV5A 2C3QA 3GMFA 5IIZA 4EIQA 5IMCA 4J2FA 4L8EA 2H01A 3OR5A 1O81A 2DKIA 4K1FA 3QAGA 4WF5A 4O5UA 2PPTA 2VLUA 2KP2A 1SJIA 3ERGA 1J0FA 17GSA 2GT6A 1EV4A 1F3AA 1ZL9A 1B9XC 1A2LA 4MJAA 2AV4A 4IELA 1M9AA 2YWIA 1WWJA 1WP0A 4OO4A 4WBJA 2L4QA 2P31A 2KLXA 3V1WA 4N10A 4NMUA 5GAND 4F9ZA 3C73A 3DIEA 1X9WB 3DVXA 5ECHB 4MZCA 4RQXA 1S3DA 2VL9A 6GSWA 1V9WA 4HI7A 2MMZA 4ZB9A 3IHQA 5D9VA 3GX0A 2WFCA 5D9WA 4JRRA 5EL8A 4XTSA 2RM5A 2O7KA 5ECIB 4QL9A 3KEBA 1ZYEA 1GNEA 2M72A 1DUGA 5B8AA 4PQ1A 2XC2A 2H0GA 3ISOA 5IPHA 5AIXA 4ZL7A 4DEJA 2XHFA 3TRXA 2GZZA 1I5GA 1V2AA 3K8NA 3RHCA 1FB6A 4FIWA 2OADA 3LJRA 2VM2A 3KH7A 3QOUA 4I5QA 1HNCA 5B6NA 3GSTA 4ZBAA 1LBKA 2VCWA 2CV4A 4CHSA 4K7NA 2PGTA 4O32A 1EV9A 1C72A 4F0BA 1PKZA 3F6DA 3BJ5A 2DMMA 3EINA 3HYPA 3GH6A 1FOHA 3H8QA 3TCOA 1GNWA 1YZXA 1GUMA 2VL2A 1THXA 4Q5RA 3EU3A 5JCWA 3WGXA 3TKSE 2H73A 20GSA 5KEJA 4X0XA 4PQHA 2V2GA 4XS6A 1OC9A 2IWTA 3ZVJD 2JACA 5BRTA 2DIZA 1HD2A 3ERWA 2R37A 1PL1A 1ZOFA 1TK5B 4TRXA 1G0TA 4KSMA 3GTUB 1DBYA 3F4TA 3ED3A 3FZ5A 3FZ4A 5CYYA 1SKWB 1H4OA 5C00A 1SJZA 4AGSA 5KOXA 2NDOA 2JSZA 5IMZA 3KJYA 2K18A 3KXOA 3KGKA 5G5EA 2JZTA 2YOIA 2L6DA 3TKSC 2H72A 1Q4JA 4POMA 2VCZA 2YANA 3NZNA 4RI7A 4FYUA 3IV4A 3H93A 4KDYA 2IMIA 2H6XA 4Z2RA 2L59A 3QFAC 3HJMA 2HZEB 2Z9SA 4IW9A 5D96A 2IMFA 4ZL8A 4ZB8A 2OE1A 4YAVA 6GSSA 2CVKA 2VUPA 1PA3A 3UL3A 1XW6A 4KCAA 2YJHA 1PL2A 2DBCA 3DYRA 4WBRD 1O6JA 4ZBDA 4H86A 2YPMA 1VF2A 1H75A 3J7Yb 7GSSA 2PBJA 2FWGA 5ID2B 1SYXA 2N5FA 5CREA 2JZRA 1U3AA 3P7XA 2H19A 3PPUA 1SD9A 2K9FA 1MDKA 1T8EB 2HRNA 4P3YB 2C3NA 2C4JA 1YF1A 2VCXA 3HA9A 3APOA 1TP9A 2XBQA 2WDUA 4HEA2 2REMA 1K0MA 3IK7A 3TJGA 2L6CA 1UN2A 5DBQA 4ZL9A 2GSQA 3VWVA 2L4CA 4Q5NA 2HI7A 2NPBA 1SL0B 1QFNA 3MSZA 1WJKA 1BJXA 1ZZYA 2M46A 5J3RA 2H6YA 1A2JA 3GL5A 3EE2A 4KAEA 3ZZXA 11GSA 2LQOA 4GRFA 2VD1A 2H1GA 4OWYA 2YP6A 3TRQA 2DJ0A 5IO2A 1XIYA 2LNSA 4ID0A 4ISDA 5L71A 1Y6EA 5HR3A 2HRAA 5D93A 5H5RA 1WMJA 4K5SA 1YQ1A 4OFNA 1N2AA 3F9UA 1Z7RA 5GSSA 1TI3A 3GNJA 3TJFA 4NPBA 1JZOA 2LKUA 3QAVA 1GTAA 1MD4A 2CQ9A 2R6KA 3Q6OA 5J41A 2QA1A 1JFUA 1K3OA 2IL3A 3E3EA 4NHZA 1BX9A 1A8LA 2MMAA 3TJKA 4N30A 1PMTA 3HVVA 1VGLA 1BEDA 1OC8A 3DD3A 4ZIJA 1ZMAA 1M99A 2VIMA 5EPFA 1ERVA 1SJ6A 2X8GA 4F2IA 5HR0A 1XW5A 1GRXA 1PN0A 1W89A 2IMEA 4JBBA 4POBA 1NSWA 4D73A 4RI6A 2HRFA 2LSTA 4I2UA 1G7OA 4I2TA 1YY7A 3KZQA 2YZHA 1EP8A 2CAIA 4ECJA 3IC8A 4IP6A 2X99A 4IS0A 4N0VA 1VF1A 1F9MA 1T00A 5ECOB 2GLRA 3IRAA 1RQMA 1ZYPA 4PURA 4XCSA 3JCML 3GKNA 4TR4A 2X64A 2EIRA 2LRCA 3TGZA 1QUWA 1YEXA 3QMXA 4J57E 4EO3A 1T1VA 4MPGA 3LFLA 3MDKA 3IAS2 4FO5A 22GSA 4YKGA 2E0QA 4K2XA 1OC9B 3CRUA 5FT3A 1OVNA 3RPPA 1SD8A 1Z5YE 1V40A 3VWXA 4GSTA 2AB6A 2X4AA 4O5RA 3EYTA 1FHEA 2IN3A 1QMVA 3EMXA 1T7PB 2V6OA 2EIOA 2B1LA 3HD5A 2F8AA 4HUAA 1MEKA 2VCTA 3FZAA 1PQNA 2C80A 1TJDA 2RIIA 4GXZA 2OKAA 5DJMA 3GV1A 1YEPA 3CSIA 2WS2A 2FHEA 4FYCA 5F0GA 3TOUA 4NXIA 4DSRA 5GAPD 4OFTA 1MDIA 2CZ2A 1B4QA 4GSNA 5DALA 4I6XA 3ZMKA 3UAPA 3ME7A 3DMLA 1ZYNA 4K9ZA 2H0IA 1K0OA 3D4TA 5ECQB 4K6XA 2IMKA 1TU8A 4KCEA 4KX4A 3F3RA 4IHUA 3IR4A 2JL4A 5JCGA 2R0CA 3F4SA 2OJLA 3LQ7A 2F8FA 2C1YA 4HDEA 4GCIA 2DSAA 2H76A 3MAKA 1GLQA 1J08A 2FNOA 2A4VA 3LXZA 1QK8A 5DAKB 3I69A 1UC7A 2LS5A 4CY6A 1Z3EA 1ERUA 2CAQA 1NHOA 1PX7A 3GX8A 3GN3A 1SENA 3APQA 3W8SA 2H1DA 3F0IA 3VLNA 3VWUA 2HE3A 3GFKA 2XPDA 3RDWA 4ZILA 5CO3A 5KN2A 2VOCA 2A2SA 5ECMB 2FA4A 1EEMA 2L57A 2WJUA 2HNLA 2NVLA 1R4WA 4KF9A 3HKRA 5HFIA 2VM1A 4TR0A 3A2WA 4NAXA 4DSQA 2H70A 3CSHA 3P2AA 3WGEA 2AHEA 2RLIA 1K0BA 2TRCP 2E2MA 1B8XA 4MABA 2GSSA 3FRCA 1ERTA 1T4YA 4V1Ap 3UOMA 2VAFA 1A23A 1B48A 3CYNA 1R5PA 1K0DA 2NTOA 1R26A 1FOVA 4F03A 1ML6A 3ZL5A 1M2BA 3ZIJA 5CRDA 4FYBA 3L78A 3LXTA 2RUFA 2G2QA 2OE3A 2QGVA 2CX3A 4YQVA 1JZRA 2LJAA 1TU7A 3P8WA 6GSXA 3H79A 1ERWA 1NW2A 5F06A 1RW1A 5F8BA 2GQLA 1CQGA 2VL3A 2DLXA 2FLSA 3GURA 1SL1B 2EC4A 1LJRA 2PVOC 3DVWA 3UJ1A 3FZ9A 1EOGA 3MYDA 3CSJA 2MMOA 9GSSA 1XWAA 2WZ9A 1DE2A 3LG6A 5H5SA 3F8UA 1M9BA 2FUG2 1AC1A 4MF6A 4PQIA 2V32A 3C7MA 4L5OA 3UBLA 1XWKA 3TB2A 1WOUA 1AQWA 3HJPA 4MPFA 4MP4A 3GUSA 5H5QA 4BWSA 5INYA 4ICYA 5KN0A 3LWAA 5ECNB 2P5QA 3F6FA 3TRPA 4G0IA 1R5AA 3KMNA 1E6BA 3LORA 3ZYWA 1WRYA 3FEUA 5C04A 5KOWA 5LCZA 4GWRA 1JHBA 1A24A 2F3MA 2RUEA 2I81A 2OE0A 2H75A 3Q74A 3GA4A 1SU9A 5DQYA 4D73B 5GZZB 1MD3A 1CQHA 4F82A 1SKRB 3GH9A 5CP1A 3RAZA 2ALBA 3L0HA 1RK4A 2FWEA 4MCUA 3TDGA 4AF2A 1SK2A 2GSRA 4USSA 4XHMA 1XW9A 4MH2A 1TRSA 4ACSA 5ECKB 3N5OA 2JU5A 3LYPA 4O92A 3HXSA 3U5RE 2JSYA 1GUHA 4DSSA 3W8JA 3R2QA 1JLVA 2KHPA 3LYKA 2AUVA 2IJYA 1IYHA 3TJJA 4HU9A 3NOFA 1EGRA 4JR6A 1AQVA 4IBPA 4IJ3A 1X0RA 2WGRA 5D8IA 4G0KA 3KP8A 2R5GA 1WPIA 1JZWA 2IMDA 1NM3A 4TW5A 3DEXA 1U3IA 5BMUA 3IA1A 6GSUA 3G9BA 3D0ZA 2ZNMA 2OACA 5CRWA 4OMVA 4BVXA 2R0PA 3BOAA 2GSTA 4TR3A 4WF4A 3VPTA 1FVKA 5EVOA 2ON5A 3CMIA 2K8SA 1THOA 5DALB 4KGIA 4MF7A 1ZCPA 3HZ8A 2G0FA 2LV3A 3LSZA 1G6WA 2HRKA 4LLRA 1SKSB 5F05A 1AW9A 5DCHA 2UZ8A 2ON7A 3IBHA 3FR6A 4RUVA 2FWHA 5IOXA 1OC3A 1F37A 4MLYA 3O3TA 4KNDA 2MYGA 2GZPA 2GZYA 1MDJA 2CT6A 4PNFA 4FH8A 1J9BA 3TOTA 4MNNA 1TI1A 4EDZA 3US3A 1YKCA 2DKHA 4MMMA 1ON4A 4JE1A 3E9JB 2B7JA 1ILOA 5CRHA 2HLSA 5AISA 1AXDA 1F6MC 1F2EA 2I1UA 5IQYA 3QDNA 3GKKA 3FYGA 4G2EA 3EWLA 4K7OA 5HR2A 4Z2TA 1OKTA 1DE1A 2V41A 3H1NA 3WYWA 3CXGA 2X8HA 3ZMLA 1M7TA 5JWOB 5IM9A 4MJBA 4WR5A 2MZCA 2HT9A 2J23A 3S9FA 4MJCA 4JR4A 3N9JA 4KDUA 2H71A 4MH3A 4EXJA 4KDXA 4X4JA 1A8YA 5A4VA 13GSA 1XBSA 1I9DA 4I8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZBB A;  1GSU A;  2FWF A;  3KP9 A;  2GVP A;  2IIY A;  3A5W A;  1ACV A;  5B7C A;  4XIH A;  3HJO A;  2DJJ A;  2DJ1 A;  3HDC A;  5AGY A;  4PNG A;  4ECB A;  3ZIV A;  4EDY A;  4N0Z A;  3M0F A;  3M3M A;  4HS1 A;  4GLT A;  4HZ2 A;  4NWY A;  2HFD A;  1TRU A;  4TN8 A;  5ELA A;  2ZCT A;  4KA0 A;  5G31 A;  5D9T A;  4J56 E;  1Z6M A;  2IFQ A;  2OBK A;  1FW1 A;  3FKF A;  3DRN A;  4ULX A;  3F3Q A;  3Q18 A;  1XOA A;  2GT5 A;  3ZVJ A;  4ZB6 A;  3ZFB A;  3ZRD A;  1R7H A;  5DJL A;  2C0E A;  2HZF A;  4NV2 A;  2VL2 C;  2EIQ A;  5A4W A;  5A5K A;  4ECI A;  1Z7P A;  2C0G A;  3A2X A;  2AJQ B;  3G7J A;  1OAZ A;  3A2V A;  1USB A;  2WUL A;  3VI7 A;  2I9H A;  4EF0 A;  1WE0 A;  3IE3 A;  2LRN A;  2MBT A;  1K0A A;  2K8V A;  1VRS D;  2C0D A;  4MZW A;  3CBU A;  2PUK C;  3ME8 A;  3CRT A;  4TVE A;  3GKX A;  5COH A;  2WRT A;  2LRT A;  4MA9 A;  2NBS A;  3IDV A;  3FR3 A;  5DDL A;  3ZIT A;  4IN0 A;  1BAY A;  3GYK A;  2ZUP A;  4BL7 A;  4WXT A;  2DJ3 A;  4EC0 A;  1URM A;  5F07 A;  3MNG A;  1GTB A;  4L0W A;  4GQC A;  3GSS A;  2GGT A;  1GSF A;  1XWB A;  4LL1 B;  2K6V A;  4DSS B;  1GTI A;  5KN3 A;  2XPE A;  2O85 A;  5LD0 A;  2IPA A;  1ZYQ B;  3KCM A;  1XFL A;  4NHW A;  4TXV A;  5IMV A;  1M2D A;  5CAX A;  4GTU A;  3WT1 A;  2H66 A;  4K2D A;  5B8B A;  1SYR A;  1G7E A;  4ILF A;  4G10 A;  1GWC A;  1GLP A;  5JWR B;  2LJR A;  4BWQ A;  3HZ4 A;  1GTU A;  2YZU A;  3D21 A;  4CDO A;  5HFG A;  3HVX A;  4Q5F A;  12GS A;  1FO5 A;  2VD0 A;  5AIV A;  2TRX A;  1O85 A;  3TKS A;  2KUC A;  4POK A;  3ZFL A;  2L5O A;  1K0N A;  1QXH A;  4IKH A;  1S3A A;  3O6T A;  2ES7 A;  2C8U A;  5HR1 A;  2N5A A;  10GS A;  1XCC A;  3APS A;  2FY6 A;  2C0F A;  1GSS A;  1GL8 A;  3I6A A;  3HHV A;  1GSD A;  2LJK A;  3H4K A;  3PR8 A;  5ABR A;  3M9K A;  5ECS A;  1X9S B;  1BQ7 A;  1V57 A;  3PGT A;  4TR1 A;  1JZD A;  1O7U A;  4DVC A;  3KMO A;  4G9H A;  4X43 A;  5LNK e;  5G1K A;  2B6M A;  1XXU A;  4L0U A;  3TKP A;  3MWH A;  4IVF A;  2OA7 A;  3QD9 A;  3HY2 A;  3C71 A;  4EE0 A;  2PMT A;  1F3B A;  1M0U A;  1KTE A;  4WEY A;  2B7K A;  1EZK A;  2YWM A;  1Z9H A;  4OO5 A;  5G2Z A;  4TXO A;  3KD0 A;  1AUC A;  3GHA A;  5IMD A;  2TIR A;  5JWQ B;  3UAR A;  5D73 A;  2YWO A;  4ML6 A;  5A4U A;  1HNA A;  1GSQ A;  2R4V A;  2J9H A;  3AY8 A;  1HQO A;  2JAD A;  4KUN A;  4LMW A;  1SL2 B;  2V1M A;  1FB0 A;  1EOH A;  3VWW A;  1OE8 A;  5J9C A;  2A2R A;  3GRX A;  1LU4 A;  2HXK A;  4KSO A;  2I4A A;  4K8M A;  3J7Y k;  3GL3 A;  3LEF A;  3IK9 A;  1PN9 A;  1EEJ A;  2F9S A;  5HQP A;  1ABA A;  1PSQ A;  4E8H A;  4GSS A;  4JZQ A;  2PVQ A;  4HJM A;  2C3T A;  3I9V 2;  1KBN A;  1OKD A;  2WCI A;  3QR6 A;  1X5D A;  4V2N A;  3F4R A;  3F63 A;  1X9M B;  4HOJ A;  3FHK A;  1PD2 1;  4BPY A;  2PU9 C;  4YAP A;  1Q98 A;  3PH9 A;  1XPV A;  3L9V A;  3FR9 A;  3DKS A;  2FGX A;  2AYT A;  2WB9 A;  6GSY A;  4RQR A;  4QL7 A;  2E7P A;  3TKR A;  4Z7X A;  1IYI A;  2P5R A;  1TW9 A;  1TK0 B;  1EGO A;  4IGJ A;  2FD3 A;  4PGT A;  1U88 A;  5G5F A;  2IFQ B;  2F51 A;  2MMN A;  1TOF A;  5DCG A;  5CNW A;  2H1A A;  2B1K A;  2QSI A;  3UEM A;  1K3L A;  2YCD A;  2HSY A;  1GSY A;  3L9U A;  3HVS A;  1M2A A;  2O87 A;  3O76 A;  4OCF A;  4K0N A;  3WT2 A;  3D6I A;  1PKW A;  1TK8 B;  4WR4 A;  3ZRE A;  1Y25 A;  4BVY A;  2H0H A;  4OCE A;  2FCH A;  1A0R P;  2PER A;  4GF0 A;  18GS A;  4PUF C;  4YQU A;  2H30 A;  4ECC A;  2CVB A;  2LNT A;  2DML A;  3IPZ A;  3VUR A;  3NIV A;  2CVD A;  19GS A;  2VCQ A;  4LL4 B;  3I43 A;  3KH9 A;  3EVI A;  1U87 A;  2D2Z A;  1EWX A;  1FVJ A;  5E4W A;  2YN1 A;  3SWL A;  2P0G A;  2CZ3 A;  4XRA A;  4EKZ A;  4XS4 A;  4F0C A;  3GKM A;  1UA5 A;  1NHY A;  3BCI A;  5DVB A;  1GSE A;  5G30 A;  4EL1 A;  4WKW A;  2DJK A;  3QFB C;  3FW2 A;  3KM6 A;  3QPM A;  2MBS A;  2LTK A;  1S3C A;  2YV7 A;  3KIJ A;  1Z6N A;  3PIN A;  3M9J A;  4V2M A;  4ZXG A;  3M1G A;  5IPG A;  1O8W A;  5ENU A;  2VCV A;  1QGV A;  2H1B A;  3D4M A;  2GQK A;  2I3Y A;  5ELG A;  4YH2 A;  3EC3 A;  2E2G A;  1T4Z A;  3DGQ A;  3RBT A;  5DAK A;  4POL A;  1OYJ A;  1AQX A;  5D9X A;  3L9S A;  5CRG A;  2AAW A;  3BD2 A;  3VI5 A;  2LEG A;  3BCK A;  5KN1 A;  3EU4 A;  3D22 A;  1K0C A;  1FAA A;  1PGT A;  3VK9 A;  2B5E A;  1GH2 A;  4GQF A;  2HYX A;  4ML1 A;  5G1L A;  2VO4 A;  4K7I A;  2CX4 A;  3M8N A;  2HSH A;  1PRX A;  4WET A;  4HQS A;  1XZO A;  2VLV A;  5ECL B;  4TR1 B;  2KP1 A;  3FK8 A;  3DWV A;  3DXB A;  2H8L A;  3KTB A;  2LQQ A;  2V6K A;  2KOK A;  8GSS A;  5B6M A;  6GSV A;  3EUR A;  3G7I A;  3ERF A;  4MJE A;  1HNB A;  2LUS A;  3C1R A;  3C8E A;  3W6G A;  1BG5 A;  2N5B A;  4BA7 A;  1U6T A;  4KW6 A;  3RHB A;  1XVQ A;  2YV9 A;  4HZ4 A;  5ECP B;  4OD7 A;  5AN1 A;  1TDI A;  4TXO B;  4L5L A;  1TRW A;  1UVZ A;  2GQM A;  1JLW A;  4X1U A;  2O89 A;  1VF3 A;  3P90 A;  2O8V B;  3QCP A;  3L4N A;  16GS A;  4AJ6 A;  2YWN A;  1ST9 A;  5J5N A;  1AAZ A;  1GP1 A;  4Q5Q A;  4TKY A;  6GST A;  1W4V A;  2B3S A;  14GS A;  3QAW A;  1YKA A;  4YQM A;  3UBK A;  2JZS A;  1VF4 A;  3Q19 A;  4MZB A;  5JCU A;  2X8C A;  4CW9 A;  1V58 A;  1X5C A;  3UMA A;  4QQ7 A;  4KH7 A;  5DQS A;  1G6Y A;  3UVH A;  2GDR A;  3RPN A;  3GIX A;  5GST A;  5IMF A;  4HQZ A;  1XOB A;  3WD6 A;  2FA8 A;  3IAM 2;  3UVT A;  5ECR B;  5HFK A;  1HYU A;  3CTF A;  4IJI A;  4LMV A;  1N8J A;  1V98 A;  4MF5 A;  2XBI A;  1X5E A;  2M80 A;  4HJ2 A;  4K0G A;  3FY7 A;  3IXR A;  1MTC A;  1DSB A;  5IOW A;  4EUY A;  2R2J A;  3ZTL A;  1TXX A;  4IQ1 A;  4XS1 A;  4PUA A;  4V1A g;  2YNX A;  3E0U A;  3A3T A;  1B9Y C;  1TRV A;  2GS3 A;  4N11 A;  1K3Y A;  5EY6 A;  1YJ6 A;  3VPQ A;  3KTL A;  1XWG A;  1O73 A;  2QKE A;  4EVM A;  3BBY A;  4AJ8 A;  4TOP A;  2PN8 A;  3WGD A;  1A0F A;  1YF0 A;  1TKD B;  1A2M A;  2YJ7 A;  1EP7 A;  1PX6 A;  4O7H A;  5IO0 A;  1OE7 A;  3EMP A;  5IMA A;  4JU5 A;  1YDK A;  4E8E A;  1SK1 A;  5J9B A;  3TJB A;  1GUL A;  3GTU A;  2VLT A;  1XVW A;  2DC5 A;  2RM6 A;  3HCZ A;  4JED A;  4I97 A;  2H74 A;  4KE3 A;  1SK0 A;  2DJ2 A;  2BTO T;  3TKQ A;  4PXO A;  3SBC A;  3VFI A;  1AIU A;  2PWJ A;  5E59 A;  1GUK A;  3IOS A;  2R3X A;  5J4U A;  2DIY A;  2CA8 A;  1BYE A;  4XS4 B;  3IC4 A;  4HU7 A;  2GTU A;  1B4P A;  4XRD A;  4MDC A;  4G19 A;  1TTZ A;  2HZE A;  3CTG A;  4PX1 A;  5FHI A;  3U6V A;  2QC7 A;  5FWG A;  2B5Y A;  4KB3 A;  2L5L A;  3TUE A;  4AJ7 A;  4IQA A;  2BMX A;  2H6Z A;  2OBI A;  1T3B A;  4MK3 A;  4OFM A;  3UIW A;  1WIK A;  2BJX A;  1FG4 A;  4IP1 A;  1KEB A;  3LGC A;  5ID2 A;  3G7Y A;  3C1S A;  1QQ2 A;  1E2Y A;  4LA1 A;  1KNG A;  4V2L A;  3D5J A;  3ZLP A;  1XWC A;  1ZGN A;  1O8X A;  2B5X A;  4NV5 A;  2C3Q A;  3GMF A;  5IIZ A;  5IMC A;  4J2F A;  4L8E A;  2H01 A;  3OR5 A;  1O81 A;  4K1F A;  3QAG A;  4WF5 A;  2PPT A;  2VLU A;  2KP2 A;  1SJI A;  3ERG A;  1J0F A;  17GS A;  2GT6 A;  1EV4 A;  1F3A A;  1ZL9 A;  1B9X C;  1A2L A;  4MJA A;  2AV4 A;  4IEL A;  1M9A A;  2YWI A;  1WWJ A;  1WP0 A;  4OO4 A;  4WBJ A;  2L4Q A;  2P31 A;  2KLX A;  3V1W A;  4N10 A;  4NMU A;  5GAN D;  4F9Z A;  3C73 A;  3DIE A;  1X9W B;  3DVX A;  5ECH B;  4MZC A;  4RQX A;  1S3D A;  2VL9 A;  6GSW A;  1V9W A;  4HI7 A;  2MMZ A;  4ZB9 A;  3IHQ A;  5D9V A;  3GX0 A;  2WFC A;  5D9W A;  4JRR A;  5EL8 A;  4XTS A;  2RM5 A;  2O7K A;  5ECI B;  4QL9 A;  3KEB A;  1ZYE A;  1GNE A;  2M72 A;  1DUG A;  5B8A A;  4PQ1 A;  2XC2 A;  2H0G A;  3ISO A;  5IPH A;  5AIX A;  4ZL7 A;  4DEJ A;  2XHF A;  3TRX A;  2GZZ A;  1I5G A;  1V2A A;  3K8N A;  3RHC A;  1FB6 A;  4FIW A;  2OAD A;  3LJR A;  2VM2 A;  3KH7 A;  3QOU A;  4I5Q A;  1HNC A;  5B6N A;  3GST A;  4ZBA A;  1LBK A;  2VCW A;  2CV4 A;  4CHS A;  4K7N A;  2PGT A;  4O32 A;  1EV9 A;  1C72 A;  4F0B A;  1PKZ A;  3F6D A;  3BJ5 A;  2DMM A;  3EIN A;  3HYP A;  3GH6 A;  3H8Q A;  3TCO A;  1GNW A;  1YZX A;  1GUM A;  2VL2 A;  1THX A;  4Q5R A;  3EU3 A;  5JCW A;  3WGX A;  3TKS E;  2H73 A;  20GS A;  5KEJ A;  4X0X A;  4PQH A;  2V2G A;  4XS6 A;  1OC9 A;  2IWT A;  3ZVJ D;  2JAC A;  2DIZ A;  1HD2 A;  3ERW A;  2R37 A;  1PL1 A;  1ZOF A;  1TK5 B;  4TRX A;  1G0T A;  4KSM A;  3GTU B;  1DBY A;  3F4T A;  3ED3 A;  3FZ5 A;  3FZ4 A;  5CYY A;  1SKW B;  1H4O A;  5C00 A;  1SJZ A;  4AGS A;  2NDO A;  2JSZ A;  5IMZ A;  3KJY A;  2K18 A;  3KXO A;  3KGK A;  5G5E A;  2JZT A;  2YOI A;  2L6D A;  3TKS C;  2H72 A;  1Q4J A;  4POM A;  2VCZ A;  2YAN A;  3NZN A;  4RI7 A;  4FYU A;  3IV4 A;  3H93 A;  4KDY A;  2IMI A;  2H6X A;  2L59 A;  3QFA C;  3HJM A;  2HZE B;  2Z9S A;  4IW9 A;  5D96 A;  2IMF A;  4ZL8 A;  4ZB8 A;  2OE1 A;  4YAV A;  6GSS A;  2CVK A;  2VUP A;  1PA3 A;  3UL3 A;  1XW6 A;  4KCA A;  2YJH A;  1PL2 A;  2DBC A;  3DYR A;  4WBR D;  1O6J A;  4ZBD A;  4H86 A;  2YPM A;  1VF2 A;  1H75 A;  3J7Y b;  7GSS A;  2PBJ A;  2FWG A;  5ID2 B;  1SYX A;  2N5F A;  5CRE A;  2JZR A;  1U3A A;  3P7X A;  2H19 A;  1SD9 A;  2K9F A;  1MDK A;  1T8E B;  2HRN A;  4P3Y B;  2C3N A;  2C4J A;  1YF1 A;  2VCX A;  3HA9 A;  3APO A;  1TP9 A;  2XBQ A;  2WDU A;  4HEA 2;  2REM A;  1K0M A;  3IK7 A;  3TJG A;  2L6C A;  1UN2 A;  5DBQ A;  4ZL9 A;  2GSQ A;  3VWV A;  2L4C A;  4Q5N A;  2HI7 A;  2NPB A;  1SL0 B;  1QFN A;  3MSZ A;  1WJK A;  1BJX A;  1ZZY A;  2M46 A;  5J3R A;  2H6Y A;  1A2J A;  3GL5 A;  3EE2 A;  4KAE A;  3ZZX A;  11GS A;  2LQO A;  4GRF A;  2VD1 A;  2H1G A;  4OWY A;  2YP6 A;  3TRQ A;  2DJ0 A;  5IO2 A;  1XIY A;  2LNS A;  4ID0 A;  4ISD A;  5L71 A;  1Y6E A;  5HR3 A;  5D93 A;  5H5R A;  1WMJ A;  1YQ1 A;  4OFN A;  1N2A A;  3F9U A;  1Z7R A;  5GSS A;  1TI3 A;  3GNJ A;  3TJF A;  4NPB A;  1JZO A;  2LKU A;  3QAV A;  1GTA A;  1MD4 A;  2CQ9 A;  2R6K A;  3Q6O A;  5J41 A;  1JFU A;  1K3O A;  2IL3 A;  3E3E A;  4NHZ A;  1BX9 A;  1A8L A;  2MMA A;  3TJK A;  4N30 A;  1PMT A;  3HVV A;  1VGL A;  1BED A;  1OC8 A;  3DD3 A;  4ZIJ A;  1ZMA A;  1M99 A;  2VIM A;  5EPF A;  1ERV A;  1SJ6 A;  2X8G A;  4F2I A;  5HR0 A;  1XW5 A;  1GRX A;  1W89 A;  2IME A;  4JBB A;  4POB A;  1NSW A;  4D73 A;  4RI6 A;  2HRF A;  2LST A;  4I2U A;  1G7O A;  4I2T A;  1YY7 A;  3KZQ A;  2YZH A;  1EP8 A;  2CAI A;  4ECJ A;  4IP6 A;  2X99 A;  4IS0 A;  4N0V A;  1VF1 A;  1F9M A;  1T00 A;  5ECO B;  2GLR A;  3IRA A;  1RQM A;  4PUR A;  4XCS A;  3JCM L;  3GKN A;  4TR4 A;  2X64 A;  2EIR A;  2LRC A;  3TGZ A;  1QUW A;  1YEX A;  3QMX A;  4J57 E;  4EO3 A;  1T1V A;  4MPG A;  3LFL A;  3MDK A;  3IAS 2;  4FO5 A;  22GS A;  2E0Q A;  1OC9 B;  3CRU A;  5FT3 A;  1OVN A;  3RPP A;  1SD8 A;  1Z5Y E;  1V40 A;  3VWX A;  4GST A;  2AB6 A;  4O5R A;  3EYT A;  1FHE A;  2IN3 A;  1QMV A;  3EMX A;  1T7P B;  2V6O A;  2EIO A;  2B1L A;  3HD5 A;  2F8A A;  4HUA A;  1MEK A;  2VCT A;  3FZA A;  1PQN A;  2C80 A;  1TJD A;  2RII A;  4GXZ A;  2OKA A;  5DJM A;  3GV1 A;  1YEP A;  3CSI A;  2WS2 A;  2FHE A;  4FYC A;  5F0G A;  3TOU A;  4NXI A;  4DSR A;  5GAP D;  4OFT A;  1MDI A;  2CZ2 A;  1B4Q A;  4GSN A;  5DAL A;  4I6X A;  3ZMK A;  3UAP A;  3ME7 A;  3DML A;  4K9Z A;  2H0I A;  1K0O A;  3D4T A;  5ECQ B;  4K6X A;  2IMK A;  1TU8 A;  4KCE A;  4KX4 A;  3F3R A;  4IHU A;  3IR4 A;  2JL4 A;  5JCG A;  3F4S A;  2OJL A;  3LQ7 A;  2F8F A;  2C1Y A;  4HDE A;  4GCI A;  2DSA A;  2H76 A;  3MAK A;  1GLQ A;  1J08 A;  2FNO A;  2A4V A;  3LXZ A;  1QK8 A;  5DAK B;  3I69 A;  1UC7 A;  2LS5 A;  1Z3E A;  1ERU A;  2CAQ A;  1NHO A;  1PX7 A;  3GX8 A;  3GN3 A;  1SEN A;  3APQ A;  3W8S A;  2H1D A;  3F0I A;  3VLN A;  3VWU A;  2HE3 A;  3GFK A;  2XPD A;  3RDW A;  4ZIL A;  5CO3 A;  5KN2 A;  2VOC A;  2A2S A;  5ECM B;  2FA4 A;  1EEM A;  2L57 A;  2WJU A;  2HNL A;  2NVL A;  1R4W A;  3HKR A;  5HFI A;  2VM1 A;  4TR0 A;  3A2W A;  4NAX A;  4DSQ A;  2H70 A;  3CSH A;  3P2A A;  3WGE A;  2AHE A;  2RLI A;  1K0B A;  2TRC P;  2E2M A;  1B8X A;  4MAB A;  2GSS A;  3FRC A;  1ERT A;  1T4Y A;  4V1A p;  3UOM A;  2VAF A;  1A23 A;  1B48 A;  3CYN A;  1R5P A;  1K0D A;  2NTO A;  1R26 A;  1FOV A;  4F03 A;  1ML6 A;  3ZL5 A;  1M2B A;  3ZIJ A;  5CRD A;  4FYB A;  3L78 A;  3LXT A;  2RUF A;  2G2Q A;  2OE3 A;  2QGV A;  2CX3 A;  4YQV A;  1JZR A;  2LJA A;  1TU7 A;  3P8W A;  6GSX A;  3H79 A;  1ERW A;  1NW2 A;  1RW1 A;  5F8B A;  2GQL A;  1CQG A;  2VL3 A;  2DLX A;  2FLS A;  3GUR A;  1SL1 B;  2EC4 A;  1LJR A;  2PVO C;  3DVW A;  3UJ1 A;  3FZ9 A;  1EOG A;  3CSJ A;  2MMO A;  9GSS A;  1XWA A;  2WZ9 A;  1DE2 A;  3LG6 A;  5H5S A;  3F8U A;  1M9B A;  2FUG 2;  1AC1 A;  4MF6 A;  4PQI A;  2V32 A;  3C7M A;  4L5O A;  3UBL A;  1XWK A;  3TB2 A;  1WOU A;  1AQW A;  3HJP A;  4MPF A;  4MP4 A;  3GUS A;  5H5Q A;  4BWS A;  5INY A;  5KN0 A;  3LWA A;  5ECN B;  2P5Q A;  3F6F A;  3TRP A;  1R5A A;  3KMN A;  1E6B A;  3LOR A;  3ZYW A;  1WRY A;  3FEU A;  5C04 A;  5LCZ A;  4GWR A;  1JHB A;  1A24 A;  2F3M A;  2RUE A;  2I81 A;  2OE0 A;  2H75 A;  3Q74 A;  3GA4 A;  1SU9 A;  5DQY A;  4D73 B;  5GZZ B;  1MD3 A;  1CQH A;  4F82 A;  1SKR B;  3GH9 A;  5CP1 A;  3RAZ A;  2ALB A;  3L0H A;  1RK4 A;  2FWE A;  4MCU A;  3TDG A;  4AF2 A;  1SK2 A;  2GSR A;  4XHM A;  1XBS A;  1XW9 A;  4MH2 A;  1TRS A;  4ACS A;  5ECK B;  3N5O A;  2JU5 A;  3LYP A;  4O92 A;  3HXS A;  3U5R E;  2JSY A;  1GUH A;  4DSS A;  3W8J A;  3R2Q A;  1JLV A;  2KHP A;  3LYK A;  2AUV A;  2IJY A;  1IYH A;  3TJJ A;  4HU9 A;  3NOF A;  1EGR A;  4JR6 A;  1AQV A;  4IBP A;  4IJ3 A;  1X0R A;  2WGR A;  5D8I A;  3KP8 A;  2R5G A;  1WPI A;  1JZW A;  2IMD A;  1NM3 A;  4TW5 A;  3DEX A;  1U3I A;  3IA1 A;  6GSU A;  3G9B A;  3D0Z A;  2ZNM A;  2OAC A;  5CRW A;  4OMV A;  4BVX A;  3BOA A;  2GST A;  4TR3 A;  4WF4 A;  3VPT A;  1FVK A;  5EVO A;  2ON5 A;  3CMI A;  2K8S A;  1THO A;  5DAL B;  4KGI A;  4MF7 A;  1ZCP A;  3HZ8 A;  2G0F A;  2LV3 A;  3LSZ A;  1G6W A;  4LLR A;  1SKS B;  5F05 A;  1AW9 A;  5DCH A;  2ON7 A;  3IBH A;  3FR6 A;  4RUV A;  2FWH A;  5IOX A;  1OC3 A;  1F37 A;  4MLY A;  3O3T A;  4KND A;  2MYG A;  2GZP A;  2GZY A;  1MDJ A;  2CT6 A;  4PNF A;  4FH8 A;  1J9B A;  3TOT A;  4EDZ A;  1TI1 A;  3US3 A;  1YKC A;  4MMM A;  1ON4 A;  4JE1 A;  3E9J B;  2B7J A;  1ILO A;  5CRH A;  2HLS A;  5AIS A;  1AXD A;  1F6M C;  1F2E A;  2I1U A;  5IQY A;  3QDN A;  3GKK A;  3FYG A;  4G2E A;  3EWL A;  4K7O A;  5HR2 A;  1OKT A;  1DE1 A;  2V41 A;  3H1N A;  3WYW A;  3CXG A;  2X8H A;  3ZML A;  1M7T A;  5JWO B;  5IM9 A;  4MJB A;  4WR5 A;  2MZC A;  2HT9 A;  2J23 A;  3S9F A;  4MJC A;  4JR4 A;  3N9J A;  4KDU A;  2H71 A;  4MH3 A;  4EXJ A;  4KDX A;  1A8Y A;  5A4V A;  13GS A;  5F06 A;  1I9D A;  4I8B A; 
#chains in the Genus database with same CATH topology
 4ZBB A;  1GSU A;  2FWF A;  2HSM A;  3KP9 A;  2GVP A;  2IIY A;  3A5W A;  1ACV A;  5B7C A;  1M3J A;  4XIH A;  3HJO A;  2DJJ A;  2DJ1 A;  3HDC A;  5AGY A;  4PNG A;  4ECB A;  3ZIV A;  4EDY A;  4N0Z A;  3M0F A;  3M3M A;  4HS1 A;  4GLT A;  4HZ2 A;  4NWY A;  2HFD A;  1TRU A;  4TN8 A;  5ELA A;  2ZCT A;  4KA0 A;  4Z2U A;  5G31 A;  5D9T A;  4J56 E;  1Z6M A;  2IFQ A;  2OBK A;  1FW1 A;  3FKF A;  3DRN A;  4ULX A;  3F3Q A;  3Q18 A;  1XOA A;  2GT5 A;  3ZVJ A;  4ZB6 A;  3ZFB A;  3ZRD A;  1R7H A;  5DJL A;  2C0E A;  2HZF A;  4NV2 A;  2VL2 C;  2EIQ A;  5A4W A;  5A5K A;  4ECI A;  1Z7P A;  2C0G A;  3A2X A;  2AJQ B;  3G7J A;  1OAZ A;  3A2V A;  1USB A;  2WUL A;  3VI7 A;  2I9H A;  4EF0 A;  1WE0 A;  3IE3 A;  2LRN A;  2MBT A;  1K0A A;  2K8V A;  1VRS D;  2C0D A;  4MZW A;  3CBU A;  2PUK C;  3ME8 A;  3CRT A;  4TVE A;  3GKX A;  5COH A;  2WRT A;  2LRT A;  4MA9 A;  2NBS A;  3IDV A;  3FR3 A;  5DDL A;  3ZIT A;  4IN0 A;  1BAY A;  3GYK A;  2ZUP A;  4BL7 A;  4WXT A;  4O5Q A;  2DJ3 A;  4EC0 A;  1URM A;  5F07 A;  3MNG A;  1GTB A;  4L0W A;  4GQC A;  3GSS A;  2GGT A;  1GSF A;  1XWB A;  2QA2 A;  4LL1 B;  2K6V A;  4DSS B;  1GTI A;  5KN3 A;  2XPE A;  2O85 A;  5LD0 A;  2IPA A;  1ZYQ B;  3KCM A;  1XFL A;  4NHW A;  4TXV A;  5IMV A;  1M2D A;  5CAX A;  4GTU A;  3WT1 A;  2H66 A;  4K2D A;  5B8B A;  1SYR A;  1G7E A;  4ILF A;  4G10 A;  1GWC A;  1GLP A;  5JWR B;  2LJR A;  4BWQ A;  3HZ4 A;  1GTU A;  2YZU A;  3D21 A;  4CDO A;  5HFG A;  3HVX A;  4Q5F A;  12GS A;  1FO5 A;  2VD0 A;  5AIV A;  2TRX A;  1O85 A;  3TKS A;  2KUC A;  4POK A;  3ZFL A;  4BVX B;  2L5O A;  1K0N A;  1QXH A;  4IKH A;  1S3A A;  3O6T A;  2ES7 A;  2C8U A;  5HR1 A;  2N5A A;  10GS A;  1XCC A;  3APS A;  2FY6 A;  2C0F A;  1GSS A;  4A5P A;  1GL8 A;  3I6A A;  3HHV A;  1GSD A;  2LJK A;  3H4K A;  3PR8 A;  5ABR A;  3M9K A;  5ECS A;  1X9S B;  1BQ7 A;  1V57 A;  3PGT A;  4TR1 A;  1JZD A;  1O7U A;  4DVC A;  3KMO A;  4G9H A;  4X43 A;  5LNK e;  5G1K A;  2B6M A;  1XXU A;  4L0U A;  3TKP A;  3MWH A;  4IVF A;  2OA7 A;  3QD9 A;  3HY2 A;  3C71 A;  1XG8 A;  4EE0 A;  2PMT A;  1F3B A;  2A2P A;  1M0U A;  1KTE A;  4WEY A;  2B7K A;  1EZK A;  2YWM A;  1Z9H A;  4OO5 A;  5G2Z A;  4TXO A;  3KD0 A;  1AUC A;  3GHA A;  5IMD A;  2TIR A;  5JWQ B;  3UAR A;  5D73 A;  2YWO A;  4ML6 A;  5A4U A;  4CY8 A;  1HNA A;  1GSQ A;  2R4V A;  2J9H A;  3AY8 A;  1HQO A;  2JAD A;  4KUN A;  4LMW A;  1SL2 B;  2V1M A;  1FB0 A;  1EOH A;  3VWW A;  1OE8 A;  5J9C A;  2A2R A;  3GRX A;  1LU4 A;  2HXK A;  4KSO A;  2I4A A;  4K8M A;  3J7Y k;  3GL3 A;  3MIX A;  3LEF A;  3IK9 A;  1PN9 A;  1EEJ A;  2F9S A;  5HQP A;  1ABA A;  1PSQ A;  4E8H A;  4GSS A;  4JZQ A;  2PVQ A;  4HJM A;  2C3T A;  3I9V 2;  1KBN A;  1OKD A;  2WCI A;  3QR6 A;  1X5D A;  4V2N A;  3F4R A;  3F63 A;  1X9M B;  4HOJ A;  3FHK A;  1PD2 1;  4BPY A;  3A5I A;  2PU9 C;  4G0L A;  4YAP A;  1Q98 A;  3PH9 A;  1XPV A;  3L9V A;  3FR9 A;  3DKS A;  2FGX A;  2AYT A;  2WB9 A;  6GSY A;  4RQR A;  4QL7 A;  2E7P A;  3TKR A;  4Z7X A;  1IYI A;  2P5R A;  1TW9 A;  1TK0 B;  1EGO A;  4IGJ A;  2FD3 A;  4PGT A;  1U88 A;  5G5F A;  2IFQ B;  2F51 A;  2MMN A;  1TOF A;  5DCG A;  5CNW A;  2H1A A;  2B1K A;  2QSI A;  3UEM A;  1K3L A;  4FQU A;  2YCD A;  2HSY A;  1GSY A;  3L9U A;  3HVS A;  1M2A A;  2O87 A;  3O76 A;  4OCF A;  4K0N A;  3WT2 A;  3D6I A;  1PKW A;  1TK8 B;  4WR4 A;  3ZRE A;  1Y25 A;  4BVY A;  2H0H A;  4OCE A;  2FCH A;  1A0R P;  2PER A;  4GF0 A;  18GS A;  4PUF C;  4YQU A;  2H30 A;  4ECC A;  2CVB A;  2LNT A;  2DML A;  3IPZ A;  3VUR A;  3NIV A;  2CVD A;  2A4H A;  19GS A;  2VCQ A;  4LL4 B;  3I43 A;  3KH9 A;  3EVI A;  1U87 A;  2D2Z A;  1EWX A;  1FVJ A;  5E4W A;  2YN1 A;  3SWL A;  2P0G A;  2CZ3 A;  4XRA A;  4BL7 B;  4EKZ A;  4XS4 A;  4PTS A;  4F0C A;  3GKM A;  1UA5 A;  1NHY A;  3BCI A;  5DVB A;  1GSE A;  5G30 A;  4EL1 A;  2R0G A;  4WKW A;  2DJK A;  3QFB C;  3CQF A;  3FW2 A;  3KM6 A;  3QPM A;  2MBS A;  2LTK A;  1S3C A;  2YV7 A;  3KIJ A;  1Z6N A;  3PIN A;  3M9J A;  4V2M A;  4ZXG A;  3M1G A;  3FMW A;  5IPG A;  1O8W A;  5ENU A;  2VCV A;  1QGV A;  2H1B A;  3D4M A;  2GQK A;  2I3Y A;  5ELG A;  4YH2 A;  3EC3 A;  2E2G A;  1T4Z A;  3DGQ A;  3RBT A;  5DAK A;  4POL A;  1OYJ A;  1AQX A;  5D9X A;  3L9S A;  5CRG A;  2AAW A;  3BD2 A;  3VI5 A;  2LEG A;  3LW9 A;  3BCK A;  5KN1 A;  3EU4 A;  2X49 A;  3D22 A;  1K0C A;  1FAA A;  1PGT A;  3VK9 A;  2B5E A;  1GH2 A;  4GQF A;  2HYX A;  4ML1 A;  5G1L A;  2VO4 A;  4K7I A;  2CX4 A;  3M8N A;  2HSH A;  1PRX A;  3EPT A;  4HQS A;  4WET A;  1XZO A;  2VLV A;  5ECL B;  4TR1 B;  2KP1 A;  3FK8 A;  3DWV A;  3DXB A;  2H8L A;  3KTB A;  2LQQ A;  2V6K A;  2KOK A;  8GSS A;  5B6M A;  6GSV A;  3EUR A;  3G7I A;  3ERF A;  4MJE A;  1HNB A;  2LUS A;  3C1R A;  3C8E A;  3W6G A;  1BG5 A;  2N5B A;  4BA7 A;  1U6T A;  4KW6 A;  4YKF A;  3RHB A;  1XVQ A;  2YV9 A;  4HZ4 A;  5ECP B;  4OD7 A;  5AN1 A;  1TDI A;  4TXO B;  4L5L A;  1TRW A;  1UVZ A;  2GQM A;  1JLW A;  4X1U A;  2O89 A;  1VF3 A;  3P90 A;  2O8V B;  3QCP A;  3L4N A;  16GS A;  4AJ6 A;  2YWN A;  1ST9 A;  5J5N A;  1AAZ A;  1GP1 A;  4Q5Q A;  4TKY A;  6GST A;  1W4V A;  2B3S A;  14GS A;  3QAW A;  1YKA A;  4YQM A;  3UBK A;  2JZS A;  1VF4 A;  3Q19 A;  4MZB A;  5JCU A;  2X8C A;  4CW9 A;  1V58 A;  1X5C A;  3UMA A;  4QQ7 A;  4KH7 A;  5DQS A;  1G6Y A;  3UVH A;  2GDR A;  3RPN A;  3GIX A;  5GST A;  5IMF A;  4HQZ A;  1XOB A;  3WD6 A;  2FA8 A;  3IAM 2;  3UVT A;  5ECR B;  5HFK A;  1HYU A;  3CTF A;  4IJI A;  4LMV A;  1N8J A;  1V98 A;  4MF5 A;  2XBI A;  1X5E A;  2M80 A;  4HJ2 A;  4K0G A;  3FY7 A;  3IXR A;  1MTC A;  1DSB A;  5IOW A;  4EUY A;  2R2J A;  3ZTL A;  1TXX A;  4IQ1 A;  4XS1 A;  4PUA A;  4V1A g;  2YNX A;  3E0U A;  3A3T A;  1B9Y C;  1TRV A;  2GS3 A;  4N11 A;  1K3Y A;  5EY6 A;  1YJ6 A;  3VPQ A;  4K5R A;  3KTL A;  1XWG A;  1O73 A;  2QKE A;  4EVM A;  3BBY A;  4AJ8 A;  4TOP A;  2PN8 A;  3WGD A;  1A0F A;  1YF0 A;  1TKD B;  1A2M A;  2YJ7 A;  1EP7 A;  1PX6 A;  4O7H A;  5IO0 A;  1OE7 A;  3EMP A;  3R3E A;  5IMA A;  4JU5 A;  1YDK A;  4E8E A;  1SK1 A;  5J9B A;  3TJB A;  1GUL A;  4BVY B;  3GTU A;  2VLT A;  1PFO A;  1XVW A;  2DC5 A;  4EIP A;  2RM6 A;  3HCZ A;  4JED A;  4I97 A;  2H74 A;  4KE3 A;  1SK0 A;  2DJ2 A;  2BTO T;  3TKQ A;  4PXO A;  3SBC A;  3VFI A;  1AIU A;  2PWJ A;  5E59 A;  1GUK A;  3IOS A;  2R3X A;  5J4U A;  2DIY A;  2CA8 A;  1BYE A;  4XS4 B;  3IC4 A;  4HU7 A;  2GTU A;  1B4P A;  4XRD A;  4MDC A;  4G19 A;  3IHG A;  1TTZ A;  2HZE A;  3CTG A;  4PX1 A;  5FHI A;  3U6V A;  2QC7 A;  5FWG A;  2B5Y A;  4KB3 A;  2L5L A;  3TUE A;  4AJ7 A;  4IQA A;  2BMX A;  2H6Z A;  2OBI A;  1T3B A;  4MK3 A;  4OFM A;  3UIW A;  1WIK A;  2BJX A;  1FG4 A;  4IP1 A;  1KEB A;  3LGC A;  5ID2 A;  3G7Y A;  3C1S A;  1QQ2 A;  1E2Y A;  4LA1 A;  1KNG A;  4V2L A;  3D5J A;  3ZLP A;  1XWC A;  1ZGN A;  1O8X A;  2B5X A;  4NV5 A;  2C3Q A;  3GMF A;  5IIZ A;  4EIQ A;  5IMC A;  4J2F A;  4L8E A;  2H01 A;  3OR5 A;  1O81 A;  2DKI A;  4K1F A;  3QAG A;  4WF5 A;  4O5U A;  2PPT A;  2VLU A;  2KP2 A;  1SJI A;  3ERG A;  1J0F A;  17GS A;  2GT6 A;  1EV4 A;  1F3A A;  1ZL9 A;  1B9X C;  1A2L A;  4MJA A;  2AV4 A;  4IEL A;  1M9A A;  2YWI A;  1WWJ A;  1WP0 A;  4OO4 A;  4WBJ A;  2L4Q A;  2P31 A;  2KLX A;  3V1W A;  4N10 A;  4NMU A;  5GAN D;  4F9Z A;  3C73 A;  3DIE A;  1X9W B;  3DVX A;  5ECH B;  4MZC A;  4RQX A;  1S3D A;  2VL9 A;  6GSW A;  1V9W A;  4HI7 A;  2MMZ A;  4ZB9 A;  3IHQ A;  5D9V A;  3GX0 A;  2WFC A;  5D9W A;  4JRR A;  5EL8 A;  4XTS A;  2RM5 A;  2O7K A;  5ECI B;  4QL9 A;  3KEB A;  1ZYE A;  1GNE A;  2M72 A;  1DUG A;  5B8A A;  4PQ1 A;  2XC2 A;  2H0G A;  3ISO A;  5IPH A;  5AIX A;  4ZL7 A;  4DEJ A;  2XHF A;  3TRX A;  2GZZ A;  1I5G A;  1V2A A;  3K8N A;  3RHC A;  1FB6 A;  4FIW A;  2OAD A;  3LJR A;  2VM2 A;  3KH7 A;  3QOU A;  4I5Q A;  1HNC A;  5B6N A;  1S3R A;  3GST A;  4ZBA A;  1LBK A;  2VCW A;  2CV4 A;  4CHS A;  4K7N A;  2PGT A;  4O32 A;  1EV9 A;  1C72 A;  4F0B A;  1PKZ A;  3F6D A;  3BJ5 A;  2DMM A;  3EIN A;  3HYP A;  3GH6 A;  1FOH A;  3H8Q A;  3TCO A;  1GNW A;  1YZX A;  1GUM A;  2VL2 A;  1THX A;  4Q5R A;  3EU3 A;  5JCW A;  3WGX A;  3TKS E;  2H73 A;  20GS A;  5KEJ A;  4X0X A;  4PQH A;  2V2G A;  4XS6 A;  1OC9 A;  2IWT A;  3ZVJ D;  2JAC A;  5BRT A;  2DIZ A;  1HD2 A;  3ERW A;  2R37 A;  1PL1 A;  1ZOF A;  1TK5 B;  4TRX A;  1G0T A;  4KSM A;  3GTU B;  1DBY A;  3F4T A;  3ED3 A;  3FZ5 A;  3FZ4 A;  5CYY A;  1SKW B;  1H4O A;  5C00 A;  1SJZ A;  4AGS A;  5KOX A;  2NDO A;  2JSZ A;  5IMZ A;  3KJY A;  2K18 A;  3KXO A;  3KGK A;  5G5E A;  2JZT A;  2YOI A;  2L6D A;  3TKS C;  2H72 A;  1Q4J A;  1M3I A;  4POM A;  2VCZ A;  2YAN A;  3NZN A;  4RI7 A;  4FYU A;  3IV4 A;  3H93 A;  4KDY A;  2IMI A;  2H6X A;  4Z2R A;  2L59 A;  3QFA C;  3HJM A;  2HZE B;  2Z9S A;  4IW9 A;  5D96 A;  2IMF A;  4ZL8 A;  4ZB8 A;  2OE1 A;  4YAV A;  6GSS A;  2CVK A;  2VUP A;  1PA3 A;  3UL3 A;  1XW6 A;  4KCA A;  2YJH A;  1PL2 A;  2DBC A;  3DYR A;  4WBR D;  1O6J A;  4ZBD A;  4H86 A;  2YPM A;  1VF2 A;  1H75 A;  3J7Y b;  7GSS A;  2PBJ A;  2FWG A;  5ID2 B;  1SYX A;  2N5F A;  5CRE A;  2JZR A;  1U3A A;  3P7X A;  2H19 A;  3PPU A;  1SD9 A;  2K9F A;  1MDK A;  1T8E B;  2HRN A;  4P3Y B;  2C3N A;  2C4J A;  1YF1 A;  2VCX A;  3HA9 A;  3APO A;  1TP9 A;  2XBQ A;  2WDU A;  4HEA 2;  2REM A;  1K0M A;  3IK7 A;  3TJG A;  2L6C A;  1UN2 A;  5DBQ A;  4ZL9 A;  2GSQ A;  3VWV A;  2L4C A;  4Q5N A;  2HI7 A;  2NPB A;  1SL0 B;  1QFN A;  3MSZ A;  1WJK A;  1BJX A;  1ZZY A;  2M46 A;  5J3R A;  2H6Y A;  1A2J A;  3GL5 A;  3EE2 A;  4KAE A;  3ZZX A;  11GS A;  2LQO A;  4GRF A;  2VD1 A;  2H1G A;  4OWY A;  2YP6 A;  3TRQ A;  2DJ0 A;  5IO2 A;  1XIY A;  2LNS A;  4ID0 A;  4ISD A;  5L71 A;  1Y6E A;  5HR3 A;  2HRA A;  5D93 A;  5H5R A;  1WMJ A;  4K5S A;  1YQ1 A;  4OFN A;  1N2A A;  3F9U A;  1Z7R A;  5GSS A;  1TI3 A;  3GNJ A;  3TJF A;  4NPB A;  1JZO A;  2LKU A;  3QAV A;  1GTA A;  1MD4 A;  2CQ9 A;  2R6K A;  3Q6O A;  5J41 A;  2QA1 A;  1JFU A;  1K3O A;  2IL3 A;  3E3E A;  4NHZ A;  1BX9 A;  1A8L A;  2MMA A;  3TJK A;  4N30 A;  1PMT A;  3HVV A;  1VGL A;  1BED A;  1OC8 A;  3DD3 A;  4ZIJ A;  1ZMA A;  1M99 A;  2VIM A;  5EPF A;  1ERV A;  1SJ6 A;  2X8G A;  4F2I A;  5HR0 A;  1XW5 A;  1GRX A;  1PN0 A;  1W89 A;  2IME A;  4JBB A;  4POB A;  1NSW A;  4D73 A;  4RI6 A;  2HRF A;  2LST A;  4I2U A;  1G7O A;  4I2T A;  1YY7 A;  3KZQ A;  2YZH A;  1EP8 A;  2CAI A;  4ECJ A;  3IC8 A;  4IP6 A;  2X99 A;  4IS0 A;  4N0V A;  1VF1 A;  1F9M A;  1T00 A;  5ECO B;  2GLR A;  3IRA A;  1RQM A;  1ZYP A;  4PUR A;  4XCS A;  3JCM L;  3GKN A;  4TR4 A;  2X64 A;  2EIR A;  2LRC A;  3TGZ A;  1QUW A;  1YEX A;  3QMX A;  4J57 E;  4EO3 A;  1T1V A;  4MPG A;  3LFL A;  3MDK A;  3IAS 2;  4FO5 A;  22GS A;  4YKG A;  2E0Q A;  4K2X A;  1OC9 B;  3CRU A;  5FT3 A;  1OVN A;  3RPP A;  1SD8 A;  1Z5Y E;  1V40 A;  3VWX A;  4GST A;  2AB6 A;  2X4A A;  4O5R A;  3EYT A;  1FHE A;  2IN3 A;  1QMV A;  3EMX A;  1T7P B;  2V6O A;  2EIO A;  2B1L A;  3HD5 A;  2F8A A;  4HUA A;  1MEK A;  2VCT A;  3FZA A;  1PQN A;  2C80 A;  1TJD A;  2RII A;  4GXZ A;  2OKA A;  5DJM A;  3GV1 A;  1YEP A;  3CSI A;  2WS2 A;  2FHE A;  4FYC A;  5F0G A;  3TOU A;  4NXI A;  4DSR A;  5GAP D;  4OFT A;  1MDI A;  2CZ2 A;  1B4Q A;  4GSN A;  5DAL A;  4I6X A;  3ZMK A;  3UAP A;  3ME7 A;  3DML A;  1ZYN A;  4K9Z A;  2H0I A;  1K0O A;  3D4T A;  5ECQ B;  4K6X A;  2IMK A;  1TU8 A;  4KCE A;  4KX4 A;  3F3R A;  4IHU A;  3IR4 A;  2JL4 A;  5JCG A;  2R0C A;  3F4S A;  2OJL A;  3LQ7 A;  2F8F A;  2C1Y A;  4HDE A;  4GCI A;  2DSA A;  2H76 A;  3MAK A;  1GLQ A;  1J08 A;  2FNO A;  2A4V A;  3LXZ A;  1QK8 A;  5DAK B;  3I69 A;  1UC7 A;  2LS5 A;  4CY6 A;  1Z3E A;  1ERU A;  2CAQ A;  1NHO A;  1PX7 A;  3GX8 A;  3GN3 A;  1SEN A;  3APQ A;  3W8S A;  2H1D A;  3F0I A;  3VLN A;  3VWU A;  2HE3 A;  3GFK A;  2XPD A;  3RDW A;  4ZIL A;  5CO3 A;  5KN2 A;  2VOC A;  2A2S A;  5ECM B;  2FA4 A;  1EEM A;  2L57 A;  2WJU A;  2HNL A;  2NVL A;  1R4W A;  4KF9 A;  3HKR A;  5HFI A;  2VM1 A;  4TR0 A;  3A2W A;  4NAX A;  4DSQ A;  2H70 A;  3CSH A;  3P2A A;  3WGE A;  2AHE A;  2RLI A;  1K0B A;  2TRC P;  2E2M A;  1B8X A;  4MAB A;  2GSS A;  3FRC A;  1ERT A;  1T4Y A;  4V1A p;  3UOM A;  2VAF A;  1A23 A;  1B48 A;  3CYN A;  1R5P A;  1K0D A;  2NTO A;  1R26 A;  1FOV A;  4F03 A;  1ML6 A;  3ZL5 A;  1M2B A;  3ZIJ A;  5CRD A;  4FYB A;  3L78 A;  3LXT A;  2RUF A;  2G2Q A;  2OE3 A;  2QGV A;  2CX3 A;  4YQV A;  1JZR A;  2LJA A;  1TU7 A;  3P8W A;  6GSX A;  3H79 A;  1ERW A;  1NW2 A;  5F06 A;  1RW1 A;  5F8B A;  2GQL A;  1CQG A;  2VL3 A;  2DLX A;  2FLS A;  3GUR A;  1SL1 B;  2EC4 A;  4HSC X;  1LJR A;  2PVO C;  3DVW A;  3UJ1 A;  3FZ9 A;  1EOG A;  3MYD A;  3CSJ A;  2MMO A;  9GSS A;  1XWA A;  2WZ9 A;  1DE2 A;  3LG6 A;  5H5S A;  3F8U A;  1M9B A;  2FUG 2;  1AC1 A;  4MF6 A;  4PQI A;  2V32 A;  3C7M A;  4L5O A;  3UBL A;  1XWK A;  3TB2 A;  1WOU A;  1AQW A;  3HJP A;  4MPF A;  4MP4 A;  3GUS A;  5H5Q A;  4BWS A;  5INY A;  4ICY A;  5KN0 A;  3LWA A;  5ECN B;  2P5Q A;  3F6F A;  3TRP A;  4G0I A;  1R5A A;  3KMN A;  1E6B A;  3LOR A;  3ZYW A;  1WRY A;  3FEU A;  5C04 A;  5KOW A;  5LCZ A;  4GWR A;  1JHB A;  1A24 A;  2F3M A;  2RUE A;  2I81 A;  2OE0 A;  2H75 A;  3Q74 A;  3GA4 A;  1SU9 A;  5DQY A;  4D73 B;  5GZZ B;  1MD3 A;  1CQH A;  4F82 A;  1SKR B;  4BIK A;  3GH9 A;  5CP1 A;  3RAZ A;  2ALB A;  3L0H A;  1RK4 A;  2FWE A;  4MCU A;  3TDG A;  4AF2 A;  1SK2 A;  2GSR A;  4USS A;  4XHM A;  1XW9 A;  4MH2 A;  1TRS A;  4ACS A;  5ECK B;  3N5O A;  2JU5 A;  3LYP A;  4O92 A;  3HXS A;  3U5R E;  2JSY A;  1GUH A;  4DSS A;  3W8J A;  3R2Q A;  1JLV A;  2KHP A;  3LYK A;  2AUV A;  2IJY A;  1IYH A;  3TJJ A;  4HU9 A;  3NOF A;  1EGR A;  4JR6 A;  1AQV A;  4IBP A;  4IJ3 A;  1X0R A;  2WGR A;  5D8I A;  4G0K A;  3KP8 A;  2R5G A;  1WPI A;  1JZW A;  2IMD A;  1NM3 A;  4TW5 A;  3DEX A;  1U3I A;  5BMU A;  3IA1 A;  6GSU A;  3G9B A;  3D0Z A;  2ZNM A;  2OAC A;  5CRW A;  4OMV A;  4BVX A;  2R0P A;  3BOA A;  2GST A;  4TR3 A;  4WF4 A;  3VPT A;  1FVK A;  5EVO A;  2ON5 A;  3CMI A;  2K8S A;  1THO A;  5DAL B;  4KGI A;  4MF7 A;  1ZCP A;  3HZ8 A;  2G0F A;  2LV3 A;  3LSZ A;  1G6W A;  2HRK A;  4LLR A;  1SKS B;  5F05 A;  1AW9 A;  5DCH A;  2UZ8 A;  2ON7 A;  3IBH A;  3FR6 A;  4RUV A;  2FWH A;  5IOX A;  1OC3 A;  1F37 A;  4MLY A;  3O3T A;  4KND A;  2MYG A;  2GZP A;  2GZY A;  1MDJ A;  2CT6 A;  4PNF A;  4FH8 A;  1J9B A;  3TOT A;  4MNN A;  1TI1 A;  4EDZ A;  3US3 A;  1YKC A;  2DKH A;  4MMM A;  1ON4 A;  4JE1 A;  3E9J B;  2B7J A;  1ILO A;  5CRH A;  2HLS A;  5AIS A;  1AXD A;  1F6M C;  1F2E A;  2I1U A;  5IQY A;  3QDN A;  3GKK A;  3FYG A;  4G2E A;  3EWL A;  4K7O A;  5HR2 A;  4Z2T A;  1OKT A;  1DE1 A;  2V41 A;  3H1N A;  3WYW A;  3CXG A;  2X8H A;  3ZML A;  1M7T A;  5JWO B;  5IM9 A;  4MJB A;  4WR5 A;  2MZC A;  3HVN A;  2HT9 A;  2J23 A;  3S9F A;  4MJC A;  4JR4 A;  3N9J A;  4KDU A;  2H71 A;  4MH3 A;  4EXJ A;  4KDX A;  4X4J A;  1A8Y A;  5A4V A;  13GS A;  1XBS A;  1I9D A;  4I8B A; 
#chains in the Genus database with same CATH homology
 4ZBB A;  1GSU A;  2FWF A;  2HSM A;  3KP9 A;  2GVP A;  2IIY A;  3A5W A;  1ACV A;  5B7C A;  4XIH A;  3HJO A;  2DJJ A;  2DJ1 A;  3HDC A;  5AGY A;  4PNG A;  4ECB A;  3ZIV A;  4EDY A;  4N0Z A;  3M0F A;  3M3M A;  4HS1 A;  4GLT A;  4HZ2 A;  4NWY A;  2HFD A;  1TRU A;  4TN8 A;  5ELA A;  2ZCT A;  4KA0 A;  4Z2U A;  5G31 A;  5D9T A;  4J56 E;  1Z6M A;  2IFQ A;  2OBK A;  1FW1 A;  3FKF A;  3DRN A;  4ULX A;  3F3Q A;  3Q18 A;  1XOA A;  2GT5 A;  3ZVJ A;  4ZB6 A;  3ZFB A;  3ZRD A;  1R7H A;  5DJL A;  2C0E A;  2HZF A;  4NV2 A;  2VL2 C;  2EIQ A;  5A4W A;  5A5K A;  4ECI A;  1Z7P A;  2C0G A;  3A2X A;  2AJQ B;  3G7J A;  1OAZ A;  3A2V A;  1USB A;  2WUL A;  3VI7 A;  2I9H A;  4EF0 A;  1WE0 A;  3IE3 A;  2LRN A;  2MBT A;  1K0A A;  2K8V A;  1VRS D;  2C0D A;  4MZW A;  3CBU A;  2PUK C;  3ME8 A;  3CRT A;  4TVE A;  3GKX A;  5COH A;  2WRT A;  2LRT A;  4MA9 A;  2NBS A;  3IDV A;  3FR3 A;  5DDL A;  3ZIT A;  4IN0 A;  1BAY A;  3GYK A;  2ZUP A;  4BL7 A;  4WXT A;  4O5Q A;  2DJ3 A;  4EC0 A;  1URM A;  5F07 A;  3MNG A;  1GTB A;  4L0W A;  4GQC A;  3GSS A;  2GGT A;  1GSF A;  1XWB A;  2QA2 A;  4LL1 B;  2K6V A;  4DSS B;  1GTI A;  5KN3 A;  2XPE A;  2O85 A;  5LD0 A;  2IPA A;  1ZYQ B;  3KCM A;  1XFL A;  4NHW A;  4TXV A;  5IMV A;  1M2D A;  5CAX A;  4GTU A;  3WT1 A;  2H66 A;  4K2D A;  5B8B A;  1SYR A;  1G7E A;  4ILF A;  4G10 A;  1GWC A;  1GLP A;  5JWR B;  2LJR A;  4BWQ A;  3HZ4 A;  1GTU A;  2YZU A;  3D21 A;  4CDO A;  5HFG A;  3HVX A;  4Q5F A;  12GS A;  1FO5 A;  2VD0 A;  5AIV A;  2TRX A;  1O85 A;  3TKS A;  2KUC A;  4POK A;  3ZFL A;  4BVX B;  2L5O A;  1K0N A;  1QXH A;  4IKH A;  1S3A A;  3O6T A;  2ES7 A;  2C8U A;  5HR1 A;  2N5A A;  10GS A;  1XCC A;  3APS A;  2FY6 A;  2C0F A;  1GSS A;  4A5P A;  1GL8 A;  3I6A A;  3HHV A;  1GSD A;  2LJK A;  3H4K A;  3PR8 A;  5ABR A;  3M9K A;  5ECS A;  1X9S B;  1BQ7 A;  1V57 A;  3PGT A;  4TR1 A;  1JZD A;  1O7U A;  4DVC A;  3KMO A;  4G9H A;  4X43 A;  5LNK e;  5G1K A;  2B6M A;  1XXU A;  4L0U A;  3TKP A;  3MWH A;  4IVF A;  2OA7 A;  3QD9 A;  3HY2 A;  3C71 A;  4EE0 A;  2PMT A;  1F3B A;  2A2P A;  1M0U A;  1KTE A;  4WEY A;  2B7K A;  1EZK A;  2YWM A;  1Z9H A;  4OO5 A;  5G2Z A;  4TXO A;  3KD0 A;  1AUC A;  3GHA A;  5IMD A;  2TIR A;  5JWQ B;  3UAR A;  5D73 A;  2YWO A;  4ML6 A;  5A4U A;  4CY8 A;  1HNA A;  1GSQ A;  2R4V A;  2J9H A;  3AY8 A;  1HQO A;  2JAD A;  4KUN A;  4LMW A;  1SL2 B;  2V1M A;  1FB0 A;  1EOH A;  3VWW A;  1OE8 A;  5J9C A;  2A2R A;  3GRX A;  1LU4 A;  2HXK A;  4KSO A;  2I4A A;  4K8M A;  3J7Y k;  3GL3 A;  3MIX A;  3LEF A;  3IK9 A;  1PN9 A;  1EEJ A;  2F9S A;  5HQP A;  1ABA A;  1PSQ A;  4E8H A;  4GSS A;  4JZQ A;  2PVQ A;  4HJM A;  2C3T A;  3I9V 2;  1KBN A;  1OKD A;  2WCI A;  3QR6 A;  1X5D A;  4V2N A;  3F4R A;  3F63 A;  1X9M B;  4HOJ A;  3FHK A;  1PD2 1;  4BPY A;  3A5I A;  2PU9 C;  4G0L A;  4YAP A;  1Q98 A;  3PH9 A;  1XPV A;  3L9V A;  3FR9 A;  3DKS A;  2FGX A;  2AYT A;  2WB9 A;  6GSY A;  4RQR A;  4QL7 A;  2E7P A;  3TKR A;  4Z7X A;  1IYI A;  2P5R A;  1TW9 A;  1TK0 B;  1EGO A;  4IGJ A;  2FD3 A;  4PGT A;  1U88 A;  5G5F A;  2IFQ B;  2F51 A;  2MMN A;  1TOF A;  5DCG A;  5CNW A;  2H1A A;  2B1K A;  2QSI A;  3UEM A;  1K3L A;  4FQU A;  2YCD A;  2HSY A;  1GSY A;  3L9U A;  3HVS A;  1M2A A;  2O87 A;  3O76 A;  4OCF A;  4K0N A;  3WT2 A;  3D6I A;  1PKW A;  1TK8 B;  4WR4 A;  3ZRE A;  1Y25 A;  4BVY A;  2H0H A;  4OCE A;  2FCH A;  1A0R P;  2PER A;  4GF0 A;  18GS A;  4PUF C;  4YQU A;  2H30 A;  4ECC A;  2CVB A;  2LNT A;  2DML A;  3IPZ A;  3VUR A;  3NIV A;  2CVD A;  2A4H A;  19GS A;  2VCQ A;  4LL4 B;  3I43 A;  3KH9 A;  3EVI A;  1U87 A;  2D2Z A;  1EWX A;  1FVJ A;  5E4W A;  2YN1 A;  3SWL A;  2P0G A;  2CZ3 A;  4XRA A;  4BL7 B;  4EKZ A;  4XS4 A;  4PTS A;  4F0C A;  3GKM A;  1UA5 A;  1NHY A;  3BCI A;  5DVB A;  1GSE A;  5G30 A;  4EL1 A;  2R0G A;  4WKW A;  2DJK A;  3QFB C;  3FW2 A;  3KM6 A;  3QPM A;  2MBS A;  2LTK A;  1S3C A;  2YV7 A;  3KIJ A;  1Z6N A;  3PIN A;  3M9J A;  4V2M A;  4ZXG A;  3M1G A;  3FMW A;  5IPG A;  1O8W A;  5ENU A;  2VCV A;  1QGV A;  2H1B A;  3D4M A;  2GQK A;  2I3Y A;  5ELG A;  4YH2 A;  3EC3 A;  2E2G A;  1T4Z A;  3DGQ A;  3RBT A;  5DAK A;  4POL A;  1OYJ A;  1AQX A;  5D9X A;  3L9S A;  5CRG A;  2AAW A;  3BD2 A;  3VI5 A;  2LEG A;  3LW9 A;  3BCK A;  5KN1 A;  3EU4 A;  2X49 A;  3D22 A;  1K0C A;  1FAA A;  1PGT A;  3VK9 A;  2B5E A;  1GH2 A;  4GQF A;  2HYX A;  4ML1 A;  5G1L A;  2VO4 A;  4K7I A;  2CX4 A;  3M8N A;  2HSH A;  1PRX A;  3EPT A;  4HQS A;  4WET A;  1XZO A;  2VLV A;  5ECL B;  4TR1 B;  2KP1 A;  3FK8 A;  3DWV A;  3DXB A;  2H8L A;  3KTB A;  2LQQ A;  2V6K A;  2KOK A;  8GSS A;  5B6M A;  6GSV A;  3EUR A;  3G7I A;  3ERF A;  4MJE A;  1HNB A;  2LUS A;  3C1R A;  3C8E A;  3W6G A;  1BG5 A;  2N5B A;  4BA7 A;  1U6T A;  4KW6 A;  4YKF A;  3RHB A;  1XVQ A;  2YV9 A;  4HZ4 A;  5ECP B;  4OD7 A;  5AN1 A;  1TDI A;  4TXO B;  4L5L A;  1TRW A;  1UVZ A;  2GQM A;  1JLW A;  4X1U A;  2O89 A;  1VF3 A;  3P90 A;  2O8V B;  3QCP A;  3L4N A;  16GS A;  4AJ6 A;  2YWN A;  1ST9 A;  5J5N A;  1AAZ A;  1GP1 A;  4Q5Q A;  4TKY A;  6GST A;  1W4V A;  2B3S A;  14GS A;  3QAW A;  1YKA A;  4YQM A;  3UBK A;  2JZS A;  1VF4 A;  3Q19 A;  4MZB A;  5JCU A;  2X8C A;  4CW9 A;  1V58 A;  1X5C A;  3UMA A;  4QQ7 A;  4KH7 A;  5DQS A;  1G6Y A;  3UVH A;  2GDR A;  3RPN A;  3GIX A;  5GST A;  5IMF A;  4HQZ A;  1XOB A;  3WD6 A;  2FA8 A;  3IAM 2;  3UVT A;  5ECR B;  5HFK A;  1HYU A;  3CTF A;  4IJI A;  4LMV A;  1N8J A;  1V98 A;  4MF5 A;  2XBI A;  1X5E A;  2M80 A;  4HJ2 A;  4K0G A;  3FY7 A;  3IXR A;  1MTC A;  1DSB A;  5IOW A;  4EUY A;  2R2J A;  3ZTL A;  1TXX A;  4IQ1 A;  4XS1 A;  4PUA A;  4V1A g;  2YNX A;  3E0U A;  3A3T A;  1B9Y C;  1TRV A;  2GS3 A;  4N11 A;  1K3Y A;  5EY6 A;  1YJ6 A;  3VPQ A;  4K5R A;  3KTL A;  1XWG A;  1O73 A;  2QKE A;  4EVM A;  3BBY A;  4AJ8 A;  4TOP A;  2PN8 A;  3WGD A;  1A0F A;  1YF0 A;  1TKD B;  1A2M A;  2YJ7 A;  1EP7 A;  1PX6 A;  4O7H A;  5IO0 A;  1OE7 A;  3EMP A;  3R3E A;  5IMA A;  4JU5 A;  1YDK A;  4E8E A;  1SK1 A;  5J9B A;  3TJB A;  1GUL A;  4BVY B;  3GTU A;  2VLT A;  1XVW A;  2DC5 A;  4EIP A;  2RM6 A;  3HCZ A;  4JED A;  4I97 A;  2H74 A;  4KE3 A;  1SK0 A;  2DJ2 A;  2BTO T;  3TKQ A;  4PXO A;  3SBC A;  3VFI A;  1AIU A;  2PWJ A;  5E59 A;  1GUK A;  3IOS A;  2R3X A;  5J4U A;  2DIY A;  2CA8 A;  1BYE A;  4XS4 B;  3IC4 A;  4HU7 A;  2GTU A;  1B4P A;  4XRD A;  4MDC A;  4G19 A;  3IHG A;  1TTZ A;  2HZE A;  3CTG A;  4PX1 A;  5FHI A;  3U6V A;  2QC7 A;  5FWG A;  2B5Y A;  4KB3 A;  2L5L A;  3TUE A;  4AJ7 A;  4IQA A;  2BMX A;  2H6Z A;  2OBI A;  1T3B A;  4MK3 A;  4OFM A;  3UIW A;  1WIK A;  2BJX A;  1FG4 A;  4IP1 A;  1KEB A;  3LGC A;  5ID2 A;  3G7Y A;  3C1S A;  1QQ2 A;  1E2Y A;  4LA1 A;  1KNG A;  4V2L A;  3D5J A;  3ZLP A;  1XWC A;  1ZGN A;  1O8X A;  2B5X A;  4NV5 A;  2C3Q A;  3GMF A;  5IIZ A;  4EIQ A;  5IMC A;  4J2F A;  4L8E A;  2H01 A;  3OR5 A;  1O81 A;  2DKI A;  4K1F A;  3QAG A;  4WF5 A;  4O5U A;  2PPT A;  2VLU A;  2KP2 A;  1SJI A;  3ERG A;  1J0F A;  17GS A;  2GT6 A;  1EV4 A;  1F3A A;  1ZL9 A;  1B9X C;  1A2L A;  4MJA A;  2AV4 A;  4IEL A;  1M9A A;  2YWI A;  1WWJ A;  1WP0 A;  4OO4 A;  4WBJ A;  2L4Q A;  2P31 A;  2KLX A;  3V1W A;  4N10 A;  4NMU A;  5GAN D;  4F9Z A;  3C73 A;  3DIE A;  1X9W B;  3DVX A;  5ECH B;  4MZC A;  4RQX A;  1S3D A;  2VL9 A;  6GSW A;  1V9W A;  4HI7 A;  2MMZ A;  4ZB9 A;  3IHQ A;  5D9V A;  3GX0 A;  2WFC A;  5D9W A;  4JRR A;  5EL8 A;  4XTS A;  2RM5 A;  2O7K A;  5ECI B;  4QL9 A;  3KEB A;  1ZYE A;  1GNE A;  2M72 A;  1DUG A;  5B8A A;  4PQ1 A;  2XC2 A;  2H0G A;  3ISO A;  5IPH A;  5AIX A;  4ZL7 A;  4DEJ A;  2XHF A;  3TRX A;  2GZZ A;  1I5G A;  1V2A A;  3K8N A;  3RHC A;  1FB6 A;  4FIW A;  2OAD A;  3LJR A;  2VM2 A;  3KH7 A;  3QOU A;  4I5Q A;  1HNC A;  5B6N A;  3GST A;  4ZBA A;  1LBK A;  2VCW A;  2CV4 A;  4CHS A;  4K7N A;  2PGT A;  4O32 A;  1EV9 A;  1C72 A;  4F0B A;  1PKZ A;  3F6D A;  3BJ5 A;  2DMM A;  3EIN A;  3HYP A;  3GH6 A;  1FOH A;  3H8Q A;  3TCO A;  1GNW A;  1YZX A;  1GUM A;  2VL2 A;  1THX A;  4Q5R A;  3EU3 A;  5JCW A;  3WGX A;  3TKS E;  2H73 A;  20GS A;  5KEJ A;  4X0X A;  4PQH A;  2V2G A;  4XS6 A;  1OC9 A;  2IWT A;  3ZVJ D;  2JAC A;  5BRT A;  2DIZ A;  1HD2 A;  3ERW A;  2R37 A;  1PL1 A;  1ZOF A;  1TK5 B;  4TRX A;  1G0T A;  4KSM A;  3GTU B;  1DBY A;  3F4T A;  3ED3 A;  3FZ5 A;  3FZ4 A;  5CYY A;  1SKW B;  1H4O A;  5C00 A;  1SJZ A;  4AGS A;  5KOX A;  2NDO A;  2JSZ A;  5IMZ A;  3KJY A;  2K18 A;  3KXO A;  3KGK A;  5G5E A;  2JZT A;  2YOI A;  2L6D A;  3TKS C;  2H72 A;  1Q4J A;  4POM A;  2VCZ A;  2YAN A;  3NZN A;  4RI7 A;  4FYU A;  3IV4 A;  3H93 A;  4KDY A;  2IMI A;  2H6X A;  4Z2R A;  2L59 A;  3QFA C;  3HJM A;  2HZE B;  2Z9S A;  4IW9 A;  5D96 A;  2IMF A;  4ZL8 A;  4ZB8 A;  2OE1 A;  4YAV A;  6GSS A;  2CVK A;  2VUP A;  1PA3 A;  3UL3 A;  1XW6 A;  4KCA A;  2YJH A;  1PL2 A;  2DBC A;  3DYR A;  4WBR D;  1O6J A;  4ZBD A;  4H86 A;  2YPM A;  1VF2 A;  1H75 A;  3J7Y b;  7GSS A;  2PBJ A;  2FWG A;  5ID2 B;  1SYX A;  2N5F A;  5CRE A;  2JZR A;  1U3A A;  3P7X A;  2H19 A;  3PPU A;  1SD9 A;  2K9F A;  1MDK A;  1T8E B;  2HRN A;  4P3Y B;  2C3N A;  2C4J A;  1YF1 A;  2VCX A;  3HA9 A;  3APO A;  1TP9 A;  2XBQ A;  2WDU A;  4HEA 2;  2REM A;  1K0M A;  3IK7 A;  3TJG A;  2L6C A;  1UN2 A;  5DBQ A;  4ZL9 A;  2GSQ A;  3VWV A;  2L4C A;  4Q5N A;  2HI7 A;  2NPB A;  1SL0 B;  1QFN A;  3MSZ A;  1WJK A;  1BJX A;  1ZZY A;  2M46 A;  5J3R A;  2H6Y A;  1A2J A;  3GL5 A;  3EE2 A;  4KAE A;  3ZZX A;  11GS A;  2LQO A;  4GRF A;  2VD1 A;  2H1G A;  4OWY A;  2YP6 A;  3TRQ A;  2DJ0 A;  5IO2 A;  1XIY A;  2LNS A;  4ID0 A;  4ISD A;  5L71 A;  1Y6E A;  5HR3 A;  2HRA A;  5D93 A;  5H5R A;  1WMJ A;  4K5S A;  1YQ1 A;  4OFN A;  1N2A A;  3F9U A;  1Z7R A;  5GSS A;  1TI3 A;  3GNJ A;  3TJF A;  4NPB A;  1JZO A;  2LKU A;  3QAV A;  1GTA A;  1MD4 A;  2CQ9 A;  2R6K A;  3Q6O A;  5J41 A;  2QA1 A;  1JFU A;  1K3O A;  2IL3 A;  3E3E A;  4NHZ A;  1BX9 A;  1A8L A;  2MMA A;  3TJK A;  4N30 A;  1PMT A;  3HVV A;  1VGL A;  1BED A;  1OC8 A;  3DD3 A;  4ZIJ A;  1ZMA A;  1M99 A;  2VIM A;  5EPF A;  1ERV A;  1SJ6 A;  2X8G A;  4F2I A;  5HR0 A;  1XW5 A;  1GRX A;  1PN0 A;  1W89 A;  2IME A;  4JBB A;  4POB A;  1NSW A;  4D73 A;  4RI6 A;  2HRF A;  2LST A;  4I2U A;  1G7O A;  4I2T A;  1YY7 A;  3KZQ A;  2YZH A;  1EP8 A;  2CAI A;  4ECJ A;  3IC8 A;  4IP6 A;  2X99 A;  4IS0 A;  4N0V A;  1VF1 A;  1F9M A;  1T00 A;  5ECO B;  2GLR A;  3IRA A;  1RQM A;  1ZYP A;  4PUR A;  4XCS A;  3JCM L;  3GKN A;  4TR4 A;  2X64 A;  2EIR A;  2LRC A;  3TGZ A;  1QUW A;  1YEX A;  3QMX A;  4J57 E;  4EO3 A;  1T1V A;  4MPG A;  3LFL A;  3MDK A;  3IAS 2;  4FO5 A;  22GS A;  4YKG A;  2E0Q A;  4K2X A;  1OC9 B;  3CRU A;  5FT3 A;  1OVN A;  3RPP A;  1SD8 A;  1Z5Y E;  1V40 A;  3VWX A;  4GST A;  2AB6 A;  2X4A A;  4O5R A;  3EYT A;  1FHE A;  2IN3 A;  1QMV A;  3EMX A;  1T7P B;  2V6O A;  2EIO A;  2B1L A;  3HD5 A;  2F8A A;  4HUA A;  1MEK A;  2VCT A;  3FZA A;  1PQN A;  2C80 A;  1TJD A;  2RII A;  4GXZ A;  2OKA A;  5DJM A;  3GV1 A;  1YEP A;  3CSI A;  2WS2 A;  2FHE A;  4FYC A;  5F0G A;  3TOU A;  4NXI A;  4DSR A;  5GAP D;  4OFT A;  1MDI A;  2CZ2 A;  1B4Q A;  4GSN A;  5DAL A;  4I6X A;  3ZMK A;  3UAP A;  3ME7 A;  3DML A;  1ZYN A;  4K9Z A;  2H0I A;  1K0O A;  3D4T A;  5ECQ B;  4K6X A;  2IMK A;  1TU8 A;  4KCE A;  4KX4 A;  3F3R A;  4IHU A;  3IR4 A;  2JL4 A;  5JCG A;  2R0C A;  3F4S A;  2OJL A;  3LQ7 A;  2F8F A;  2C1Y A;  4HDE A;  4GCI A;  2DSA A;  2H76 A;  3MAK A;  1GLQ A;  1J08 A;  2FNO A;  2A4V A;  3LXZ A;  1QK8 A;  5DAK B;  3I69 A;  1UC7 A;  2LS5 A;  4CY6 A;  1Z3E A;  1ERU A;  2CAQ A;  1NHO A;  1PX7 A;  3GX8 A;  3GN3 A;  1SEN A;  3APQ A;  3W8S A;  2H1D A;  3F0I A;  3VLN A;  3VWU A;  2HE3 A;  3GFK A;  2XPD A;  3RDW A;  4ZIL A;  5CO3 A;  5KN2 A;  2VOC A;  2A2S A;  5ECM B;  2FA4 A;  1EEM A;  2L57 A;  2WJU A;  2HNL A;  2NVL A;  1R4W A;  4KF9 A;  3HKR A;  5HFI A;  2VM1 A;  4TR0 A;  3A2W A;  4NAX A;  4DSQ A;  2H70 A;  3CSH A;  3P2A A;  3WGE A;  2AHE A;  2RLI A;  1K0B A;  2TRC P;  2E2M A;  1B8X A;  4MAB A;  2GSS A;  3FRC A;  1ERT A;  1T4Y A;  4V1A p;  3UOM A;  2VAF A;  1A23 A;  1B48 A;  3CYN A;  1R5P A;  1K0D A;  2NTO A;  1R26 A;  1FOV A;  4F03 A;  1ML6 A;  3ZL5 A;  1M2B A;  3ZIJ A;  5CRD A;  4FYB A;  3L78 A;  3LXT A;  2RUF A;  2G2Q A;  2OE3 A;  2QGV A;  2CX3 A;  4YQV A;  1JZR A;  2LJA A;  1TU7 A;  3P8W A;  6GSX A;  3H79 A;  1ERW A;  1NW2 A;  5F06 A;  1RW1 A;  5F8B A;  2GQL A;  1CQG A;  2VL3 A;  2DLX A;  2FLS A;  3GUR A;  1SL1 B;  2EC4 A;  1LJR A;  2PVO C;  3DVW A;  3UJ1 A;  3FZ9 A;  1EOG A;  3MYD A;  3CSJ A;  2MMO A;  9GSS A;  1XWA A;  2WZ9 A;  1DE2 A;  3LG6 A;  5H5S A;  3F8U A;  1M9B A;  2FUG 2;  1AC1 A;  4MF6 A;  4PQI A;  2V32 A;  3C7M A;  4L5O A;  3UBL A;  1XWK A;  3TB2 A;  1WOU A;  1AQW A;  3HJP A;  4MPF A;  4MP4 A;  3GUS A;  5H5Q A;  4BWS A;  5INY A;  4ICY A;  5KN0 A;  3LWA A;  5ECN B;  2P5Q A;  3F6F A;  3TRP A;  4G0I A;  1R5A A;  3KMN A;  1E6B A;  3LOR A;  3ZYW A;  1WRY A;  3FEU A;  5C04 A;  5KOW A;  5LCZ A;  4GWR A;  1JHB A;  1A24 A;  2F3M A;  2RUE A;  2I81 A;  2OE0 A;  2H75 A;  3Q74 A;  3GA4 A;  1SU9 A;  5DQY A;  4D73 B;  5GZZ B;  1MD3 A;  1CQH A;  4F82 A;  1SKR B;  3GH9 A;  5CP1 A;  3RAZ A;  2ALB A;  3L0H A;  1RK4 A;  2FWE A;  4MCU A;  3TDG A;  4AF2 A;  1SK2 A;  2GSR A;  4USS A;  4XHM A;  1XW9 A;  4MH2 A;  1TRS A;  4ACS A;  5ECK B;  3N5O A;  2JU5 A;  3LYP A;  4O92 A;  3HXS A;  3U5R E;  2JSY A;  1GUH A;  4DSS A;  3W8J A;  3R2Q A;  1JLV A;  2KHP A;  3LYK A;  2AUV A;  2IJY A;  1IYH A;  3TJJ A;  4HU9 A;  3NOF A;  1EGR A;  4JR6 A;  1AQV A;  4IBP A;  4IJ3 A;  1X0R A;  2WGR A;  5D8I A;  4G0K A;  3KP8 A;  2R5G A;  1WPI A;  1JZW A;  2IMD A;  1NM3 A;  4TW5 A;  3DEX A;  1U3I A;  5BMU A;  3IA1 A;  6GSU A;  3G9B A;  3D0Z A;  2ZNM A;  2OAC A;  5CRW A;  4OMV A;  4BVX A;  2R0P A;  3BOA A;  2GST A;  4TR3 A;  4WF4 A;  3VPT A;  1FVK A;  5EVO A;  2ON5 A;  3CMI A;  2K8S A;  1THO A;  5DAL B;  4KGI A;  4MF7 A;  1ZCP A;  3HZ8 A;  2G0F A;  2LV3 A;  3LSZ A;  1G6W A;  2HRK A;  4LLR A;  1SKS B;  5F05 A;  1AW9 A;  5DCH A;  2UZ8 A;  2ON7 A;  3IBH A;  3FR6 A;  4RUV A;  2FWH A;  5IOX A;  1OC3 A;  1F37 A;  4MLY A;  3O3T A;  4KND A;  2MYG A;  2GZP A;  2GZY A;  1MDJ A;  2CT6 A;  4PNF A;  4FH8 A;  1J9B A;  3TOT A;  4MNN A;  1TI1 A;  4EDZ A;  3US3 A;  1YKC A;  2DKH A;  4MMM A;  1ON4 A;  4JE1 A;  3E9J B;  2B7J A;  1ILO A;  5CRH A;  2HLS A;  5AIS A;  1AXD A;  1F6M C;  1F2E A;  2I1U A;  5IQY A;  3QDN A;  3GKK A;  3FYG A;  4G2E A;  3EWL A;  4K7O A;  5HR2 A;  4Z2T A;  1OKT A;  1DE1 A;  2V41 A;  3H1N A;  3WYW A;  3CXG A;  2X8H A;  3ZML A;  1M7T A;  5JWO B;  5IM9 A;  4MJB A;  4WR5 A;  2MZC A;  2HT9 A;  2J23 A;  3S9F A;  4MJC A;  4JR4 A;  3N9J A;  4KDU A;  2H71 A;  4MH3 A;  4EXJ A;  4KDX A;  4X4J A;  1A8Y A;  5A4V A;  13GS A;  1XBS A;  1I9D A;  4I8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...