3MNLA

The crystal structure of kstr (rv3574) from mycobacterium tuberculosis h37rv
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
189
structure length
188
Chain Sequence
LGSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRSAVAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMAGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIGDQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Transcriptional Repressor KstR in Complex with CoA Thioester Cholesterol Metabolites Sheds Light on the Regulation of Cholesterol Catabolism in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription regulator
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN (PROBABLY TETR-FAMILY)
total genus 78
structure length 188
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17925 TetR_C_20 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3mnlA00
3NPIA 1U9NA 3WHCA 4ABZA 2G3BA 1A6IA 1JUSA 3Q3SA 3BTJA 1QVUA 3LWJA 3LSJA 2X9DA 5GP9A 3B6AA 2XB5A 2EH3A 1UI5A 2HYTA 3JSJA 4B1RA 5FKLA 3VW2A 3DEWA 5F0HA 2FX0A 5EZGA 3S5RA 2YVEA 1RKTA 3HTJA 5K7ZA 3GEUA 2IU5A 4AF5A 2UXHA 3IH4A 5IOZA 3DCFA 5K7FA 1VI0A 2IEKA 1JT6A 2RAEA 3ANGA 3B81A 3HTAA 5DAJA 2VKVA 3ZQHA 2XPUA 4AC0A 3Q0UA 5F0CA 4JKZA 1Z77A 5FKMA 2Q24A 4B3AA 5F04A 5GPAA 3TP3A 3BHQA 3BR1A 2QKOA 3VPRA 3MNLA 3O8HA 3IUVA 4X1EA 4ICHA 2HXIA 1JTXA 2ID3A 2XGDA 5K58A 3CDLA 3G1LA 4M3BA 3VVZA 1QPIA 5FKNA 2NS7A 3HE0A 3DPJA 3F1BA 5CW8A 3FK7A 2TRTA 2ZOZA 3FK6A 2GENA 3IH2A 3T6NA 1JUPA 3G1OA 5FKOA 2UXUA 3ON2A 4ACIA 3FIWA 5H9TA 3EGQA 3KNWA 1UI6A 3B6CA 1T33A 2G7LA 2TCTA 2ZCXA 3CWRA 2RHAA 1RPWA 2VPRA 2OPTA 3RD3A 4HKUA 2NP3A 2X6OA 3HIMA 4AC6A 1JT0A 3G7RA 3CCYA 2WGBA 4D5FA 2DG8A 3FRQA 1JTYA 5FHPA 3Q0VA 5J1RA 2OF7A 2JJ7A 3BCGA 3BT9A 4I76A 1BJZA 5HAWA 2ZOYA 3COLA 2OI8A 2YVHA 3E7QA 2QIBA 3GZIA 3CJDA 3LSRA 2RASA 3HTIA 4D5CA 2JK3A 5F0FA 2HKUA 5F08A 3NNRA 2XPWA 5D18A 2OERA 4M3GA 2D6YA 3QQAA 5IOYA 4V2GA 3C07A 5D19A 5EYRA 4M3DA 5FKKA 3BNIA 5J3LA 2XRLA 4GCKA 5HSZA 5GPCA 5CXIA 1SGMA 5FMPA 2I10A 3PPBA 1RKWA 5J1UA 1JUMA 3LHQA 2IAIA 3NXCA 1U9OA 3PM1A 5AQCA 2REKA 2NX4A 4JNNA 4NN1A 3ZQLA 2VKEA 3BQZA 3BR5A 3NRGA 4KWAA 4MO7A 2GFNA 3BJBA 4CGRA 2QOPA 4D7MA 4UDSA 1ZK8A 2FQ4A 4NELA 3ZQFA 2UXIA 3SDGA 2XDNA 2V57A 4I6ZA 4YZEA 4W97A 2XGCA 3VVYA 4GFKA 1T56A 3QBMA 1QVTA 1Z0XA 4W1UA 3IH3A 3VOKA 3VW1A 3QPLA 3V78A 5EFYA 2UXOA 3VOXA 3ZQGA 3KKCA 2G7GA 3LSPA 4PXIA 2ID6A 2DTZA 3SFIA 3ZQIA 2O7TA 4DW6A 5CXGA 3TP0A 4JL3A 2UXPA 2G0EA 3VIBA 3C2BA 2PBXA 4G12A 5C4YA 3RH2A 2ZB9A 3LJLA 3O8GA 2IBDA 3AQTA 5J1YA 2FJ1A 2WUIA 3O60A 4ME9A 3VUQA 2ZCNA 3BR2A 2HXOA 4XK4A 2GUHA 3HGGA 3MVPA 3QKXA 2W53A 5D1RA 5K7HA 4M3EA 3V6GA 2PZ9A 3BTLA 3EUPA 3BR3A 3BQYA 2QCOA 4MK6A 2HQ5A 3KKDA 3BTIA 4GCTA 2ZCMA 3ANPA 3BTCA 3VVXA 3LOCA 3ON4A 5F1JA 3WHBA 2Y30A 3AQSA 5IPAA 2Y31A 5FGLA 2QWTA 3Q0WA 1ORKA 4JYKA 3BRUA 4MXMA 5EZHA 2GBYA 4L62A 4D7NA 3P9TA 3QPSA 3HTHA 5HBUA 2G7SA 1ZKGA 3KZ9A 3HGYA 3G1MA 3PASA 3G56A 5F27A 2Y2ZA 2DG7A 2FD5A 5IP6A 2HYJA 3BR0A 3F0CA 4V2FA 3CRJA 2NS8A 4AUXA 2F07A 2XPVA 2WV1A 2NP5A 2FBQA 2QTQA 4GCLA 4M3FA 4GFLA 3VW0A 3NI7A 3VP5A 2O7OA 2XGEA 3BR6A
chains in the Genus database with same CATH superfamily
3NPIA 1U9NA 3WHCA 4OD4A 4ABZA 2G3BA 1A6IA 1JUSA 3Q3SA 3BTJA 1QVUA 3LWJA 3LSJA 2X9DA 5GP9A 3DU6A 3B6AA 2XB5A 2EH3A 1UI5A 2HYTA 3JSJA 4B1RA 5FKLA 3VW2A 3DEWA 5F0HA 2FX0A 5EZGA 3S5RA 2YVEA 5CQGA 1RKTA 3HTJA 5K7ZA 3GEUA 2IU5A 4AF5A 2UXHA 4C2MA 3IH4A 5IOZA 2R7UA 3DCFA 5K7FA 1VI0A 2IEKA 1JT6A 2RAEA 3ANGA 3B81A 3HTAA 5DAJA 4OD5A 2VKVA 3ZQHA 4WIBA 4U9NA 2XPUA 4AC0A 2R7RA 3Q0UA 5F0CA 4JKZA 1Z77A 5FKMA 2A2FX 2Q24A 4B3AA 5F04A 5GPAA 3TP3A 3BHQA 3BR1A 2QKOA 3VPRA 3MNLA 3O8HA 3IUVA 4X1EA 4ICHA 2HXIA 1JTXA 2ID3A 2XGDA 5K58A 3CDLA 3G1LA 4M3BA 3VVZA 1QPIA 5FKNA 2NS7A 3HE0A 3DPJA 3F1BA 5CW8A 3FK7A 4U9LA 2TRTA 2R7WA 2ZOZA 3FK6A 2GENA 3IH2A 3T6NA 3SWHA 1JUPA 3G1OA 5FKOA 2UXUA 3ON2A 4ACIA 3FIWA 5H9TA 3EGQA 3KNWA 1UI6A 3B6CA 1T33A 2G7LA 2TCTA 2ZCXA 3CWRA 2RHAA 1RPWA 2VPRA 2OPTA 3RD3A 4HKUA 2NP3A 2X6OA 3HIMA 4AC6A 1JT0A 3G7RA 3CCYA 2WGBA 4D5FA 2R7TA 3FHNA 2DG8A 3FRQA 2R7XA 1JTYA 5FHPA 3Q0VA 5J1RA 2OF7A 2JJ7A 3BCGA 3BT9A 4I76A 1BJZA 5HAWA 2ZOYA 3COLA 2OI8A 2YVHA 3E7QA 2R7OA 2QIBA 3GZIA 3CJDA 3LSRA 2RASA 3HTIA 4D5CA 2JK3A 5F0FA 2HKUA 5F08A 3NNRA 2XPWA 5D18A 2OERA 4M3GA 2D6YA 3QQAA 2PFVA 5IOYA 4V2GA 2B1EA 3C07A 5D19A 2R7QA 5EYRA 4IRVA 4M3DA 5FKKA 3BNIA 5J3LA 2XRLA 4GCKA 5HSZA 5GPCA 5CXIA 1SGMA 5FMPA 2I10A 3PPBA 1RKWA 5J1UA 1JUMA 3LHQA 2IAIA 3NXCA 1U9OA 3PM1A 5AQCA 2REKA 2NX4A 4JNNA 4NN1A 3ZQLA 2VKEA 3BQZA 3BR5A 3NRGA 4KWAA 4MO7A 2GFNA 3BJBA 3K8PC 4CGRA 2QOPA 4D7MA 4UDSA 1ZK8A 2FQ4A 4NELA 3ZQFA 2UXIA 3SDGA 2XDNA 2V57A 4I6ZA 4YZEA 4W97A 2XGCA 3VVYA 4GFKA 1T56A 3QBMA 1QVTA 1Z0XA 4W1UA 3IH3A 2B3WA 3VOKA 3VW1A 3QPLA 3V78A 5EFYA 2UXOA 3VOXA 3ZQGA 3KKCA 2G7GA 3LSPA 4PXIA 2ID6A 2DTZA 3SFIA 3ZQIA 2O7TA 4DW6A 5CXGA 3TP0A 4JL3A 2UXPA 2G0EA 3KYLA 3VIBA 3C2BA 2PBXA 4G12A 5C4YA 3RH2A 2ZB9A 3LJLA 3VTIA 3O8GA 2IBDA 3AQTA 5J1YA 2FJ1A 2WUIA 3O60A 4ME9A 3VUQA 2ZCNA 3BR2A 2HXOA 4XK4A 2GUHA 3HGGA 2FJI1 3MVPA 3QKXA 2W53A 5D1RA 5K7HA 4M3EA 3V6GA 2PZ9A 3BTLA 3EUPA 3BR3A 3BQYA 2QCOA 4MK6A 2HQ5A 3KKDA 3BTIA 4GCTA 2ZCMA 3ANPA 3BTCA 3VVXA 3LOCA 3ON4A 5F1JA 3WHBA 2Y30A 3AQSA 5IPAA 2Y31A 2YVXA 5FGLA 2QWTA 3Q0WA 1ORKA 4JYKA 3BRUA 4MXMA 5EZHA 2GBYA 4L62A 4D7NA 3P9TA 3QPSA 3HTHA 5HBUA 2G7SA 1ZKGA 3KZ9A 3HGYA 3DU5A 3G1MA 3PASA 3G56A 5F27A 2Y2ZA 2DG7A 2FD5A 2R7VA 5IP6A 2HYJA 3BR0A 3F0CA 4V2FA 3CRJA 2NS8A 4AUXA 4DVYP 2F07A 2XPVA 2WV1A 2NP5A 2FBQA 2QTQA 4GCLA 4M3FA 4GFLA 3VW0A 3NS4A 2R7SA 3NI7A 3VP5A 2ZY9A 2O7OA 2XGEA 3BR6A
chains in the Genus database with same CATH topology
3NPIA 1U9NA 3WHCA 4ABZA 2G3BA 1A6IA 1JUSA 3Q3SA 3BTJA 1QVUA 3LWJA 3LSJA 2X9DA 5GP9A 3B6AA 2XB5A 2EH3A 1UI5A 2HYTA 3JSJA 4B1RA 5FKLA 3VW2A 3DEWA 5F0HA 2FX0A 5EZGA 3S5RA 2YVEA 1RKTA 3HTJA 5K7ZA 3GEUA 2IU5A 4AF5A 2UXHA 3IH4A 5IOZA 3DCFA 5K7FA 1VI0A 2IEKA 1JT6A 2RAEA 3ANGA 3B81A 3HTAA 5DAJA 2VKVA 3ZQHA 2XPUA 4AC0A 3Q0UA 5F0CA 4JKZA 1Z77A 5FKMA 2Q24A 4B3AA 5F04A 5GPAA 3TP3A 3BHQA 3BR1A 2QKOA 3VPRA 3MNLA 3O8HA 3IUVA 4X1EA 4ICHA 2HXIA 1JTXA 2ID3A 2XGDA 5K58A 3CDLA 3G1LA 4M3BA 3VVZA 1QPIA 5FKNA 2NS7A 3HE0A 3DPJA 3F1BA 5CW8A 3FK7A 2TRTA 2ZOZA 3FK6A 2GENA 3IH2A 3T6NA 1JUPA 3G1OA 5FKOA 2UXUA 3ON2A 4ACIA 3FIWA 5H9TA 3EGQA 3KNWA 1UI6A 3B6CA 1T33A 2G7LA 2TCTA 2ZCXA 3CWRA 2RHAA 1RPWA 2VPRA 2OPTA 3RD3A 4HKUA 2NP3A 2X6OA 3HIMA 4AC6A 1JT0A 3G7RA 3CCYA 2WGBA 4D5FA 2DG8A 3FRQA 1JTYA 5FHPA 3Q0VA 5J1RA 2OF7A 2JJ7A 3BCGA 3BT9A 4I76A 1BJZA 5HAWA 2ZOYA 3COLA 2OI8A 2YVHA 3E7QA 2QIBA 3GZIA 3CJDA 3LSRA 2RASA 3HTIA 4D5CA 2JK3A 5F0FA 2HKUA 5F08A 3NNRA 2XPWA 5D18A 2OERA 4M3GA 2D6YA 3QQAA 5IOYA 4V2GA 3C07A 5D19A 5EYRA 4M3DA 5FKKA 3BNIA 5J3LA 2XRLA 4GCKA 5HSZA 5GPCA 5CXIA 1SGMA 5FMPA 2I10A 3PPBA 1RKWA 5J1UA 1JUMA 3LHQA 2IAIA 3NXCA 1U9OA 3PM1A 5AQCA 2REKA 2NX4A 4JNNA 4NN1A 3ZQLA 2VKEA 3BQZA 3BR5A 3NRGA 4KWAA 4MO7A 2GFNA 3BJBA 4CGRA 2QOPA 4D7MA 4UDSA 1ZK8A 2FQ4A 4NELA 3ZQFA 2UXIA 3SDGA 2XDNA 2V57A 4I6ZA 4YZEA 4W97A 2XGCA 3VVYA 4GFKA 1T56A 3QBMA 1QVTA 1Z0XA 4W1UA 3IH3A 3VOKA 3VW1A 3QPLA 3V78A 5EFYA 2UXOA 3VOXA 3ZQGA 3KKCA 2G7GA 3LSPA 4PXIA 2ID6A 2DTZA 3SFIA 3ZQIA 2O7TA 4DW6A 5CXGA 3TP0A 4JL3A 2UXPA 2G0EA 3VIBA 3C2BA 2PBXA 4G12A 5C4YA 3RH2A 2ZB9A 3LJLA 3O8GA 2IBDA 3AQTA 5J1YA 2FJ1A 2WUIA 3O60A 4ME9A 3VUQA 2ZCNA 3BR2A 2HXOA 4XK4A 2GUHA 3HGGA 3MVPA 3QKXA 2W53A 5D1RA 5K7HA 4M3EA 3V6GA 2PZ9A 3BTLA 3EUPA 3BR3A 3BQYA 2QCOA 4MK6A 2HQ5A 3KKDA 3BTIA 4GCTA 2ZCMA 3ANPA 3BTCA 3VVXA 3LOCA 3ON4A 5F1JA 3WHBA 2Y30A 3AQSA 5IPAA 2Y31A 5FGLA 2QWTA 3Q0WA 1ORKA 4JYKA 3BRUA 4MXMA 5EZHA 2GBYA 4L62A 4D7NA 3P9TA 3QPSA 3HTHA 5HBUA 2G7SA 1ZKGA 3KZ9A 3HGYA 3G1MA 3PASA 3G56A 5F27A 2Y2ZA 2DG7A 2FD5A 5IP6A 2HYJA 3BR0A 3F0CA 4V2FA 3CRJA 2NS8A 4AUXA 2F07A 2XPVA 2WV1A 2NP5A 2FBQA 2QTQA 4GCLA 4M3FA 4GFLA 3VW0A 3NI7A 3VP5A 2O7OA 2XGEA 3BR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NPI A;  1U9N A;  3WHC A;  4ABZ A;  2G3B A;  1A6I A;  1JUS A;  3Q3S A;  3BTJ A;  1QVU A;  3LWJ A;  3LSJ A;  2X9D A;  5GP9 A;  3B6A A;  2XB5 A;  2EH3 A;  1UI5 A;  2HYT A;  3JSJ A;  4B1R A;  5FKL A;  3VW2 A;  3DEW A;  5F0H A;  2FX0 A;  5EZG A;  3S5R A;  2YVE A;  1RKT A;  3HTJ A;  5K7Z A;  3GEU A;  2IU5 A;  4AF5 A;  2UXH A;  3IH4 A;  5IOZ A;  3DCF A;  5K7F A;  1VI0 A;  2IEK A;  1JT6 A;  2RAE A;  3ANG A;  3B81 A;  3HTA A;  5DAJ A;  2VKV A;  3ZQH A;  2XPU A;  4AC0 A;  3Q0U A;  5F0C A;  4JKZ A;  1Z77 A;  5FKM A;  2Q24 A;  4B3A A;  5F04 A;  5GPA A;  3TP3 A;  3BHQ A;  3BR1 A;  2QKO A;  3VPR A;  3MNL A;  3O8H A;  3IUV A;  4X1E A;  4ICH A;  2HXI A;  1JTX A;  2ID3 A;  2XGD A;  5K58 A;  3CDL A;  3G1L A;  4M3B A;  3VVZ A;  1QPI A;  5FKN A;  2NS7 A;  3HE0 A;  3DPJ A;  3F1B A;  5CW8 A;  3FK7 A;  2TRT A;  2ZOZ A;  3FK6 A;  2GEN A;  3IH2 A;  3T6N A;  1JUP A;  3G1O A;  5FKO A;  2UXU A;  3ON2 A;  4ACI A;  3FIW A;  5H9T A;  3EGQ A;  3KNW A;  1UI6 A;  3B6C A;  1T33 A;  2G7L A;  2TCT A;  2ZCX A;  3CWR A;  2RHA A;  1RPW A;  2VPR A;  2OPT A;  3RD3 A;  4HKU A;  2NP3 A;  2X6O A;  3HIM A;  4AC6 A;  1JT0 A;  3G7R A;  3CCY A;  2WGB A;  4D5F A;  2DG8 A;  3FRQ A;  1JTY A;  5FHP A;  3Q0V A;  5J1R A;  2OF7 A;  2JJ7 A;  3BCG A;  3BT9 A;  4I76 A;  1BJZ A;  5HAW A;  2ZOY A;  3COL A;  2OI8 A;  2YVH A;  3E7Q A;  2QIB A;  3GZI A;  3CJD A;  3LSR A;  2RAS A;  3HTI A;  4D5C A;  2JK3 A;  5F0F A;  2HKU A;  5F08 A;  3NNR A;  2XPW A;  5D18 A;  2OER A;  4M3G A;  2D6Y A;  3QQA A;  5IOY A;  4V2G A;  3C07 A;  5D19 A;  5EYR A;  4M3D A;  5FKK A;  3BNI A;  5J3L A;  2XRL A;  4GCK A;  5HSZ A;  5GPC A;  5CXI A;  1SGM A;  5FMP A;  2I10 A;  3PPB A;  1RKW A;  5J1U A;  1JUM A;  3LHQ A;  2IAI A;  3NXC A;  1U9O A;  3PM1 A;  5AQC A;  2REK A;  2NX4 A;  4JNN A;  4NN1 A;  3ZQL A;  2VKE A;  3BQZ A;  3BR5 A;  3NRG A;  4KWA A;  4MO7 A;  2GFN A;  3BJB A;  4CGR A;  2QOP A;  4D7M A;  4UDS A;  1ZK8 A;  2FQ4 A;  4NEL A;  3ZQF A;  2UXI A;  3SDG A;  2XDN A;  2V57 A;  4I6Z A;  4YZE A;  4W97 A;  2XGC A;  3VVY A;  4GFK A;  1T56 A;  3QBM A;  1QVT A;  1Z0X A;  4W1U A;  3IH3 A;  3VOK A;  3VW1 A;  3QPL A;  3V78 A;  5EFY A;  2UXO A;  3VOX A;  3ZQG A;  3KKC A;  2G7G A;  3LSP A;  4PXI A;  2ID6 A;  2DTZ A;  3SFI A;  3ZQI A;  2O7T A;  4DW6 A;  5CXG A;  3TP0 A;  4JL3 A;  2UXP A;  2G0E A;  3VIB A;  3C2B A;  2PBX A;  4G12 A;  5C4Y A;  3RH2 A;  2ZB9 A;  3LJL A;  3O8G A;  2IBD A;  3AQT A;  5J1Y A;  2FJ1 A;  2WUI A;  3O60 A;  4ME9 A;  3VUQ A;  2ZCN A;  3BR2 A;  2HXO A;  4XK4 A;  2GUH A;  3HGG A;  3MVP A;  3QKX A;  2W53 A;  5D1R A;  5K7H A;  4M3E A;  3V6G A;  2PZ9 A;  3BTL A;  3EUP A;  3BR3 A;  3BQY A;  2QCO A;  4MK6 A;  2HQ5 A;  3KKD A;  3BTI A;  4GCT A;  2ZCM A;  3ANP A;  3BTC A;  3VVX A;  3LOC A;  3ON4 A;  5F1J A;  3WHB A;  2Y30 A;  3AQS A;  5IPA A;  2Y31 A;  5FGL A;  2QWT A;  3Q0W A;  1ORK A;  4JYK A;  3BRU A;  4MXM A;  5EZH A;  2GBY A;  4L62 A;  4D7N A;  3P9T A;  3QPS A;  3HTH A;  5HBU A;  2G7S A;  1ZKG A;  3KZ9 A;  3HGY A;  3G1M A;  3PAS A;  3G56 A;  5F27 A;  2Y2Z A;  2DG7 A;  2FD5 A;  5IP6 A;  2HYJ A;  3BR0 A;  3F0C A;  4V2F A;  3CRJ A;  2NS8 A;  4AUX A;  2F07 A;  2XPV A;  2WV1 A;  2NP5 A;  2FBQ A;  2QTQ A;  4GCL A;  4M3F A;  4GFL A;  3VW0 A;  3NI7 A;  3VP5 A;  2O7O A;  2XGE A;  3BR6 A; 
#chains in the Genus database with same CATH topology
 3NPI A;  1U9N A;  3WHC A;  4OD4 A;  4ABZ A;  2G3B A;  1A6I A;  1JUS A;  3Q3S A;  3BTJ A;  1QVU A;  3LWJ A;  3LSJ A;  2X9D A;  5GP9 A;  3DU6 A;  3B6A A;  2XB5 A;  2EH3 A;  1UI5 A;  2HYT A;  3JSJ A;  4B1R A;  5FKL A;  3VW2 A;  3DEW A;  5F0H A;  2FX0 A;  5EZG A;  3S5R A;  2YVE A;  5CQG A;  1RKT A;  3HTJ A;  5K7Z A;  3GEU A;  2IU5 A;  4AF5 A;  2UXH A;  4C2M A;  3IH4 A;  5IOZ A;  2R7U A;  3DCF A;  5K7F A;  1VI0 A;  2IEK A;  1JT6 A;  2RAE A;  3ANG A;  3B81 A;  3HTA A;  5DAJ A;  4OD5 A;  2VKV A;  3ZQH A;  4WIB A;  4U9N A;  2XPU A;  4AC0 A;  2R7R A;  3Q0U A;  5F0C A;  4JKZ A;  1Z77 A;  5FKM A;  2A2F X;  2Q24 A;  4B3A A;  5F04 A;  5GPA A;  3TP3 A;  3BHQ A;  3BR1 A;  2QKO A;  3VPR A;  3MNL A;  3O8H A;  3IUV A;  4X1E A;  4ICH A;  2HXI A;  1JTX A;  2ID3 A;  2XGD A;  5K58 A;  3CDL A;  3G1L A;  4M3B A;  3VVZ A;  1QPI A;  5FKN A;  2NS7 A;  3HE0 A;  3DPJ A;  3F1B A;  5CW8 A;  3FK7 A;  4U9L A;  2TRT A;  2R7W A;  2ZOZ A;  3FK6 A;  2GEN A;  3IH2 A;  3T6N A;  3SWH A;  1JUP A;  3G1O A;  5FKO A;  2UXU A;  3ON2 A;  4ACI A;  3FIW A;  5H9T A;  3EGQ A;  3KNW A;  1UI6 A;  3B6C A;  1T33 A;  2G7L A;  2TCT A;  2ZCX A;  3CWR A;  2RHA A;  1RPW A;  2VPR A;  2OPT A;  3RD3 A;  4HKU A;  2NP3 A;  2X6O A;  3HIM A;  4AC6 A;  1JT0 A;  3G7R A;  3CCY A;  2WGB A;  4D5F A;  2R7T A;  3FHN A;  2DG8 A;  3FRQ A;  2R7X A;  1JTY A;  5FHP A;  3Q0V A;  5J1R A;  2OF7 A;  2JJ7 A;  3BCG A;  3BT9 A;  4I76 A;  1BJZ A;  5HAW A;  2ZOY A;  3COL A;  2OI8 A;  2YVH A;  3E7Q A;  2R7O A;  2QIB A;  3GZI A;  3CJD A;  3LSR A;  2RAS A;  3HTI A;  4D5C A;  2JK3 A;  5F0F A;  2HKU A;  5F08 A;  3NNR A;  2XPW A;  5D18 A;  2OER A;  4M3G A;  2D6Y A;  3QQA A;  2PFV A;  5IOY A;  4V2G A;  2B1E A;  3C07 A;  5D19 A;  2R7Q A;  5EYR A;  4IRV A;  4M3D A;  5FKK A;  3BNI A;  5J3L A;  2XRL A;  4GCK A;  5HSZ A;  5GPC A;  5CXI A;  1SGM A;  5FMP A;  2I10 A;  3PPB A;  1RKW A;  5J1U A;  1JUM A;  3LHQ A;  2IAI A;  3NXC A;  1U9O A;  3PM1 A;  5AQC A;  2REK A;  2NX4 A;  4JNN A;  4NN1 A;  3ZQL A;  2VKE A;  3BQZ A;  3BR5 A;  3NRG A;  4KWA A;  4MO7 A;  2GFN A;  3BJB A;  3K8P C;  4CGR A;  2QOP A;  4D7M A;  4UDS A;  1ZK8 A;  2FQ4 A;  4NEL A;  3ZQF A;  2UXI A;  3SDG A;  2XDN A;  2V57 A;  4I6Z A;  4YZE A;  4W97 A;  2XGC A;  3VVY A;  4GFK A;  1T56 A;  3QBM A;  1QVT A;  1Z0X A;  4W1U A;  3IH3 A;  2B3W A;  3VOK A;  3VW1 A;  3QPL A;  3V78 A;  5EFY A;  2UXO A;  3VOX A;  3ZQG A;  3KKC A;  2G7G A;  3LSP A;  4PXI A;  2ID6 A;  2DTZ A;  3SFI A;  3ZQI A;  2O7T A;  4DW6 A;  5CXG A;  3TP0 A;  4JL3 A;  2UXP A;  2G0E A;  3KYL A;  3VIB A;  3C2B A;  2PBX A;  4G12 A;  5C4Y A;  3RH2 A;  2ZB9 A;  3LJL A;  3VTI A;  3O8G A;  2IBD A;  3AQT A;  5J1Y A;  2FJ1 A;  2WUI A;  3O60 A;  4ME9 A;  3VUQ A;  2ZCN A;  3BR2 A;  2HXO A;  4XK4 A;  2GUH A;  3HGG A;  2FJI 1;  3MVP A;  3QKX A;  2W53 A;  5D1R A;  5K7H A;  4M3E A;  3V6G A;  2PZ9 A;  3BTL A;  3EUP A;  3BR3 A;  3BQY A;  2QCO A;  4MK6 A;  2HQ5 A;  3KKD A;  3BTI A;  4GCT A;  2ZCM A;  3ANP A;  3BTC A;  3VVX A;  3LOC A;  3ON4 A;  5F1J A;  3WHB A;  2Y30 A;  3AQS A;  5IPA A;  2Y31 A;  2YVX A;  5FGL A;  2QWT A;  3Q0W A;  1ORK A;  4JYK A;  3BRU A;  4MXM A;  5EZH A;  2GBY A;  4L62 A;  4D7N A;  3P9T A;  3QPS A;  3HTH A;  5HBU A;  2G7S A;  1ZKG A;  3KZ9 A;  3HGY A;  3DU5 A;  3G1M A;  3PAS A;  3G56 A;  5F27 A;  2Y2Z A;  2DG7 A;  2FD5 A;  2R7V A;  5IP6 A;  2HYJ A;  3BR0 A;  3F0C A;  4V2F A;  3CRJ A;  2NS8 A;  4AUX A;  4DVY P;  2F07 A;  2XPV A;  2WV1 A;  2NP5 A;  2FBQ A;  2QTQ A;  4GCL A;  4M3F A;  4GFL A;  3VW0 A;  3NS4 A;  2R7S A;  3NI7 A;  3VP5 A;  2ZY9 A;  2O7O A;  2XGE A;  3BR6 A; 
#chains in the Genus database with same CATH homology
 3NPI A;  1U9N A;  3WHC A;  4ABZ A;  2G3B A;  1A6I A;  1JUS A;  3Q3S A;  3BTJ A;  1QVU A;  3LWJ A;  3LSJ A;  2X9D A;  5GP9 A;  3B6A A;  2XB5 A;  2EH3 A;  1UI5 A;  2HYT A;  3JSJ A;  4B1R A;  5FKL A;  3VW2 A;  3DEW A;  5F0H A;  2FX0 A;  5EZG A;  3S5R A;  2YVE A;  1RKT A;  3HTJ A;  5K7Z A;  3GEU A;  2IU5 A;  4AF5 A;  2UXH A;  3IH4 A;  5IOZ A;  3DCF A;  5K7F A;  1VI0 A;  2IEK A;  1JT6 A;  2RAE A;  3ANG A;  3B81 A;  3HTA A;  5DAJ A;  2VKV A;  3ZQH A;  2XPU A;  4AC0 A;  3Q0U A;  5F0C A;  4JKZ A;  1Z77 A;  5FKM A;  2Q24 A;  4B3A A;  5F04 A;  5GPA A;  3TP3 A;  3BHQ A;  3BR1 A;  2QKO A;  3VPR A;  3MNL A;  3O8H A;  3IUV A;  4X1E A;  4ICH A;  2HXI A;  1JTX A;  2ID3 A;  2XGD A;  5K58 A;  3CDL A;  3G1L A;  4M3B A;  3VVZ A;  1QPI A;  5FKN A;  2NS7 A;  3HE0 A;  3DPJ A;  3F1B A;  5CW8 A;  3FK7 A;  2TRT A;  2ZOZ A;  3FK6 A;  2GEN A;  3IH2 A;  3T6N A;  1JUP A;  3G1O A;  5FKO A;  2UXU A;  3ON2 A;  4ACI A;  3FIW A;  5H9T A;  3EGQ A;  3KNW A;  1UI6 A;  3B6C A;  1T33 A;  2G7L A;  2TCT A;  2ZCX A;  3CWR A;  2RHA A;  1RPW A;  2VPR A;  2OPT A;  3RD3 A;  4HKU A;  2NP3 A;  2X6O A;  3HIM A;  4AC6 A;  1JT0 A;  3G7R A;  3CCY A;  2WGB A;  4D5F A;  2DG8 A;  3FRQ A;  1JTY A;  5FHP A;  3Q0V A;  5J1R A;  2OF7 A;  2JJ7 A;  3BCG A;  3BT9 A;  4I76 A;  1BJZ A;  5HAW A;  2ZOY A;  3COL A;  2OI8 A;  2YVH A;  3E7Q A;  2QIB A;  3GZI A;  3CJD A;  3LSR A;  2RAS A;  3HTI A;  4D5C A;  2JK3 A;  5F0F A;  2HKU A;  5F08 A;  3NNR A;  2XPW A;  5D18 A;  2OER A;  4M3G A;  2D6Y A;  3QQA A;  5IOY A;  4V2G A;  3C07 A;  5D19 A;  5EYR A;  4M3D A;  5FKK A;  3BNI A;  5J3L A;  2XRL A;  4GCK A;  5HSZ A;  5GPC A;  5CXI A;  1SGM A;  5FMP A;  2I10 A;  3PPB A;  1RKW A;  5J1U A;  1JUM A;  3LHQ A;  2IAI A;  3NXC A;  1U9O A;  3PM1 A;  5AQC A;  2REK A;  2NX4 A;  4JNN A;  4NN1 A;  3ZQL A;  2VKE A;  3BQZ A;  3BR5 A;  3NRG A;  4KWA A;  4MO7 A;  2GFN A;  3BJB A;  4CGR A;  2QOP A;  4D7M A;  4UDS A;  1ZK8 A;  2FQ4 A;  4NEL A;  3ZQF A;  2UXI A;  3SDG A;  2XDN A;  2V57 A;  4I6Z A;  4YZE A;  4W97 A;  2XGC A;  3VVY A;  4GFK A;  1T56 A;  3QBM A;  1QVT A;  1Z0X A;  4W1U A;  3IH3 A;  3VOK A;  3VW1 A;  3QPL A;  3V78 A;  5EFY A;  2UXO A;  3VOX A;  3ZQG A;  3KKC A;  2G7G A;  3LSP A;  4PXI A;  2ID6 A;  2DTZ A;  3SFI A;  3ZQI A;  2O7T A;  4DW6 A;  5CXG A;  3TP0 A;  4JL3 A;  2UXP A;  2G0E A;  3VIB A;  3C2B A;  2PBX A;  4G12 A;  5C4Y A;  3RH2 A;  2ZB9 A;  3LJL A;  3O8G A;  2IBD A;  3AQT A;  5J1Y A;  2FJ1 A;  2WUI A;  3O60 A;  4ME9 A;  3VUQ A;  2ZCN A;  3BR2 A;  2HXO A;  4XK4 A;  2GUH A;  3HGG A;  3MVP A;  3QKX A;  2W53 A;  5D1R A;  5K7H A;  4M3E A;  3V6G A;  2PZ9 A;  3BTL A;  3EUP A;  3BR3 A;  3BQY A;  2QCO A;  4MK6 A;  2HQ5 A;  3KKD A;  3BTI A;  4GCT A;  2ZCM A;  3ANP A;  3BTC A;  3VVX A;  3LOC A;  3ON4 A;  5F1J A;  3WHB A;  2Y30 A;  3AQS A;  5IPA A;  2Y31 A;  5FGL A;  2QWT A;  3Q0W A;  1ORK A;  4JYK A;  3BRU A;  4MXM A;  5EZH A;  2GBY A;  4L62 A;  4D7N A;  3P9T A;  3QPS A;  3HTH A;  5HBU A;  2G7S A;  1ZKG A;  3KZ9 A;  3HGY A;  3G1M A;  3PAS A;  3G56 A;  5F27 A;  2Y2Z A;  2DG7 A;  2FD5 A;  5IP6 A;  2HYJ A;  3BR0 A;  3F0C A;  4V2F A;  3CRJ A;  2NS8 A;  4AUX A;  2F07 A;  2XPV A;  2WV1 A;  2NP5 A;  2FBQ A;  2QTQ A;  4GCL A;  4M3F A;  4GFL A;  3VW0 A;  3NI7 A;  3VP5 A;  2O7O A;  2XGE A;  3BR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...