3MNLA

The crystal structure of kstr (rv3574) from mycobacterium tuberculosis h37rv
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
189
structure length
188
Chain Sequence
LGSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRSAVAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMAGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIGDQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN (PROBABLY TETR-FAMILY)
publication title The Structure of the Transcriptional Repressor KstR in Complex with CoA Thioester Cholesterol Metabolites Sheds Light on the Regulation of Cholesterol Catabolism in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription regulator
total genus 78
structure length 188
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17925 TetR_C_20 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3mnlA00
2OI8A 3P9TA 2W53A 5F04A 5FKLA 3VOKA 2G7SA 5GP9A 2ZCXA 2NP5A 2NS8A 4B3AA 3CDLA 4G12A 3RD3A 3LWJA 1JT0A 2IU5A 4JKZA 4W97A 3EGQA 2FQ4A 3BQYA 3EUPA 3VUQA 2XPUA 5FGLA 3BTIA 2HXOA 1U9OA 3FIWA 1QVTA 4GFLA 2UXOA 2NS7A 2YVHA 2XB5A 2UXIA 4I76A 5J3LA 5FKMA 2Y30A 4M3FA 3BRUA 2HYTA 4ME9A 5HBUA 2O7TA 5HAWA 3V78A 3Q0WA 2ID3A 3SDGA 3WHCA 4ABZA 2F07A 5K7HA 4ACIA 5EFYA 2ZCNA 3HIMA 3BNIA 3BR2A 2XGCA 5DAJA 5IOYA 3VW1A 2XGDA 3E7QA 2QIBA 3ZQHA 2FX0A 3SFIA 2RAEA 3QPLA 3GEUA 3PM1A 5F08A 3G1LA 3Q0VA 3ANPA 3IH2A 3HE0A 4MK6A 5EZGA 4HKUA 1JUPA 2DG7A 3IH3A 5D19A 3BTJA 3FK7A 2EH3A 1Z0XA 2GBYA 3HTJA 3NI7A 2VPRA 1ZKGA 2ZOYA 3VVYA 4JNNA 5F0FA 2FBQA 5IPAA 2X6OA 2QCOA 2REKA 2FD5A 1JUSA 2PBXA 1U9NA 3TP0A 4KWAA 4AF5A 5J1YA 3O60A 2HYJA 1JTYA 4M3DA 2JK3A 1Z77A 2Y2ZA 3KKDA 2G0EA 4YZEA 2Q24A 3ZQGA 2TCTA 3WHBA 3HGGA 3MVPA 5HSZA 3QKXA 2XPVA 4V2FA 1UI6A 1T56A 4NN1A 3G1MA 3O8GA 1RPWA 3VVZA 5J1UA 2RHAA 3KZ9A 3DEWA 5EZHA 2GENA 3LJLA 2ZOZA 5C4YA 3MNLA 2X9DA 2GFNA 3G7RA 5D18A 3NRGA 3C2BA 5EYRA 5FHPA 2WGBA 5F1JA 3DCFA 4GFKA 4AC6A 4GCLA 1T33A 2FJ1A 3ZQFA 2XDNA 4I6ZA 3B81A 4XK4A 2WV1A 3G1OA 3HGYA 3F0CA 3ZQIA 3NXCA 3T6NA 3HTHA 2PZ9A 2UXUA 3KKCA 2VKEA 2WUIA 3ZQLA 5F0CA 1JUMA 2OERA 2Y31A 3VW2A 2TRTA 3LOCA 4D7NA 2XPWA 2IEKA 2D6YA 3VIBA 3IH4A 4JL3A 3BTCA 3LSRA 3BR6A 4MO7A 2XGEA 2UXHA 4L62A 2IAIA 4NELA 4CGRA 5FKOA 3RH2A 2NP3A 3ON2A 2HKUA 3KNWA 4AUXA 3HTAA 4ICHA 2GUHA 4M3BA 4UDSA 5FMPA 3BR1A 3B6CA 4DW6A 5FKNA 5IP6A 3F1BA 3ANGA 3COLA 4D5CA 2ZB9A 3NPIA 5IOZA 1QPIA 1QVUA 1RKTA 3BJBA 3VOXA 4V2GA 3VW0A 2HXIA 1ORKA 5CW8A 3GZIA 4M3GA 2DTZA 5CXIA 4D7MA 5GPAA 5AQCA 3BT9A 3HTIA 2OF7A 2NX4A 3JSJA 3Q3SA 2VKVA 5K58A 3LSPA 3O8HA 3LSJA 5D1RA 2G7GA 1JTXA 3CRJA 3PPBA 4JYKA 5CXGA 2UXPA 3G56A 3CCYA 3BR3A 5F0HA 3BCGA 3CWRA 3S5RA 3DPJA 4AC0A 4GCTA 2XRLA 4D5FA 4B1RA 3AQTA 3NNRA 5K7ZA 1VI0A 2RASA 2QTQA 2QKOA 3LHQA 1A6IA 3QBMA 3VPRA 4W1UA 5J1RA 2OPTA 3VP5A 2IBDA 4PXIA 3FRQA 3TP3A 5FKKA 3BR5A 1RKWA 1SGMA 3IUVA 4M3EA 3AQSA 2ZCMA 4MXMA 2G3BA 3BTLA 3PASA 2HQ5A 3V6GA 3BR0A 4GCKA 2V57A 3C07A 5F27A 2DG8A 1BJZA 3FK6A 1JT6A 3QPSA 2G7LA 2QOPA 3CJDA 2QWTA 2JJ7A 3QQAA 1UI5A 4X1EA 5H9TA 3BQZA 1ZK8A 2I10A 5K7FA 3B6AA 2YVEA 3Q0UA 3BHQA 2O7OA 2ID6A 3ON4A 5GPCA 3VVXA
chains in the Genus database with same CATH superfamily
2OI8A 3P9TA 2W53A 5F04A 4U9NA 5FKLA 3VOKA 2G7SA 5GP9A 3DU6A 2ZCXA 2NP5A 2NS8A 4B3AA 3NS4A 3CDLA 4G12A 3RD3A 3LWJA 1JT0A 2IU5A 4JKZA 4W97A 3EGQA 2FQ4A 3BQYA 3EUPA 3VUQA 2XPUA 5FGLA 3BTIA 2HXOA 1U9OA 3FIWA 1QVTA 4GFLA 2UXOA 2NS7A 2YVHA 2XB5A 2UXIA 4I76A 3VTIA 5J3LA 5FKMA 2Y30A 4M3FA 3BRUA 2HYTA 4ME9A 5HBUA 2O7TA 5HAWA 3SWHA 3V78A 3Q0WA 2ID3A 3SDGA 3WHCA 4ABZA 2F07A 5K7HA 4ACIA 5EFYA 2ZCNA 3HIMA 3BNIA 3BR2A 2B1EA 2XGCA 5DAJA 5IOYA 3VW1A 2XGDA 3E7QA 2QIBA 3ZQHA 2FX0A 3K8PC 3SFIA 2RAEA 3QPLA 3GEUA 3PM1A 5F08A 3G1LA 3Q0VA 3ANPA 3IH2A 3HE0A 4MK6A 5EZGA 4OD5A 2R7UA 4HKUA 1JUPA 2DG7A 3IH3A 5D19A 3BTJA 3FK7A 2EH3A 1Z0XA 2GBYA 3HTJA 3NI7A 2VPRA 3DU5A 1ZKGA 2ZOYA 3VVYA 4JNNA 5F0FA 2FBQA 5IPAA 2X6OA 2QCOA 2REKA 2FD5A 1JUSA 2PBXA 2YVXA 1U9NA 3TP0A 4KWAA 4AF5A 5J1YA 3O60A 2HYJA 1JTYA 4M3DA 2JK3A 2R7XA 1Z77A 2Y2ZA 3KKDA 2G0EA 4YZEA 2Q24A 3ZQGA 2TCTA 3WHBA 3HGGA 3MVPA 5HSZA 3QKXA 2XPVA 4V2FA 1UI6A 1T56A 4NN1A 3G1MA 3O8GA 1RPWA 3VVZA 5J1UA 2RHAA 3KZ9A 3DEWA 5EZHA 2GENA 3LJLA 2ZOZA 2R7OA 5C4YA 3MNLA 2X9DA 2GFNA 3G7RA 5D18A 3NRGA 3C2BA 5EYRA 5FHPA 2WGBA 5F1JA 3DCFA 4GFKA 4AC6A 4GCLA 1T33A 2FJ1A 3ZQFA 2XDNA 4I6ZA 3B81A 4XK4A 4C2MA 2WV1A 3G1OA 3HGYA 3F0CA 3ZQIA 3NXCA 3T6NA 2R7SA 3HTHA 2PZ9A 2UXUA 3KKCA 2VKEA 2R7RA 2WUIA 3ZQLA 5F0CA 3FHNA 1JUMA 2OERA 2Y31A 3VW2A 2TRTA 3LOCA 4D7NA 2XPWA 2IEKA 2D6YA 3VIBA 3IH4A 4JL3A 3BTCA 3LSRA 3BR6A 4MO7A 2XGEA 2UXHA 4L62A 2IAIA 4NELA 4CGRA 5FKOA 3RH2A 2NP3A 3KYLA 3ON2A 2HKUA 3KNWA 4AUXA 3HTAA 4ICHA 2GUHA 4M3BA 4UDSA 5FMPA 3BR1A 3B6CA 4DW6A 4IRVA 5FKNA 5IP6A 3F1BA 3ANGA 2FJI1 3COLA 4D5CA 2ZB9A 3NPIA 5IOZA 1QPIA 1QVUA 1RKTA 3BJBA 3VOXA 4V2GA 4U9LA 3VW0A 2HXIA 1ORKA 5CW8A 3GZIA 4M3GA 2DTZA 5CXIA 4D7MA 5GPAA 5AQCA 2PFVA 3BT9A 3HTIA 2OF7A 2NX4A 3JSJA 3Q3SA 2VKVA 5K58A 3LSPA 3O8HA 3LSJA 5D1RA 2G7GA 1JTXA 3CRJA 3PPBA 4JYKA 5CXGA 2UXPA 3G56A 3CCYA 4OD4A 3BR3A 5F0HA 3BCGA 2A2FX 2R7WA 3CWRA 3S5RA 3DPJA 4AC0A 4GCTA 2XRLA 4D5FA 4B1RA 3AQTA 3NNRA 5K7ZA 2R7VA 1VI0A 2RASA 2QTQA 2ZY9A 2QKOA 3LHQA 1A6IA 3QBMA 3VPRA 2B3WA 4W1UA 5J1RA 2OPTA 3VP5A 4DVYP 4WIBA 2IBDA 4PXIA 3FRQA 2R7TA 3TP3A 5FKKA 3BR5A 1RKWA 1SGMA 3IUVA 4M3EA 5CQGA 3AQSA 2ZCMA 4MXMA 2G3BA 3BTLA 3PASA 2HQ5A 3V6GA 3BR0A 4GCKA 2V57A 3C07A 5F27A 2DG8A 1BJZA 3FK6A 1JT6A 3QPSA 2G7LA 2QOPA 3CJDA 2QWTA 2JJ7A 3QQAA 1UI5A 4X1EA 5H9TA 3BQZA 1ZK8A 2I10A 5K7FA 3B6AA 2YVEA 3Q0UA 3BHQA 2R7QA 2O7OA 2ID6A 3ON4A 5GPCA 3VVXA
chains in the Genus database with same CATH topology
2OI8A 3P9TA 2W53A 5F04A 5FKLA 3VOKA 2G7SA 5GP9A 2ZCXA 2NP5A 2NS8A 4B3AA 3CDLA 4G12A 3RD3A 3LWJA 1JT0A 2IU5A 4JKZA 4W97A 3EGQA 2FQ4A 3BQYA 3EUPA 3VUQA 2XPUA 5FGLA 3BTIA 2HXOA 1U9OA 3FIWA 1QVTA 4GFLA 2UXOA 2NS7A 2YVHA 2XB5A 2UXIA 4I76A 5J3LA 5FKMA 2Y30A 4M3FA 3BRUA 2HYTA 4ME9A 5HBUA 2O7TA 5HAWA 3V78A 3Q0WA 2ID3A 3SDGA 3WHCA 4ABZA 2F07A 5K7HA 4ACIA 5EFYA 2ZCNA 3HIMA 3BNIA 3BR2A 2XGCA 5DAJA 5IOYA 3VW1A 2XGDA 3E7QA 2QIBA 3ZQHA 2FX0A 3SFIA 2RAEA 3QPLA 3GEUA 3PM1A 5F08A 3G1LA 3Q0VA 3ANPA 3IH2A 3HE0A 4MK6A 5EZGA 4HKUA 1JUPA 2DG7A 3IH3A 5D19A 3BTJA 3FK7A 2EH3A 1Z0XA 2GBYA 3HTJA 3NI7A 2VPRA 1ZKGA 2ZOYA 3VVYA 4JNNA 5F0FA 2FBQA 5IPAA 2X6OA 2QCOA 2REKA 2FD5A 1JUSA 2PBXA 1U9NA 3TP0A 4KWAA 4AF5A 5J1YA 3O60A 2HYJA 1JTYA 4M3DA 2JK3A 1Z77A 2Y2ZA 3KKDA 2G0EA 4YZEA 2Q24A 3ZQGA 2TCTA 3WHBA 3HGGA 3MVPA 5HSZA 3QKXA 2XPVA 4V2FA 1UI6A 1T56A 4NN1A 3G1MA 3O8GA 1RPWA 3VVZA 5J1UA 2RHAA 3KZ9A 3DEWA 5EZHA 2GENA 3LJLA 2ZOZA 5C4YA 3MNLA 2X9DA 2GFNA 3G7RA 5D18A 3NRGA 3C2BA 5EYRA 5FHPA 2WGBA 5F1JA 3DCFA 4GFKA 4AC6A 4GCLA 1T33A 2FJ1A 3ZQFA 2XDNA 4I6ZA 3B81A 4XK4A 2WV1A 3G1OA 3HGYA 3F0CA 3ZQIA 3NXCA 3T6NA 3HTHA 2PZ9A 2UXUA 3KKCA 2VKEA 2WUIA 3ZQLA 5F0CA 1JUMA 2OERA 2Y31A 3VW2A 2TRTA 3LOCA 4D7NA 2XPWA 2IEKA 2D6YA 3VIBA 3IH4A 4JL3A 3BTCA 3LSRA 3BR6A 4MO7A 2XGEA 2UXHA 4L62A 2IAIA 4NELA 4CGRA 5FKOA 3RH2A 2NP3A 3ON2A 2HKUA 3KNWA 4AUXA 3HTAA 4ICHA 2GUHA 4M3BA 4UDSA 5FMPA 3BR1A 3B6CA 4DW6A 5FKNA 5IP6A 3F1BA 3ANGA 3COLA 4D5CA 2ZB9A 3NPIA 5IOZA 1QPIA 1QVUA 1RKTA 3BJBA 3VOXA 4V2GA 3VW0A 2HXIA 1ORKA 5CW8A 3GZIA 4M3GA 2DTZA 5CXIA 4D7MA 5GPAA 5AQCA 3BT9A 3HTIA 2OF7A 2NX4A 3JSJA 3Q3SA 2VKVA 5K58A 3LSPA 3O8HA 3LSJA 5D1RA 2G7GA 1JTXA 3CRJA 3PPBA 4JYKA 5CXGA 2UXPA 3G56A 3CCYA 3BR3A 5F0HA 3BCGA 3CWRA 3S5RA 3DPJA 4AC0A 4GCTA 2XRLA 4D5FA 4B1RA 3AQTA 3NNRA 5K7ZA 1VI0A 2RASA 2QTQA 2QKOA 3LHQA 1A6IA 3QBMA 3VPRA 4W1UA 5J1RA 2OPTA 3VP5A 2IBDA 4PXIA 3FRQA 3TP3A 5FKKA 3BR5A 1RKWA 1SGMA 3IUVA 4M3EA 3AQSA 2ZCMA 4MXMA 2G3BA 3BTLA 3PASA 2HQ5A 3V6GA 3BR0A 4GCKA 2V57A 3C07A 5F27A 2DG8A 1BJZA 3FK6A 1JT6A 3QPSA 2G7LA 2QOPA 3CJDA 2QWTA 2JJ7A 3QQAA 1UI5A 4X1EA 5H9TA 3BQZA 1ZK8A 2I10A 5K7FA 3B6AA 2YVEA 3Q0UA 3BHQA 2O7OA 2ID6A 3ON4A 5GPCA 3VVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OI8 A;  3P9T A;  2W53 A;  5F04 A;  5FKL A;  3VOK A;  2G7S A;  5GP9 A;  2ZCX A;  2NP5 A;  2NS8 A;  4B3A A;  3CDL A;  4G12 A;  3RD3 A;  3LWJ A;  1JT0 A;  2IU5 A;  4JKZ A;  4W97 A;  3EGQ A;  2FQ4 A;  3BQY A;  3EUP A;  3VUQ A;  2XPU A;  5FGL A;  3BTI A;  2HXO A;  1U9O A;  3FIW A;  1QVT A;  4GFL A;  2UXO A;  2NS7 A;  2YVH A;  2XB5 A;  2UXI A;  4I76 A;  5J3L A;  5FKM A;  2Y30 A;  4M3F A;  3BRU A;  2HYT A;  4ME9 A;  5HBU A;  2O7T A;  5HAW A;  3V78 A;  3Q0W A;  2ID3 A;  3SDG A;  3WHC A;  4ABZ A;  2F07 A;  5K7H A;  4ACI A;  5EFY A;  2ZCN A;  3HIM A;  3BNI A;  3BR2 A;  2XGC A;  5DAJ A;  5IOY A;  3VW1 A;  2XGD A;  3E7Q A;  2QIB A;  3ZQH A;  2FX0 A;  3SFI A;  2RAE A;  3QPL A;  3GEU A;  3PM1 A;  5F08 A;  3G1L A;  3Q0V A;  3ANP A;  3IH2 A;  3HE0 A;  4MK6 A;  5EZG A;  4HKU A;  1JUP A;  2DG7 A;  3IH3 A;  5D19 A;  3BTJ A;  3FK7 A;  2EH3 A;  1Z0X A;  2GBY A;  3HTJ A;  3NI7 A;  2VPR A;  1ZKG A;  2ZOY A;  3VVY A;  4JNN A;  5F0F A;  2FBQ A;  5IPA A;  2X6O A;  2QCO A;  2REK A;  2FD5 A;  1JUS A;  2PBX A;  1U9N A;  3TP0 A;  4KWA A;  4AF5 A;  5J1Y A;  3O60 A;  2HYJ A;  1JTY A;  4M3D A;  2JK3 A;  1Z77 A;  2Y2Z A;  3KKD A;  2G0E A;  4YZE A;  2Q24 A;  3ZQG A;  2TCT A;  3WHB A;  3HGG A;  3MVP A;  5HSZ A;  3QKX A;  2XPV A;  4V2F A;  1UI6 A;  1T56 A;  4NN1 A;  3G1M A;  3O8G A;  1RPW A;  3VVZ A;  5J1U A;  2RHA A;  3KZ9 A;  3DEW A;  5EZH A;  2GEN A;  3LJL A;  2ZOZ A;  5C4Y A;  3MNL A;  2X9D A;  2GFN A;  3G7R A;  5D18 A;  3NRG A;  3C2B A;  5EYR A;  5FHP A;  2WGB A;  5F1J A;  3DCF A;  4GFK A;  4AC6 A;  4GCL A;  1T33 A;  2FJ1 A;  3ZQF A;  2XDN A;  4I6Z A;  3B81 A;  4XK4 A;  2WV1 A;  3G1O A;  3HGY A;  3F0C A;  3ZQI A;  3NXC A;  3T6N A;  3HTH A;  2PZ9 A;  2UXU A;  3KKC A;  2VKE A;  2WUI A;  3ZQL A;  5F0C A;  1JUM A;  2OER A;  2Y31 A;  3VW2 A;  2TRT A;  3LOC A;  4D7N A;  2XPW A;  2IEK A;  2D6Y A;  3VIB A;  3IH4 A;  4JL3 A;  3BTC A;  3LSR A;  3BR6 A;  4MO7 A;  2XGE A;  2UXH A;  4L62 A;  2IAI A;  4NEL A;  4CGR A;  5FKO A;  3RH2 A;  2NP3 A;  3ON2 A;  2HKU A;  3KNW A;  4AUX A;  3HTA A;  4ICH A;  2GUH A;  4M3B A;  4UDS A;  5FMP A;  3BR1 A;  3B6C A;  4DW6 A;  5FKN A;  5IP6 A;  3F1B A;  3ANG A;  3COL A;  4D5C A;  2ZB9 A;  3NPI A;  5IOZ A;  1QPI A;  1QVU A;  1RKT A;  3BJB A;  3VOX A;  4V2G A;  3VW0 A;  2HXI A;  1ORK A;  5CW8 A;  3GZI A;  4M3G A;  2DTZ A;  5CXI A;  4D7M A;  5GPA A;  5AQC A;  3BT9 A;  3HTI A;  2OF7 A;  2NX4 A;  3JSJ A;  3Q3S A;  2VKV A;  5K58 A;  3LSP A;  3O8H A;  3LSJ A;  5D1R A;  2G7G A;  1JTX A;  3CRJ A;  3PPB A;  4JYK A;  5CXG A;  2UXP A;  3G56 A;  3CCY A;  3BR3 A;  5F0H A;  3BCG A;  3CWR A;  3S5R A;  3DPJ A;  4AC0 A;  4GCT A;  2XRL A;  4D5F A;  4B1R A;  3AQT A;  3NNR A;  5K7Z A;  1VI0 A;  2RAS A;  2QTQ A;  2QKO A;  3LHQ A;  1A6I A;  3QBM A;  3VPR A;  4W1U A;  5J1R A;  2OPT A;  3VP5 A;  2IBD A;  4PXI A;  3FRQ A;  3TP3 A;  5FKK A;  3BR5 A;  1RKW A;  1SGM A;  3IUV A;  4M3E A;  3AQS A;  2ZCM A;  4MXM A;  2G3B A;  3BTL A;  3PAS A;  2HQ5 A;  3V6G A;  3BR0 A;  4GCK A;  2V57 A;  3C07 A;  5F27 A;  2DG8 A;  1BJZ A;  3FK6 A;  1JT6 A;  3QPS A;  2G7L A;  2QOP A;  3CJD A;  2QWT A;  2JJ7 A;  3QQA A;  1UI5 A;  4X1E A;  5H9T A;  3BQZ A;  1ZK8 A;  2I10 A;  5K7F A;  3B6A A;  2YVE A;  3Q0U A;  3BHQ A;  2O7O A;  2ID6 A;  3ON4 A;  5GPC A;  3VVX A; 
#chains in the Genus database with same CATH topology
 2OI8 A;  3P9T A;  2W53 A;  5F04 A;  4U9N A;  5FKL A;  3VOK A;  2G7S A;  5GP9 A;  3DU6 A;  2ZCX A;  2NP5 A;  2NS8 A;  4B3A A;  3NS4 A;  3CDL A;  4G12 A;  3RD3 A;  3LWJ A;  1JT0 A;  2IU5 A;  4JKZ A;  4W97 A;  3EGQ A;  2FQ4 A;  3BQY A;  3EUP A;  3VUQ A;  2XPU A;  5FGL A;  3BTI A;  2HXO A;  1U9O A;  3FIW A;  1QVT A;  4GFL A;  2UXO A;  2NS7 A;  2YVH A;  2XB5 A;  2UXI A;  4I76 A;  3VTI A;  5J3L A;  5FKM A;  2Y30 A;  4M3F A;  3BRU A;  2HYT A;  4ME9 A;  5HBU A;  2O7T A;  5HAW A;  3SWH A;  3V78 A;  3Q0W A;  2ID3 A;  3SDG A;  3WHC A;  4ABZ A;  2F07 A;  5K7H A;  4ACI A;  5EFY A;  2ZCN A;  3HIM A;  3BNI A;  3BR2 A;  2B1E A;  2XGC A;  5DAJ A;  5IOY A;  3VW1 A;  2XGD A;  3E7Q A;  2QIB A;  3ZQH A;  2FX0 A;  3K8P C;  3SFI A;  2RAE A;  3QPL A;  3GEU A;  3PM1 A;  5F08 A;  3G1L A;  3Q0V A;  3ANP A;  3IH2 A;  3HE0 A;  4MK6 A;  5EZG A;  4OD5 A;  2R7U A;  4HKU A;  1JUP A;  2DG7 A;  3IH3 A;  5D19 A;  3BTJ A;  3FK7 A;  2EH3 A;  1Z0X A;  2GBY A;  3HTJ A;  3NI7 A;  2VPR A;  3DU5 A;  1ZKG A;  2ZOY A;  3VVY A;  4JNN A;  5F0F A;  2FBQ A;  5IPA A;  2X6O A;  2QCO A;  2REK A;  2FD5 A;  1JUS A;  2PBX A;  2YVX A;  1U9N A;  3TP0 A;  4KWA A;  4AF5 A;  5J1Y A;  3O60 A;  2HYJ A;  1JTY A;  4M3D A;  2JK3 A;  2R7X A;  1Z77 A;  2Y2Z A;  3KKD A;  2G0E A;  4YZE A;  2Q24 A;  3ZQG A;  2TCT A;  3WHB A;  3HGG A;  3MVP A;  5HSZ A;  3QKX A;  2XPV A;  4V2F A;  1UI6 A;  1T56 A;  4NN1 A;  3G1M A;  3O8G A;  1RPW A;  3VVZ A;  5J1U A;  2RHA A;  3KZ9 A;  3DEW A;  5EZH A;  2GEN A;  3LJL A;  2ZOZ A;  2R7O A;  5C4Y A;  3MNL A;  2X9D A;  2GFN A;  3G7R A;  5D18 A;  3NRG A;  3C2B A;  5EYR A;  5FHP A;  2WGB A;  5F1J A;  3DCF A;  4GFK A;  4AC6 A;  4GCL A;  1T33 A;  2FJ1 A;  3ZQF A;  2XDN A;  4I6Z A;  3B81 A;  4XK4 A;  4C2M A;  2WV1 A;  3G1O A;  3HGY A;  3F0C A;  3ZQI A;  3NXC A;  3T6N A;  2R7S A;  3HTH A;  2PZ9 A;  2UXU A;  3KKC A;  2VKE A;  2R7R A;  2WUI A;  3ZQL A;  5F0C A;  3FHN A;  1JUM A;  2OER A;  2Y31 A;  3VW2 A;  2TRT A;  3LOC A;  4D7N A;  2XPW A;  2IEK A;  2D6Y A;  3VIB A;  3IH4 A;  4JL3 A;  3BTC A;  3LSR A;  3BR6 A;  4MO7 A;  2XGE A;  2UXH A;  4L62 A;  2IAI A;  4NEL A;  4CGR A;  5FKO A;  3RH2 A;  2NP3 A;  3KYL A;  3ON2 A;  2HKU A;  3KNW A;  4AUX A;  3HTA A;  4ICH A;  2GUH A;  4M3B A;  4UDS A;  5FMP A;  3BR1 A;  3B6C A;  4DW6 A;  4IRV A;  5FKN A;  5IP6 A;  3F1B A;  3ANG A;  2FJI 1;  3COL A;  4D5C A;  2ZB9 A;  3NPI A;  5IOZ A;  1QPI A;  1QVU A;  1RKT A;  3BJB A;  3VOX A;  4V2G A;  4U9L A;  3VW0 A;  2HXI A;  1ORK A;  5CW8 A;  3GZI A;  4M3G A;  2DTZ A;  5CXI A;  4D7M A;  5GPA A;  5AQC A;  2PFV A;  3BT9 A;  3HTI A;  2OF7 A;  2NX4 A;  3JSJ A;  3Q3S A;  2VKV A;  5K58 A;  3LSP A;  3O8H A;  3LSJ A;  5D1R A;  2G7G A;  1JTX A;  3CRJ A;  3PPB A;  4JYK A;  5CXG A;  2UXP A;  3G56 A;  3CCY A;  4OD4 A;  3BR3 A;  5F0H A;  3BCG A;  2A2F X;  2R7W A;  3CWR A;  3S5R A;  3DPJ A;  4AC0 A;  4GCT A;  2XRL A;  4D5F A;  4B1R A;  3AQT A;  3NNR A;  5K7Z A;  2R7V A;  1VI0 A;  2RAS A;  2QTQ A;  2ZY9 A;  2QKO A;  3LHQ A;  1A6I A;  3QBM A;  3VPR A;  2B3W A;  4W1U A;  5J1R A;  2OPT A;  3VP5 A;  4DVY P;  4WIB A;  2IBD A;  4PXI A;  3FRQ A;  2R7T A;  3TP3 A;  5FKK A;  3BR5 A;  1RKW A;  1SGM A;  3IUV A;  4M3E A;  5CQG A;  3AQS A;  2ZCM A;  4MXM A;  2G3B A;  3BTL A;  3PAS A;  2HQ5 A;  3V6G A;  3BR0 A;  4GCK A;  2V57 A;  3C07 A;  5F27 A;  2DG8 A;  1BJZ A;  3FK6 A;  1JT6 A;  3QPS A;  2G7L A;  2QOP A;  3CJD A;  2QWT A;  2JJ7 A;  3QQA A;  1UI5 A;  4X1E A;  5H9T A;  3BQZ A;  1ZK8 A;  2I10 A;  5K7F A;  3B6A A;  2YVE A;  3Q0U A;  3BHQ A;  2R7Q A;  2O7O A;  2ID6 A;  3ON4 A;  5GPC A;  3VVX A; 
#chains in the Genus database with same CATH homology
 2OI8 A;  3P9T A;  2W53 A;  5F04 A;  5FKL A;  3VOK A;  2G7S A;  5GP9 A;  2ZCX A;  2NP5 A;  2NS8 A;  4B3A A;  3CDL A;  4G12 A;  3RD3 A;  3LWJ A;  1JT0 A;  2IU5 A;  4JKZ A;  4W97 A;  3EGQ A;  2FQ4 A;  3BQY A;  3EUP A;  3VUQ A;  2XPU A;  5FGL A;  3BTI A;  2HXO A;  1U9O A;  3FIW A;  1QVT A;  4GFL A;  2UXO A;  2NS7 A;  2YVH A;  2XB5 A;  2UXI A;  4I76 A;  5J3L A;  5FKM A;  2Y30 A;  4M3F A;  3BRU A;  2HYT A;  4ME9 A;  5HBU A;  2O7T A;  5HAW A;  3V78 A;  3Q0W A;  2ID3 A;  3SDG A;  3WHC A;  4ABZ A;  2F07 A;  5K7H A;  4ACI A;  5EFY A;  2ZCN A;  3HIM A;  3BNI A;  3BR2 A;  2XGC A;  5DAJ A;  5IOY A;  3VW1 A;  2XGD A;  3E7Q A;  2QIB A;  3ZQH A;  2FX0 A;  3SFI A;  2RAE A;  3QPL A;  3GEU A;  3PM1 A;  5F08 A;  3G1L A;  3Q0V A;  3ANP A;  3IH2 A;  3HE0 A;  4MK6 A;  5EZG A;  4HKU A;  1JUP A;  2DG7 A;  3IH3 A;  5D19 A;  3BTJ A;  3FK7 A;  2EH3 A;  1Z0X A;  2GBY A;  3HTJ A;  3NI7 A;  2VPR A;  1ZKG A;  2ZOY A;  3VVY A;  4JNN A;  5F0F A;  2FBQ A;  5IPA A;  2X6O A;  2QCO A;  2REK A;  2FD5 A;  1JUS A;  2PBX A;  1U9N A;  3TP0 A;  4KWA A;  4AF5 A;  5J1Y A;  3O60 A;  2HYJ A;  1JTY A;  4M3D A;  2JK3 A;  1Z77 A;  2Y2Z A;  3KKD A;  2G0E A;  4YZE A;  2Q24 A;  3ZQG A;  2TCT A;  3WHB A;  3HGG A;  3MVP A;  5HSZ A;  3QKX A;  2XPV A;  4V2F A;  1UI6 A;  1T56 A;  4NN1 A;  3G1M A;  3O8G A;  1RPW A;  3VVZ A;  5J1U A;  2RHA A;  3KZ9 A;  3DEW A;  5EZH A;  2GEN A;  3LJL A;  2ZOZ A;  5C4Y A;  3MNL A;  2X9D A;  2GFN A;  3G7R A;  5D18 A;  3NRG A;  3C2B A;  5EYR A;  5FHP A;  2WGB A;  5F1J A;  3DCF A;  4GFK A;  4AC6 A;  4GCL A;  1T33 A;  2FJ1 A;  3ZQF A;  2XDN A;  4I6Z A;  3B81 A;  4XK4 A;  2WV1 A;  3G1O A;  3HGY A;  3F0C A;  3ZQI A;  3NXC A;  3T6N A;  3HTH A;  2PZ9 A;  2UXU A;  3KKC A;  2VKE A;  2WUI A;  3ZQL A;  5F0C A;  1JUM A;  2OER A;  2Y31 A;  3VW2 A;  2TRT A;  3LOC A;  4D7N A;  2XPW A;  2IEK A;  2D6Y A;  3VIB A;  3IH4 A;  4JL3 A;  3BTC A;  3LSR A;  3BR6 A;  4MO7 A;  2XGE A;  2UXH A;  4L62 A;  2IAI A;  4NEL A;  4CGR A;  5FKO A;  3RH2 A;  2NP3 A;  3ON2 A;  2HKU A;  3KNW A;  4AUX A;  3HTA A;  4ICH A;  2GUH A;  4M3B A;  4UDS A;  5FMP A;  3BR1 A;  3B6C A;  4DW6 A;  5FKN A;  5IP6 A;  3F1B A;  3ANG A;  3COL A;  4D5C A;  2ZB9 A;  3NPI A;  5IOZ A;  1QPI A;  1QVU A;  1RKT A;  3BJB A;  3VOX A;  4V2G A;  3VW0 A;  2HXI A;  1ORK A;  5CW8 A;  3GZI A;  4M3G A;  2DTZ A;  5CXI A;  4D7M A;  5GPA A;  5AQC A;  3BT9 A;  3HTI A;  2OF7 A;  2NX4 A;  3JSJ A;  3Q3S A;  2VKV A;  5K58 A;  3LSP A;  3O8H A;  3LSJ A;  5D1R A;  2G7G A;  1JTX A;  3CRJ A;  3PPB A;  4JYK A;  5CXG A;  2UXP A;  3G56 A;  3CCY A;  3BR3 A;  5F0H A;  3BCG A;  3CWR A;  3S5R A;  3DPJ A;  4AC0 A;  4GCT A;  2XRL A;  4D5F A;  4B1R A;  3AQT A;  3NNR A;  5K7Z A;  1VI0 A;  2RAS A;  2QTQ A;  2QKO A;  3LHQ A;  1A6I A;  3QBM A;  3VPR A;  4W1U A;  5J1R A;  2OPT A;  3VP5 A;  2IBD A;  4PXI A;  3FRQ A;  3TP3 A;  5FKK A;  3BR5 A;  1RKW A;  1SGM A;  3IUV A;  4M3E A;  3AQS A;  2ZCM A;  4MXM A;  2G3B A;  3BTL A;  3PAS A;  2HQ5 A;  3V6G A;  3BR0 A;  4GCK A;  2V57 A;  3C07 A;  5F27 A;  2DG8 A;  1BJZ A;  3FK6 A;  1JT6 A;  3QPS A;  2G7L A;  2QOP A;  3CJD A;  2QWT A;  2JJ7 A;  3QQA A;  1UI5 A;  4X1E A;  5H9T A;  3BQZ A;  1ZK8 A;  2I10 A;  5K7F A;  3B6A A;  2YVE A;  3Q0U A;  3BHQ A;  2O7O A;  2ID6 A;  3ON4 A;  5GPC A;  3VVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...