3MNLA

The crystal structure of kstr (rv3574) from mycobacterium tuberculosis h37rv
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
189
structure length
188
Chain Sequence
LGSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRSAVAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMAGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIGDQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN (PROBABLY TETR-FAMILY)
publication title The Structure of the Transcriptional Repressor KstR in Complex with CoA Thioester Cholesterol Metabolites Sheds Light on the Regulation of Cholesterol Catabolism in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription regulator
total genus 78
structure length 188
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17925 TetR_C_20 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3mnlA00
2Y31A 1JT6A 3ON2A 2WUIA 2XPWA 2X6OA 5K7ZA 2HYTA 3G7RA 3HGGA 2QKOA 2DG7A 5IOYA 2G7GA 4JKZA 3VOXA 3DPJA 5FKMA 1UI6A 3CCYA 4D5CA 3LSPA 2ZCXA 5CXGA 3FK7A 5HSZA 4GFKA 2ID6A 4CGRA 2ZCNA 5D19A 2FBQA 3QKXA 4I76A 3LJLA 1ZK8A 5FKOA 4KWAA 3BR3A 2F07A 3Q0WA 2O7TA 3COLA 3VVYA 1RPWA 3LSRA 2XPUA 3VP5A 3FK6A 5J3LA 2XDNA 2ID3A 3KKDA 3HGYA 1JUPA 3DCFA 3EUPA 3NPIA 3ZQHA 2WGBA 3KKCA 2OPTA 2TCTA 4XK4A 5CXIA 3ZQIA 5FHPA 3NNRA 4D7NA 4ME9A 2HQ5A 3F0CA 4M3EA 3HIMA 4MXMA 1QVTA 3TP0A 2UXUA 1RKTA 5GPAA 3VW2A 4M3FA 2FJ1A 3VIBA 3F1BA 3AQTA 2XGDA 2FQ4A 2HXOA 3VVZA 1U9OA 2QTQA 2GBYA 3CDLA 3BJBA 5F0HA 4W97A 3VPRA 4B1RA 5CW8A 3LSJA 4M3GA 2G3BA 3ZQFA 3BCGA 3QPLA 2VKVA 2GUHA 5FMPA 2XPVA 5IOZA 2NP5A 2XB5A 3C2BA 4G12A 2FD5A 3CJDA 5GPCA 2QOPA 3C07A 3HTJA 3NXCA 2HKUA 4AF5A 1ORKA 5F0FA 2PBXA 2RASA 1JUMA 5EFYA 5F1JA 3S5RA 3IH2A 2FX0A 2ZB9A 3BQZA 3BNIA 1UI5A 3IH4A 2NS7A 2JJ7A 2HXIA 2VPRA 5GP9A 2IAIA 3ANPA 5IPAA 3ZQLA 3PPBA 4DW6A 2OF7A 1A6IA 5DAJA 3Q3SA 3HE0A 2QWTA 3PASA 3ON4A 4ABZA 5J1RA 3V78A 3SDGA 3G56A 3TP3A 1QPIA 5C4YA 3BR1A 4YZEA 5D18A 1JUSA 2G0EA 2Y30A 4B3AA 4AC0A 3BTIA 3E7QA 1T56A 2NX4A 3IUVA 4AUXA 3BTJA 3WHBA 3NI7A 4W1UA 3QPSA 3MVPA 2DTZA 2W53A 2GFNA 5HAWA 2XRLA 2ZCMA 3VOKA 2XGEA 4MK6A 5IP6A 4JYKA 3BTLA 4GCLA 3ZQGA 2XGCA 2D6YA 3EGQA 4GCTA 4AC6A 3AQSA 3O8HA 4L62A 3WHCA 2QCOA 3B81A 2G7LA 1SGMA 5FKNA 2I10A 2QIBA 3KZ9A 4UDSA 3Q0VA 2TRTA 3HTIA 2HYJA 5J1UA 4X1EA 3FIWA 4M3BA 2IEKA 3V6GA 4MO7A 3NRGA 2REKA 2X9DA 2G7SA 2PZ9A 1U9NA 2YVEA 1ZKGA 2OERA 4JL3A 5F04A 1Z0XA 2WV1A 1RKWA 3LHQA 3G1LA 5K7HA 5F0CA 3PM1A 2RHAA 3B6AA 3BTCA 5HBUA 3RD3A 2OI8A 4NN1A 5FKKA 2DG8A 2Q24A 4HKUA 3KNWA 3BT9A 5H9TA 4ACIA 3BR5A 5EZGA 3BHQA 4ICHA 5J1YA 5EYRA 2GENA 5D1RA 5K7FA 2JK3A 3FRQA 2V57A 3B6CA 3BQYA 1QVUA 3HTAA 3VW0A 3O60A 3CWRA 3IH3A 1JTXA 4D7MA 3HTHA 4V2GA 2IU5A 3T6NA 2IBDA 4I6ZA 2UXOA 3BR6A 5AQCA 2NS8A 3RH2A 2EH3A 2Y2ZA 4NELA 3BR0A 3GZIA 5FKLA 2YVHA 5F27A 4V2FA 4GFLA 3G1MA 3LOCA 3Q0UA 3G1OA 4JNNA 4D5FA 3DEWA 3ANGA 5EZHA 3MNLA 2UXIA 3BRUA 2VKEA 3VUQA 1JT0A 5K58A 3JSJA 4GCKA 1BJZA 1Z77A 2UXPA 2UXHA 3SFIA 3P9TA 3LWJA 3VW1A 1JTYA 3QQAA 3O8GA 2RAEA 4M3DA 2NP3A 2O7OA 3CRJA 3QBMA 3BR2A 3VVXA 5FGLA 4PXIA 3GEUA 2ZOYA 5F08A 1VI0A 2ZOZA 1T33A
chains in the Genus database with same CATH superfamily
2Y31A 4U9LA 1JT6A 2R7WA 3ON2A 2WUIA 2XPWA 2X6OA 5K7ZA 2HYTA 2R7OA 2FJI1 3G7RA 3HGGA 2QKOA 2PFVA 2DG7A 5IOYA 2G7GA 4JKZA 3VOXA 3DPJA 5FKMA 1UI6A 3CCYA 4D5CA 3LSPA 2ZCXA 5CXGA 3FK7A 5HSZA 3DU5A 4GFKA 2ID6A 4CGRA 2ZCNA 5D19A 2FBQA 3QKXA 4I76A 3LJLA 1ZK8A 5FKOA 2R7VA 4KWAA 3BR3A 2F07A 3Q0WA 2O7TA 3K8PC 3COLA 3VVYA 1RPWA 3LSRA 2XPUA 3VP5A 3FK6A 5J3LA 2XDNA 4C2MA 2ID3A 3KKDA 3HGYA 1JUPA 3DCFA 3EUPA 3NPIA 3ZQHA 2YVXA 2WGBA 3KKCA 2OPTA 2TCTA 4XK4A 5CXIA 3ZQIA 5FHPA 3NNRA 4D7NA 4ME9A 2HQ5A 2ZY9A 3F0CA 4M3EA 3HIMA 4MXMA 1QVTA 3TP0A 2UXUA 1RKTA 5GPAA 3VW2A 4M3FA 2FJ1A 3VIBA 3F1BA 3AQTA 2XGDA 2FQ4A 2HXOA 3VVZA 1U9OA 2QTQA 3SWHA 2GBYA 3CDLA 3BJBA 5F0HA 4W97A 3VPRA 4B1RA 5CW8A 3LSJA 4M3GA 2G3BA 3FHNA 3BCGA 3ZQFA 3QPLA 2VKVA 2GUHA 5FMPA 2XPVA 5IOZA 2NP5A 2XB5A 3C2BA 4G12A 2FD5A 3CJDA 5GPCA 2QOPA 3C07A 3KYLA 3HTJA 3NXCA 2HKUA 4AF5A 1ORKA 5F0FA 2PBXA 2RASA 1JUMA 2A2FX 5EFYA 5F1JA 3S5RA 3IH2A 2FX0A 2ZB9A 3BQZA 3BNIA 1UI5A 3IH4A 2NS7A 2JJ7A 5CQGA 2HXIA 2VPRA 5GP9A 2IAIA 3ANPA 5IPAA 3ZQLA 3PPBA 4DW6A 2OF7A 1A6IA 5DAJA 3Q3SA 3HE0A 2QWTA 3PASA 3ON4A 4ABZA 5J1RA 3V78A 3SDGA 3G56A 3TP3A 1QPIA 5C4YA 3BR1A 2R7XA 4YZEA 5D18A 1JUSA 2G0EA 2Y30A 2R7RA 4B3AA 4AC0A 3BTIA 3VTIA 3E7QA 1T56A 2NX4A 3IUVA 2R7TA 4AUXA 3BTJA 3WHBA 3NI7A 4W1UA 3QPSA 3MVPA 2DTZA 2W53A 2GFNA 2R7QA 5HAWA 2XRLA 2ZCMA 3VOKA 2XGEA 4MK6A 5IP6A 4JYKA 3BTLA 4GCLA 3ZQGA 2XGCA 2D6YA 3EGQA 4GCTA 4AC6A 3AQSA 3O8HA 4L62A 3WHCA 2QCOA 3DU6A 3B81A 2G7LA 1SGMA 5FKNA 2I10A 2QIBA 3KZ9A 4UDSA 3Q0VA 2TRTA 3HTIA 2HYJA 5J1UA 4X1EA 3FIWA 4M3BA 2IEKA 3V6GA 2B1EA 4MO7A 3NRGA 2REKA 2X9DA 2G7SA 2PZ9A 1U9NA 2YVEA 1ZKGA 2OERA 4JL3A 5F04A 1Z0XA 2WV1A 1RKWA 3LHQA 3G1LA 5K7HA 5F0CA 3PM1A 2B3WA 2RHAA 3B6AA 3BTCA 5HBUA 3RD3A 2OI8A 4NN1A 5FKKA 2R7UA 2DG8A 2Q24A 4HKUA 3KNWA 3BT9A 5H9TA 4ACIA 3BR5A 5EZGA 3BHQA 4ICHA 5J1YA 4WIBA 5EYRA 2GENA 5D1RA 5K7FA 2JK3A 3FRQA 3NS4A 2V57A 3B6CA 3BQYA 1QVUA 3HTAA 3VW0A 3O60A 4OD4A 3CWRA 3IH3A 1JTXA 4D7MA 3HTHA 4V2GA 2IU5A 3T6NA 2IBDA 4I6ZA 2UXOA 4IRVA 3BR6A 5AQCA 2NS8A 3RH2A 2EH3A 2Y2ZA 4NELA 3BR0A 3GZIA 5FKLA 2YVHA 5F27A 4V2FA 4GFLA 3G1MA 3LOCA 3Q0UA 3G1OA 4JNNA 4D5FA 3DEWA 3ANGA 5EZHA 3MNLA 2UXIA 3BRUA 2VKEA 3VUQA 1JT0A 5K58A 3JSJA 4GCKA 1BJZA 1Z77A 2UXPA 2UXHA 3SFIA 3P9TA 3LWJA 2R7SA 3VW1A 1JTYA 3QQAA 3O8GA 2RAEA 4M3DA 2NP3A 2O7OA 3CRJA 4DVYP 4U9NA 3QBMA 3BR2A 3VVXA 5FGLA 4PXIA 3GEUA 2ZOYA 5F08A 1VI0A 2ZOZA 1T33A 4OD5A
chains in the Genus database with same CATH topology
2Y31A 1JT6A 3ON2A 2WUIA 2XPWA 2X6OA 5K7ZA 2HYTA 3G7RA 3HGGA 2QKOA 2DG7A 5IOYA 2G7GA 4JKZA 3VOXA 3DPJA 5FKMA 1UI6A 3CCYA 4D5CA 3LSPA 2ZCXA 5CXGA 3FK7A 5HSZA 4GFKA 2ID6A 4CGRA 2ZCNA 5D19A 2FBQA 3QKXA 4I76A 3LJLA 1ZK8A 5FKOA 4KWAA 3BR3A 2F07A 3Q0WA 2O7TA 3COLA 3VVYA 1RPWA 3LSRA 2XPUA 3VP5A 3FK6A 5J3LA 2XDNA 2ID3A 3KKDA 3HGYA 1JUPA 3DCFA 3EUPA 3NPIA 3ZQHA 2WGBA 3KKCA 2OPTA 2TCTA 4XK4A 5CXIA 3ZQIA 5FHPA 3NNRA 4D7NA 4ME9A 2HQ5A 3F0CA 4M3EA 3HIMA 4MXMA 1QVTA 3TP0A 2UXUA 1RKTA 5GPAA 3VW2A 4M3FA 2FJ1A 3VIBA 3F1BA 3AQTA 2XGDA 2FQ4A 2HXOA 3VVZA 1U9OA 2QTQA 2GBYA 3CDLA 3BJBA 5F0HA 4W97A 3VPRA 4B1RA 5CW8A 3LSJA 4M3GA 2G3BA 3ZQFA 3BCGA 3QPLA 2VKVA 2GUHA 5FMPA 2XPVA 5IOZA 2NP5A 2XB5A 3C2BA 4G12A 2FD5A 3CJDA 5GPCA 2QOPA 3C07A 3HTJA 3NXCA 2HKUA 4AF5A 1ORKA 5F0FA 2PBXA 2RASA 1JUMA 5EFYA 5F1JA 3S5RA 3IH2A 2FX0A 2ZB9A 3BQZA 3BNIA 1UI5A 3IH4A 2NS7A 2JJ7A 2HXIA 2VPRA 5GP9A 2IAIA 3ANPA 5IPAA 3ZQLA 3PPBA 4DW6A 2OF7A 1A6IA 5DAJA 3Q3SA 3HE0A 2QWTA 3PASA 3ON4A 4ABZA 5J1RA 3V78A 3SDGA 3G56A 3TP3A 1QPIA 5C4YA 3BR1A 4YZEA 5D18A 1JUSA 2G0EA 2Y30A 4B3AA 4AC0A 3BTIA 3E7QA 1T56A 2NX4A 3IUVA 4AUXA 3BTJA 3WHBA 3NI7A 4W1UA 3QPSA 3MVPA 2DTZA 2W53A 2GFNA 5HAWA 2XRLA 2ZCMA 3VOKA 2XGEA 4MK6A 5IP6A 4JYKA 3BTLA 4GCLA 3ZQGA 2XGCA 2D6YA 3EGQA 4GCTA 4AC6A 3AQSA 3O8HA 4L62A 3WHCA 2QCOA 3B81A 2G7LA 1SGMA 5FKNA 2I10A 2QIBA 3KZ9A 4UDSA 3Q0VA 2TRTA 3HTIA 2HYJA 5J1UA 4X1EA 3FIWA 4M3BA 2IEKA 3V6GA 4MO7A 3NRGA 2REKA 2X9DA 2G7SA 2PZ9A 1U9NA 2YVEA 1ZKGA 2OERA 4JL3A 5F04A 1Z0XA 2WV1A 1RKWA 3LHQA 3G1LA 5K7HA 5F0CA 3PM1A 2RHAA 3B6AA 3BTCA 5HBUA 3RD3A 2OI8A 4NN1A 5FKKA 2DG8A 2Q24A 4HKUA 3KNWA 3BT9A 5H9TA 4ACIA 3BR5A 5EZGA 3BHQA 4ICHA 5J1YA 5EYRA 2GENA 5D1RA 5K7FA 2JK3A 3FRQA 2V57A 3B6CA 3BQYA 1QVUA 3HTAA 3VW0A 3O60A 3CWRA 3IH3A 1JTXA 4D7MA 3HTHA 4V2GA 2IU5A 3T6NA 2IBDA 4I6ZA 2UXOA 3BR6A 5AQCA 2NS8A 3RH2A 2EH3A 2Y2ZA 4NELA 3BR0A 3GZIA 5FKLA 2YVHA 5F27A 4V2FA 4GFLA 3G1MA 3LOCA 3Q0UA 3G1OA 4JNNA 4D5FA 3DEWA 3ANGA 5EZHA 3MNLA 2UXIA 3BRUA 2VKEA 3VUQA 1JT0A 5K58A 3JSJA 4GCKA 1BJZA 1Z77A 2UXPA 2UXHA 3SFIA 3P9TA 3LWJA 3VW1A 1JTYA 3QQAA 3O8GA 2RAEA 4M3DA 2NP3A 2O7OA 3CRJA 3QBMA 3BR2A 3VVXA 5FGLA 4PXIA 3GEUA 2ZOYA 5F08A 1VI0A 2ZOZA 1T33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y31 A;  1JT6 A;  3ON2 A;  2WUI A;  2XPW A;  2X6O A;  5K7Z A;  2HYT A;  3G7R A;  3HGG A;  2QKO A;  2DG7 A;  5IOY A;  2G7G A;  4JKZ A;  3VOX A;  3DPJ A;  5FKM A;  1UI6 A;  3CCY A;  4D5C A;  3LSP A;  2ZCX A;  5CXG A;  3FK7 A;  5HSZ A;  4GFK A;  2ID6 A;  4CGR A;  2ZCN A;  5D19 A;  2FBQ A;  3QKX A;  4I76 A;  3LJL A;  1ZK8 A;  5FKO A;  4KWA A;  3BR3 A;  2F07 A;  3Q0W A;  2O7T A;  3COL A;  3VVY A;  1RPW A;  3LSR A;  2XPU A;  3VP5 A;  3FK6 A;  5J3L A;  2XDN A;  2ID3 A;  3KKD A;  3HGY A;  1JUP A;  3DCF A;  3EUP A;  3NPI A;  3ZQH A;  2WGB A;  3KKC A;  2OPT A;  2TCT A;  4XK4 A;  5CXI A;  3ZQI A;  5FHP A;  3NNR A;  4D7N A;  4ME9 A;  2HQ5 A;  3F0C A;  4M3E A;  3HIM A;  4MXM A;  1QVT A;  3TP0 A;  2UXU A;  1RKT A;  5GPA A;  3VW2 A;  4M3F A;  2FJ1 A;  3VIB A;  3F1B A;  3AQT A;  2XGD A;  2FQ4 A;  2HXO A;  3VVZ A;  1U9O A;  2QTQ A;  2GBY A;  3CDL A;  3BJB A;  5F0H A;  4W97 A;  3VPR A;  4B1R A;  5CW8 A;  3LSJ A;  4M3G A;  2G3B A;  3ZQF A;  3BCG A;  3QPL A;  2VKV A;  2GUH A;  5FMP A;  2XPV A;  5IOZ A;  2NP5 A;  2XB5 A;  3C2B A;  4G12 A;  2FD5 A;  3CJD A;  5GPC A;  2QOP A;  3C07 A;  3HTJ A;  3NXC A;  2HKU A;  4AF5 A;  1ORK A;  5F0F A;  2PBX A;  2RAS A;  1JUM A;  5EFY A;  5F1J A;  3S5R A;  3IH2 A;  2FX0 A;  2ZB9 A;  3BQZ A;  3BNI A;  1UI5 A;  3IH4 A;  2NS7 A;  2JJ7 A;  2HXI A;  2VPR A;  5GP9 A;  2IAI A;  3ANP A;  5IPA A;  3ZQL A;  3PPB A;  4DW6 A;  2OF7 A;  1A6I A;  5DAJ A;  3Q3S A;  3HE0 A;  2QWT A;  3PAS A;  3ON4 A;  4ABZ A;  5J1R A;  3V78 A;  3SDG A;  3G56 A;  3TP3 A;  1QPI A;  5C4Y A;  3BR1 A;  4YZE A;  5D18 A;  1JUS A;  2G0E A;  2Y30 A;  4B3A A;  4AC0 A;  3BTI A;  3E7Q A;  1T56 A;  2NX4 A;  3IUV A;  4AUX A;  3BTJ A;  3WHB A;  3NI7 A;  4W1U A;  3QPS A;  3MVP A;  2DTZ A;  2W53 A;  2GFN A;  5HAW A;  2XRL A;  2ZCM A;  3VOK A;  2XGE A;  4MK6 A;  5IP6 A;  4JYK A;  3BTL A;  4GCL A;  3ZQG A;  2XGC A;  2D6Y A;  3EGQ A;  4GCT A;  4AC6 A;  3AQS A;  3O8H A;  4L62 A;  3WHC A;  2QCO A;  3B81 A;  2G7L A;  1SGM A;  5FKN A;  2I10 A;  2QIB A;  3KZ9 A;  4UDS A;  3Q0V A;  2TRT A;  3HTI A;  2HYJ A;  5J1U A;  4X1E A;  3FIW A;  4M3B A;  2IEK A;  3V6G A;  4MO7 A;  3NRG A;  2REK A;  2X9D A;  2G7S A;  2PZ9 A;  1U9N A;  2YVE A;  1ZKG A;  2OER A;  4JL3 A;  5F04 A;  1Z0X A;  2WV1 A;  1RKW A;  3LHQ A;  3G1L A;  5K7H A;  5F0C A;  3PM1 A;  2RHA A;  3B6A A;  3BTC A;  5HBU A;  3RD3 A;  2OI8 A;  4NN1 A;  5FKK A;  2DG8 A;  2Q24 A;  4HKU A;  3KNW A;  3BT9 A;  5H9T A;  4ACI A;  3BR5 A;  5EZG A;  3BHQ A;  4ICH A;  5J1Y A;  5EYR A;  2GEN A;  5D1R A;  5K7F A;  2JK3 A;  3FRQ A;  2V57 A;  3B6C A;  3BQY A;  1QVU A;  3HTA A;  3VW0 A;  3O60 A;  3CWR A;  3IH3 A;  1JTX A;  4D7M A;  3HTH A;  4V2G A;  2IU5 A;  3T6N A;  2IBD A;  4I6Z A;  2UXO A;  3BR6 A;  5AQC A;  2NS8 A;  3RH2 A;  2EH3 A;  2Y2Z A;  4NEL A;  3BR0 A;  3GZI A;  5FKL A;  2YVH A;  5F27 A;  4V2F A;  4GFL A;  3G1M A;  3LOC A;  3Q0U A;  3G1O A;  4JNN A;  4D5F A;  3DEW A;  3ANG A;  5EZH A;  3MNL A;  2UXI A;  3BRU A;  2VKE A;  3VUQ A;  1JT0 A;  5K58 A;  3JSJ A;  4GCK A;  1BJZ A;  1Z77 A;  2UXP A;  2UXH A;  3SFI A;  3P9T A;  3LWJ A;  3VW1 A;  1JTY A;  3QQA A;  3O8G A;  2RAE A;  4M3D A;  2NP3 A;  2O7O A;  3CRJ A;  3QBM A;  3BR2 A;  3VVX A;  5FGL A;  4PXI A;  3GEU A;  2ZOY A;  5F08 A;  1VI0 A;  2ZOZ A;  1T33 A; 
#chains in the Genus database with same CATH topology
 2Y31 A;  4U9L A;  1JT6 A;  2R7W A;  3ON2 A;  2WUI A;  2XPW A;  2X6O A;  5K7Z A;  2HYT A;  2R7O A;  2FJI 1;  3G7R A;  3HGG A;  2QKO A;  2PFV A;  2DG7 A;  5IOY A;  2G7G A;  4JKZ A;  3VOX A;  3DPJ A;  5FKM A;  1UI6 A;  3CCY A;  4D5C A;  3LSP A;  2ZCX A;  5CXG A;  3FK7 A;  5HSZ A;  3DU5 A;  4GFK A;  2ID6 A;  4CGR A;  2ZCN A;  5D19 A;  2FBQ A;  3QKX A;  4I76 A;  3LJL A;  1ZK8 A;  5FKO A;  2R7V A;  4KWA A;  3BR3 A;  2F07 A;  3Q0W A;  2O7T A;  3K8P C;  3COL A;  3VVY A;  1RPW A;  3LSR A;  2XPU A;  3VP5 A;  3FK6 A;  5J3L A;  2XDN A;  4C2M A;  2ID3 A;  3KKD A;  3HGY A;  1JUP A;  3DCF A;  3EUP A;  3NPI A;  3ZQH A;  2YVX A;  2WGB A;  3KKC A;  2OPT A;  2TCT A;  4XK4 A;  5CXI A;  3ZQI A;  5FHP A;  3NNR A;  4D7N A;  4ME9 A;  2HQ5 A;  2ZY9 A;  3F0C A;  4M3E A;  3HIM A;  4MXM A;  1QVT A;  3TP0 A;  2UXU A;  1RKT A;  5GPA A;  3VW2 A;  4M3F A;  2FJ1 A;  3VIB A;  3F1B A;  3AQT A;  2XGD A;  2FQ4 A;  2HXO A;  3VVZ A;  1U9O A;  2QTQ A;  3SWH A;  2GBY A;  3CDL A;  3BJB A;  5F0H A;  4W97 A;  3VPR A;  4B1R A;  5CW8 A;  3LSJ A;  4M3G A;  2G3B A;  3FHN A;  3BCG A;  3ZQF A;  3QPL A;  2VKV A;  2GUH A;  5FMP A;  2XPV A;  5IOZ A;  2NP5 A;  2XB5 A;  3C2B A;  4G12 A;  2FD5 A;  3CJD A;  5GPC A;  2QOP A;  3C07 A;  3KYL A;  3HTJ A;  3NXC A;  2HKU A;  4AF5 A;  1ORK A;  5F0F A;  2PBX A;  2RAS A;  1JUM A;  2A2F X;  5EFY A;  5F1J A;  3S5R A;  3IH2 A;  2FX0 A;  2ZB9 A;  3BQZ A;  3BNI A;  1UI5 A;  3IH4 A;  2NS7 A;  2JJ7 A;  5CQG A;  2HXI A;  2VPR A;  5GP9 A;  2IAI A;  3ANP A;  5IPA A;  3ZQL A;  3PPB A;  4DW6 A;  2OF7 A;  1A6I A;  5DAJ A;  3Q3S A;  3HE0 A;  2QWT A;  3PAS A;  3ON4 A;  4ABZ A;  5J1R A;  3V78 A;  3SDG A;  3G56 A;  3TP3 A;  1QPI A;  5C4Y A;  3BR1 A;  2R7X A;  4YZE A;  5D18 A;  1JUS A;  2G0E A;  2Y30 A;  2R7R A;  4B3A A;  4AC0 A;  3BTI A;  3VTI A;  3E7Q A;  1T56 A;  2NX4 A;  3IUV A;  2R7T A;  4AUX A;  3BTJ A;  3WHB A;  3NI7 A;  4W1U A;  3QPS A;  3MVP A;  2DTZ A;  2W53 A;  2GFN A;  2R7Q A;  5HAW A;  2XRL A;  2ZCM A;  3VOK A;  2XGE A;  4MK6 A;  5IP6 A;  4JYK A;  3BTL A;  4GCL A;  3ZQG A;  2XGC A;  2D6Y A;  3EGQ A;  4GCT A;  4AC6 A;  3AQS A;  3O8H A;  4L62 A;  3WHC A;  2QCO A;  3DU6 A;  3B81 A;  2G7L A;  1SGM A;  5FKN A;  2I10 A;  2QIB A;  3KZ9 A;  4UDS A;  3Q0V A;  2TRT A;  3HTI A;  2HYJ A;  5J1U A;  4X1E A;  3FIW A;  4M3B A;  2IEK A;  3V6G A;  2B1E A;  4MO7 A;  3NRG A;  2REK A;  2X9D A;  2G7S A;  2PZ9 A;  1U9N A;  2YVE A;  1ZKG A;  2OER A;  4JL3 A;  5F04 A;  1Z0X A;  2WV1 A;  1RKW A;  3LHQ A;  3G1L A;  5K7H A;  5F0C A;  3PM1 A;  2B3W A;  2RHA A;  3B6A A;  3BTC A;  5HBU A;  3RD3 A;  2OI8 A;  4NN1 A;  5FKK A;  2R7U A;  2DG8 A;  2Q24 A;  4HKU A;  3KNW A;  3BT9 A;  5H9T A;  4ACI A;  3BR5 A;  5EZG A;  3BHQ A;  4ICH A;  5J1Y A;  4WIB A;  5EYR A;  2GEN A;  5D1R A;  5K7F A;  2JK3 A;  3FRQ A;  3NS4 A;  2V57 A;  3B6C A;  3BQY A;  1QVU A;  3HTA A;  3VW0 A;  3O60 A;  4OD4 A;  3CWR A;  3IH3 A;  1JTX A;  4D7M A;  3HTH A;  4V2G A;  2IU5 A;  3T6N A;  2IBD A;  4I6Z A;  2UXO A;  4IRV A;  3BR6 A;  5AQC A;  2NS8 A;  3RH2 A;  2EH3 A;  2Y2Z A;  4NEL A;  3BR0 A;  3GZI A;  5FKL A;  2YVH A;  5F27 A;  4V2F A;  4GFL A;  3G1M A;  3LOC A;  3Q0U A;  3G1O A;  4JNN A;  4D5F A;  3DEW A;  3ANG A;  5EZH A;  3MNL A;  2UXI A;  3BRU A;  2VKE A;  3VUQ A;  1JT0 A;  5K58 A;  3JSJ A;  4GCK A;  1BJZ A;  1Z77 A;  2UXP A;  2UXH A;  3SFI A;  3P9T A;  3LWJ A;  2R7S A;  3VW1 A;  1JTY A;  3QQA A;  3O8G A;  2RAE A;  4M3D A;  2NP3 A;  2O7O A;  3CRJ A;  4DVY P;  4U9N A;  3QBM A;  3BR2 A;  3VVX A;  5FGL A;  4PXI A;  3GEU A;  2ZOY A;  5F08 A;  1VI0 A;  2ZOZ A;  1T33 A;  4OD5 A; 
#chains in the Genus database with same CATH homology
 2Y31 A;  1JT6 A;  3ON2 A;  2WUI A;  2XPW A;  2X6O A;  5K7Z A;  2HYT A;  3G7R A;  3HGG A;  2QKO A;  2DG7 A;  5IOY A;  2G7G A;  4JKZ A;  3VOX A;  3DPJ A;  5FKM A;  1UI6 A;  3CCY A;  4D5C A;  3LSP A;  2ZCX A;  5CXG A;  3FK7 A;  5HSZ A;  4GFK A;  2ID6 A;  4CGR A;  2ZCN A;  5D19 A;  2FBQ A;  3QKX A;  4I76 A;  3LJL A;  1ZK8 A;  5FKO A;  4KWA A;  3BR3 A;  2F07 A;  3Q0W A;  2O7T A;  3COL A;  3VVY A;  1RPW A;  3LSR A;  2XPU A;  3VP5 A;  3FK6 A;  5J3L A;  2XDN A;  2ID3 A;  3KKD A;  3HGY A;  1JUP A;  3DCF A;  3EUP A;  3NPI A;  3ZQH A;  2WGB A;  3KKC A;  2OPT A;  2TCT A;  4XK4 A;  5CXI A;  3ZQI A;  5FHP A;  3NNR A;  4D7N A;  4ME9 A;  2HQ5 A;  3F0C A;  4M3E A;  3HIM A;  4MXM A;  1QVT A;  3TP0 A;  2UXU A;  1RKT A;  5GPA A;  3VW2 A;  4M3F A;  2FJ1 A;  3VIB A;  3F1B A;  3AQT A;  2XGD A;  2FQ4 A;  2HXO A;  3VVZ A;  1U9O A;  2QTQ A;  2GBY A;  3CDL A;  3BJB A;  5F0H A;  4W97 A;  3VPR A;  4B1R A;  5CW8 A;  3LSJ A;  4M3G A;  2G3B A;  3ZQF A;  3BCG A;  3QPL A;  2VKV A;  2GUH A;  5FMP A;  2XPV A;  5IOZ A;  2NP5 A;  2XB5 A;  3C2B A;  4G12 A;  2FD5 A;  3CJD A;  5GPC A;  2QOP A;  3C07 A;  3HTJ A;  3NXC A;  2HKU A;  4AF5 A;  1ORK A;  5F0F A;  2PBX A;  2RAS A;  1JUM A;  5EFY A;  5F1J A;  3S5R A;  3IH2 A;  2FX0 A;  2ZB9 A;  3BQZ A;  3BNI A;  1UI5 A;  3IH4 A;  2NS7 A;  2JJ7 A;  2HXI A;  2VPR A;  5GP9 A;  2IAI A;  3ANP A;  5IPA A;  3ZQL A;  3PPB A;  4DW6 A;  2OF7 A;  1A6I A;  5DAJ A;  3Q3S A;  3HE0 A;  2QWT A;  3PAS A;  3ON4 A;  4ABZ A;  5J1R A;  3V78 A;  3SDG A;  3G56 A;  3TP3 A;  1QPI A;  5C4Y A;  3BR1 A;  4YZE A;  5D18 A;  1JUS A;  2G0E A;  2Y30 A;  4B3A A;  4AC0 A;  3BTI A;  3E7Q A;  1T56 A;  2NX4 A;  3IUV A;  4AUX A;  3BTJ A;  3WHB A;  3NI7 A;  4W1U A;  3QPS A;  3MVP A;  2DTZ A;  2W53 A;  2GFN A;  5HAW A;  2XRL A;  2ZCM A;  3VOK A;  2XGE A;  4MK6 A;  5IP6 A;  4JYK A;  3BTL A;  4GCL A;  3ZQG A;  2XGC A;  2D6Y A;  3EGQ A;  4GCT A;  4AC6 A;  3AQS A;  3O8H A;  4L62 A;  3WHC A;  2QCO A;  3B81 A;  2G7L A;  1SGM A;  5FKN A;  2I10 A;  2QIB A;  3KZ9 A;  4UDS A;  3Q0V A;  2TRT A;  3HTI A;  2HYJ A;  5J1U A;  4X1E A;  3FIW A;  4M3B A;  2IEK A;  3V6G A;  4MO7 A;  3NRG A;  2REK A;  2X9D A;  2G7S A;  2PZ9 A;  1U9N A;  2YVE A;  1ZKG A;  2OER A;  4JL3 A;  5F04 A;  1Z0X A;  2WV1 A;  1RKW A;  3LHQ A;  3G1L A;  5K7H A;  5F0C A;  3PM1 A;  2RHA A;  3B6A A;  3BTC A;  5HBU A;  3RD3 A;  2OI8 A;  4NN1 A;  5FKK A;  2DG8 A;  2Q24 A;  4HKU A;  3KNW A;  3BT9 A;  5H9T A;  4ACI A;  3BR5 A;  5EZG A;  3BHQ A;  4ICH A;  5J1Y A;  5EYR A;  2GEN A;  5D1R A;  5K7F A;  2JK3 A;  3FRQ A;  2V57 A;  3B6C A;  3BQY A;  1QVU A;  3HTA A;  3VW0 A;  3O60 A;  3CWR A;  3IH3 A;  1JTX A;  4D7M A;  3HTH A;  4V2G A;  2IU5 A;  3T6N A;  2IBD A;  4I6Z A;  2UXO A;  3BR6 A;  5AQC A;  2NS8 A;  3RH2 A;  2EH3 A;  2Y2Z A;  4NEL A;  3BR0 A;  3GZI A;  5FKL A;  2YVH A;  5F27 A;  4V2F A;  4GFL A;  3G1M A;  3LOC A;  3Q0U A;  3G1O A;  4JNN A;  4D5F A;  3DEW A;  3ANG A;  5EZH A;  3MNL A;  2UXI A;  3BRU A;  2VKE A;  3VUQ A;  1JT0 A;  5K58 A;  3JSJ A;  4GCK A;  1BJZ A;  1Z77 A;  2UXP A;  2UXH A;  3SFI A;  3P9T A;  3LWJ A;  3VW1 A;  1JTY A;  3QQA A;  3O8G A;  2RAE A;  4M3D A;  2NP3 A;  2O7O A;  3CRJ A;  3QBM A;  3BR2 A;  3VVX A;  5FGL A;  4PXI A;  3GEU A;  2ZOY A;  5F08 A;  1VI0 A;  2ZOZ A;  1T33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...