3MNNA

A ruthenium antitumour agent forms specific histone protein adducts in the nucleosome core
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title A ruthenium antimetastasis agent forms specific histone protein adducts in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mnnA00
5GSUD 3AZKD 4KUDB 3AV1C 2AROA 3AZKB 5G49B 2L5AA 2F8NK 4WU8C 5GT3D 4J8UA 5E5AA 3MNNC 3LJAA 3AZFD 1HQ3B 5B1MB 5B32D 3AZFB 4EO5C 1P3GC 4J8XA 5AY8D 2F8ND 5B32B 1KX3D 4XZQD 2NZDA 2F8NB 5AY8B 4KGCB 5GXQC 1KX3B 4XZQB 4QLCC 3AYWA 3LZ1A 3X1UA 4Z2MG 5CPIA 4XUJD 2BYMA 3A6NA 4ZUXC 4XUJB 4JJNC 3AZKA 5C3IC 4H9QA 4WNNB 2NQBC 2RVQD 3UT9B 3R45A 5GT3A 3AZFA 5CPJC 1P3AB 5B32A 5BS7A 3MGRD 3B0DB 5JA4B 4KUDC 2F8NA 5AY8A 3WTPE 1KX3A 4XZQA 5B24C 5FUGB 4E44A 5B31B 1HQ3C 4DRAA 5B1MC 2HUEB 3UTBD 2YFWA 3X1TB 1M19B 4XUJA 3KUYB 4DRBA 3UTBB 4KGCC 4NE6A 1EQZD 3W97D 1N1JB 5B0ZC 1P34B 3RELB 3O62B 4H9NB 5JA4A 3MVDC 3MGRA 5AV9D 5B31A 3LELC 3AZMD 3UT9C 2F8NH 1ID3D 5AV9B 3REHD 3AZMB 3MGQD 1P3AC 3REHB 3AZIC 2FJ7B 1TZYC 3B6GB 3UTBA 5AV5D 1EQZA 4X23C 5B31C 5AV5B 4G91B 3WTPB 2HUEC 3W97A 3RELA 4HGAB 4H9NA 4ZBJC 4J8VD 3B6FC 3X1TC 3C1CC 5CP6D 3KUYC 2CV5D 1M19C 4J8VB 3KWQD 1KX5B 3WA9D 3W99B 5CP6B 2HIOC 3NQJB 3REKB 3NQUB 5AV9A 3AZMA 1P34C 4Z5TC 1ID3A 3RELC 3REHA 3AV1D 3O62C 4CAYB 3MGQA 3AV1B 4WU8D 3VH5T 3MNND 3MNNB 5AV5A 1P3GD 4CSRB 1P3GB 2FJ7C 1P3MC 5GXQD 4QLCD 4H9SC 4J8VA 3B6GC 1ULYA 2CV5A 5CP6A 4QLCB 3KWQA 3WA9A 5CPKC 3NQUA 3TU4C 4YM6C 3WTPC 1U35B 4ZUXD 1P3BC 4JJND 5AVCC 4ZUXB 2NQBD 3AV1A 5C3IB 1KX5C 3W99C 3C1BC 4WU8A 3MNNA 3REKC 4CSRA 5CPJD 1P3GA 4KUDD 5B24D 5GXQA 5B40C 4QLCA 5B24B 4H9PB 1HQ3D 5F99C 5B1MD 1M18C 4YS3B 1P3PB 4ZUXA 4KGCD 4KHAB 4JJNA 4Z66C 2NQBA 5B0ZD 3UTAB 5B0ZB 5CPJA 1U35C 3VH5A 3MVDD 3VH6T 4KUDA 1KX4C 4H9OB 3MVDB 5G49A 5B24A 3LELD 4H9PA 3UT9D 5BT1C 3LELB 1HQ3A 1P3AD 5B1MA 3AZID 1TZYD 5DNMB 3AZIB 2YFVB 4KHAA 3AZNC 3AN2C 1TZYB 5JRGC 1P3IC 4KGCA 4X23D 3AZLB 3B0CT 5B31D 5B1LB 3X1SB 3V9RB 4X23B 5B0ZA 3B6FD 4YS3C 3X1TD 4H9RB 3C1CD 3KUYD 3AZJB 3AFAB 1P3PC 4ZBJB 1M19D 3B6FB 3C1CB 3MVDA 2HIOD 1P3KB 4WNNA 3KXBB 2HIOB 4LD9C 3LELA 1P34D 4NE5A 3UT9A 4Z5TD 5B2JB 3UTAC 4AWLC 3RELD 3O62D 3AV2C 4Z5TB 5B33C 1P3AA 3AZEC 3AZIA 2YFVA 1TZYA 1Q9CA 2BYKB 5FUGA 3V9RA 4X23A 2FJ7D 1P3MD 5AVBB 3B6GD 3B6FA 5DNMC 1P3MB 3X1TA 3C1CA 1M19A 3KUYA 3B0BA 5CPKD 3TU4D 3AZLC 1P3FB 2HIOA 3X1SC 5B1LC 3WTPD 3X1VC 4YM6D 1F66C 1S32C 1P3BD 3VH6A 3TU4B 5CPKB 4YM6B 1N1JA 4UUZB 1P34A 5AVCD 4Z5TA 1P3BB 1B6WA 3AZJC 3O62A 3AFAC 1KX5D 5AVCB 3W99D 3C1BD 1P3KC 5GT0C 3REKD 3KXBC 3C1BB 1B67A 3REIB 4NE3A 5B2JC 3W98B 3KSYA 2FJ7A 1P3MA 3WAAB 5B40D 4J8WB 4H9SA 4WU9C 3AZGC 3B6GA 5F99D 5B40B 3REJC 5F99B 1P3OB 1M18D 5CPKA 3TU4A 4YM6A 3WTPA 4UUZA 1M18B 1P3BA 5AVBC 3VH5W 5AVCA 4Z66D 5BNXB 5KDMB 1KX5A 3W99A 4Z66B 3C1BA 1BH8B 1P3FC 3NQJA 3WKJC 3REKA 1U35D 2PYOB 5DNNC 1KX4D 4CAYA 3MGPC 1KX4B 5B40A 5BO0B 5BT1D 5F99A 3W96B 3REIC 1AOIB 1M18A 5B0YB 3AZHB 3W98C 1P3ID 3AZND 3AN2D 5JRGD 3WAAC 5KDMA 4J8WC 3AZNB 3AN2B 1P3IB 5JRGB 5B2IC 1F1EA 4Z66A 1BH8A 4J8UB 5E5AB 4Z2MH 1P3OC 4YS3D 2PYOA 1P3PD 4WZSB 1ZLAC 1U35A 3LZ0B 1KX4A 2NZDB 3MGSC 4LD9D 5BO0A 3UTAD 3LZ1B 4LD9B 3X1UB 1WWIA 3AV2D 2LY8A 5AV8C 5B33D 2PYOC 4AWLB 3AZED 3AV2B 1P3LC 2BYMB 5B33B 3A6NB 3AZEB 5BNVB 1R4VA 1P3IA 3AZNA 4M6BA 3AN2A 5JRGA 5GSUB 4H9QB 4R8PC 4WV4B 3W96C 1JFIB 3VH6W 5AV6C 3R45B 1AOIC 5GT3B 5B0YC 5DNMD 3LZ0A 3AZHC 4YS3A 1P3PA 1M1AC 3AZLD 2AROC 5B1LD 3X1SD 3X1VD 1F66D 1S32D 4LD9A 3X1VB 4J8UC 5E5AC 3LJAC 1S32B 3UTAA 1F66B 3AZJD 1H3OB 3AFAD 3AV2A 3LZ0C 5B33A 4J8XC 3B0CW 3AZEA 5BNVA 2YFWB 5GT0D 1P3KD 5GSUA 2NZDC 3KXBD 4H9OA 5GT0B 1TAFB 3AYWC 1JFIA 5B2JD 3LZ1C 3X1UC 2JSSA 5CPIC 4G92C 4WU9D 3AZGD 3A6NC 5DNMA 4WU9B 5GSUC 3MGRB 3REJD 3AZKC 3AZGB 3AZLA 3X1SA 5B1LA 3X1VA 3REJB 1F66A 1S32A 5AVBD 1H3OA 5GT3C 3AZFC 4H9RA 3AZJA 5B32C 3AFAA 5BS7C 1A7WA 5AY8C 1P3FD 1P3KA 5GT0A 3WKJD 1HTAA 1KX3C 1TAFA 4XZQC 3KXBA 3WKJB 1EQZB 5DNND 5B2JA 3W97B 5DNNB 3MGPD 4WU9A 4XUJC 3MGPB 3AZGA 2BYKA 3REID 3REJA 2RVQC 3W98D 2IO5B 4E45A 5AVBA 3WAAD 1ID3B 4J8WD 5B2ID 3B0DC 3MGQB 5B2IB 3MGRC 1P3OD 1P3FA 3WKJA 1ZLAD 5B32G 1ZLAB 2F8NG 5DNNA 3MGSD 3MGPA 3UTBC 3MGSB 2CV5B 1WWSA 5AV8D 3KWQB 3WA9B 2PYOD 1KU5A 3REIA 1EQZC 5AV8B 1P3LD 3W98A 3W97C 1P3LB 1BH9B 3WAAA 4R8PD 4J8WA 5B2IA 3W96D 5CHLB 4R8PB 5AV6D 4WU8B 1AOID 1P3OA 5B0YD 3AZHD 5AV6B 2IO5C 5AV9C 1M1AD 1ZLAA 3AZMC 4EO5B 1ID3C 3REHC 2AROD 1M1AB 3MGQC 5BNXA 3MGSA 2AROB 5GXQB 5B31G 4J8UD 5E5AD 3LJAD 5AV8A 5AV5C 4G91C 3LZ0D 3LJAB 4J8XD 1BFMA 4HGAC 1P3LA 1BH9A 2NZDD 4J8XB 4JJNB 4J8VC 3AYWD 3LZ1D 4R8PA 2NQBB 3X1UD 2CV5C 5CP6C 3AYWB 3W96A 2CWEA 3KWQC 3WA9C 5AV6A 5CPID 1AOIA 5B0YA 3A6ND 3AZHA 4NFTA 5CPJB 5CPIB 4G92B 1M1AA
chains in the Genus database with same CATH superfamily
5GSUD 3AZKD 4KUDB 3AV1C 2AROA 3AZKB 5G49B 2Y2GA 2L5AA 2F8NK 4WU8C 5GT3D 4J8UA 5E5AA 3MNNC 3LJAA 3AZFD 1HQ3B 5B1MB 5B32D 3AZFB 4EO5C 1P3GC 4J8XA 5AY8D 2F8ND 5B32B 1KX3D 4XZQD 2NZDA 2F8NB 5AY8B 4KGCB 5GXQC 1KX3B 1T3UA 4XZQB 4QLCC 3AYWA 3LZ1A 2Y2LA 3X1UA 4Z2MG 5CPIA 4XUJD 2BYMA 3A6NA 4ZUXC 4XUJB 4JJNC 3AZKA 5C3IC 4H9QA 4WNNB 2NQBC 2RVQD 3UT9B 3R45A 5GT3A 3AZFA 5CPJC 1P3AB 5B32A 5BS7A 3MGRD 3B0DB 5JA4B 4KUDC 2F8NA 5AY8A 3WTPE 1KX3A 4XZQA 5B24C 5FUGB 4E44A 5B31B 1HQ3C 3P5JB 4DRAA 5B1MC 2HUEB 3UTBD 2YFWA 2G5IC 3X1TB 4XUJA 3KUYB 1M19B 4DRBA 3UTBB 4KGCC 4NE6A 1EQZD 3W97D 1N1JB 5B0ZC 1P34B 3IP4C 3RELB 3O62B 4H9NB 5JA4A 3MVDC 3MGRA 5AV9D 5B31A 3LELC 3AZMD 3UT9C 2F8NH 1ID3D 5AV9B 3REHD 3AZMB 4WJ3C 3MGQD 1P3AC 3REHB 3AZIC 2FJ7B 1TZYC 2Y2MA 3B6GB 3UTBA 5AV5D 1EQZA 4X23C 5B31C 5AV5B 4G91B 3WTPB 2HUEC 3W97A 3RELA 4HGAB 4H9NA 4ZBJC 4J8VD 3B6FC 3X1TC 3C1CC 5CP6D 3KUYC 2CV5D 1M19C 4J8VB 3KFUG 3KWQD 1KX5B 3WA9D 3W99B 5CP6B 2HIOC 3NQJB 3REKB 3NQUB 3H0MC 5AV9A 3AZMA 1P34C 4Z5TC 1ID3A 2DF4C 3RELC 3REHA 3AV1D 3O62C 4CAYB 3MGQA 3AV1B 4WU8D 3VH5T 3MNND 3MNNB 5AV5A 1P3GD 4CSRB 1P3GB 2XD1A 2FJ7C 1P3MC 5GXQD 4QLCD 4H9SC 4J8VA 3B6GC 1ULYA 2CV5A 5CP6A 4QLCB 3KWQA 3WA9A 2RIQA 5CPKC 3NQUA 3TU4C 4YM6C 3WTPC 1U35B 4ZUXD 1P3BC 2F2AC 3A1KA 4JJND 5AVCC 4ZUXB 2NQBD 2Y2JA 3AV1A 5C3IB 1KX5C 3W99C 3C1BC 4WU8A 3MNNA 3REKC 4CSRA 5CPJD 1P3GA 4KUDD 5B24D 2UWXA 5GXQA 5B40C 4QLCA 5B24B 4H9PB 1HQ3D 5F99C 5B1MD 1M18C 4YS3B 1P3PB 4ZUXA 4KGCD 4KHAB 4JJNA 4Z66C 2NQBA 2ZY4A 5B0ZD 3UTAB 2Y2KA 3EG5B 5B0ZB 5CPJA 1U35C 3VH5A 3MVDD 3VH6T 4KUDA 1KX4C 4H9OB 3MVDB 5G49A 5B24A 3LELD 4H9PA 3UT9D 5BT1C 3LELB 1HQ3A 1P3AD 5B1MA 3AZID 1TZYD 5DNMB 3AZIB 2YFVB 4KHAA 3AZNC 3AN2C 1TZYB 5JRGC 1P3IC 4KGCA 3EPHA 4X23D 3AZLB 3B0CT 5B31D 5B1LB 3X1SB 3V9RB 4X23B 5B0ZA 3B6FD 4YS3C 3X1TD 4H9RB 3C1CD 3KUYD 3AZJB 3AFAB 1P3PC 4ZBJB 1M19D 3FDDA 3B6FB 3C1CB 3MVDA 2HIOD 1P3KB 4WNNA 3KXBB 2HIOB 4LD9C 3LELA 1P34D 4NE5A 3UT9A 4Z5TD 5B2JB 3UTAC 4AWLC 3RELD 3O62D 3AV2C 4Z5TB 5B33C 1P3AA 3AZEC 3AZIA 2YFVA 1TZYA 1Q9CA 2G5HC 1Z2CB 2BYKB 5FUGA 3V9RA 4X23A 3H0LC 2FJ7D 1P3MD 5AVBB 3B6GD 3B6FA 5DNMC 1P3MB 3X1TA 3C1CA 1M19A 3KUYA 2Y2QA 3B0BA 5CPKD 3TU4D 3AZLC 1P3FB 2HIOA 3X1SC 5B1LC 4YM6D 3X1VC 3WTPD 1F66C 1S32C 1P3BD 3VH6A 3TU4B 5CPKB 2Y2PA 4YM6B 1N1JA 4UUZB 1P34A 5AVCD 4Z5TA 1P3BB 1B6WA 3AZJC 3O62A 3AFAC 2W8SA 1KX5D 5AVCB 3W99D 3C1BD 1P3KC 5GT0C 3AL0C 3REKD 3KXBC 3C1BB 2JE5A 1B67A 3REIB 4NE3A 5B2JC 3W98B 3KSYA 2FJ7A 1P3MA 3WAAB 5B40D 2Y2HA 4H9SA 4J8WB 4WU9C 3AZGC 3B6GA 5F99D 5B40B 3REJC 5F99B 1P3OB 1M18D 5CPKA 3TU4A 4YM6A 3WTPA 4UUZA 1M18B 1P3BA 5AVBC 3VH5W 2FFFB 5AVCA 4Z66D 5BNXB 5KDMB 1KX5A 3W99A 4Z66B 3C1BA 1BH8B 1P3FC 3NQJA 3WKJC 3REKA 1U35D 2PYOB 5DNNC 1KX4D 4CAYA 3EPJA 3MGPC 1KX4B 5B40A 5BO0B 5BT1D 4DQYB 5F99A 3W96B 2ZY3A 3REIC 1AOIB 1M18A 5B0YB 2Y2IA 3AZHB 3W98C 1P3ID 3AZND 3AN2D 5JRGD 2Y2OA 3WAAC 5KDMA 4J8WC 3AZNB 3AN2B 1P3IB 5JRGB 5B2IC 1F1EA 4Z66A 1BH8A 4J8UB 5E5AB 4Z2MH 1P3OC 4YS3D 2PYOA 1P3PD 4WZSB 1ZLAC 1U35A 3LZ0B 1KX4A 2NZDB 3MGSC 4LD9D 5BO0A 3UTAD 3LZ1B 4LD9B 3X1UB 1WWIA 3AV2D 2LY8A 5AV8C 5B33D 2PYOC 4AWLB 3AZED 3AV2B 1P3LC 2BYMB 5B33B 3A6NB 3AZEB 5BNVB 1R4VA 1P3IA 3AZNA 4M6BA 2VQRA 5JRGA 3AN2A 5GSUB 4H9QB 4R8PC 4WV4B 3W96C 1JFIB 3VH6W 5AV6C 3R45B 1AOIC 5GT3B 5B0YC 5DNMD 3LZ0A 3AZHC 4YS3A 1P3PA 1M1AC 3AZLD 2AROC 5B1LD 3X1SD 3X1VD 1F66D 1S32D 4LD9A 3X1VB 4J8UC 5E5AC 3LJAC 1S32B 3UTAA 1F66B 3AZJD 1H3OB 3AFAD 3AV2A 3LZ0C 5B33A 4J8XC 3B0CW 3AZEA 5BNVA 2YFWB 5GT0D 1P3KD 5GSUA 2NZDC 3KXBD 4H9OA 5GT0B 1TAFB 3AYWC 1JFIA 5B2JD 3LZ1C 2XD5A 3X1UC 2JSSA 5CPIC 4G92C 4WU9D 3AZGD 3A6NC 5DNMA 4WU9B 5GSUC 3MGRB 3REJD 3AZKC 3AZGB 3AZLA 3X1SA 5B1LA 3X1VA 3REJB 1F66A 1S32A 5AVBD 2J8PA 1H3OA 5GT3C 3AZFC 4H9RA 3AZJA 5B32C 3AFAA 5BS7C 1A7WA 5AY8C 1P3FD 1P3KA 5GT0A 3WKJD 1HTAA 1KX3C 1TAFA 4XZQC 3KXBA 3WKJB 1EQZB 5DNND 5B2JA 3W97B 5DNNB 1PZRA 3MGPD 2Y2NA 3EPKA 4WU9A 4XUJC 3MGPB 3AZGA 2BYKA 3REID 3REJA 2RVQC 3W98D 2IO5B 4E45A 5AVBA 3WAAD 1ID3B 4J8WD 5B2ID 3B0DC 3MGQB 5B2IB 3MGRC 1P3OD 1P3FA 3WKJA 1ZLAD 5B32G 2BG1A 1ZLAB 2F8NG 5DNNA 3EPLA 3MGSD 3MGPA 3UTBC 3MGSB 2CV5B 1WWSA 5AV8D 3KWQB 3WA9B 2PYOD 1KU5A 3REIA 1EQZC 5AV8B 1P3LD 3W98A 3W97C 1P3LB 1BH9B 3WAAA 4R8PD 4J8WA 5B2IA 3W96D 5CHLB 4R8PB 5AV6D 1W2EA 4WU8B 1AOID 2DQNC 1P3OA 5B0YD 3AZHD 5AV6B 2IO5C 5AV9C 1M1AD 1ZLAA 3AZMC 4EO5B 1ID3C 3REHC 2AROD 1M1AB 3MGQC 5BNXA 3MGSA 2AROB 5GXQB 5B31G 4J8UD 5E5AD 3LJAD 3A1IA 2ZM5A 5AV8A 5AV5C 4G91C 3LZ0D 3LJAB 4J8XD 1BFMA 4HGAC 1P3LA 1BH9A 2ZY2A 2NZDD 4J8XB 4JJNB 4J8VC 3AYWD 3F6TA 3LZ1D 4R8PA 2NQBB 3X1UD 4UPKA 5CP6C 2JCHA 2CV5C 2ZY5A 3H0RC 2CWEA 3W96A 3KWQC 3AYWB 3WA9C 5AV6A 5CPID 1AOIA 5B0YA 3A6ND 3AZHA 4NFTA 5CPJB 5CPIB 4G92B 1M1AA
chains in the Genus database with same CATH topology
5GSUD 3AZKD 4KUDB 3AV1C 2AROA 3AZKB 5G49B 2Y2GA 2L5AA 2F8NK 4WU8C 5GT3D 4J8UA 5E5AA 3MNNC 3LJAA 3AZFD 1HQ3B 5B1MB 5B32D 3AZFB 4EO5C 1P3GC 4J8XA 5AY8D 2F8ND 5B32B 1KX3D 4XZQD 2NZDA 2F8NB 5AY8B 4KGCB 5GXQC 1KX3B 1T3UA 4XZQB 4QLCC 3AYWA 3LZ1A 2Y2LA 3X1UA 4Z2MG 5CPIA 4XUJD 2BYMA 3A6NA 4ZUXC 4XUJB 4JJNC 3AZKA 5C3IC 4H9QA 4WNNB 2NQBC 2RVQD 3UT9B 3R45A 5GT3A 3AZFA 5CPJC 1P3AB 5B32A 5BS7A 3MGRD 3B0DB 5JA4B 4KUDC 2F8NA 5AY8A 3WTPE 1KX3A 4XZQA 5B24C 5FUGB 4E44A 5B31B 1HQ3C 3P5JB 4DRAA 5B1MC 2HUEB 3UTBD 2YFWA 2G5IC 3X1TB 4XUJA 3KUYB 1M19B 4DRBA 3UTBB 4KGCC 4NE6A 1EQZD 3W97D 1N1JB 5B0ZC 1P34B 3IP4C 3RELB 3O62B 4H9NB 5JA4A 3MVDC 3MGRA 5AV9D 5B31A 3LELC 3AZMD 3UT9C 2F8NH 1ID3D 5AV9B 3REHD 3AZMB 4WJ3C 3MGQD 1P3AC 3REHB 3AZIC 2FJ7B 1TZYC 2Y2MA 3B6GB 3UTBA 5AV5D 1EQZA 4X23C 5B31C 5AV5B 4G91B 3WTPB 2HUEC 3W97A 3RELA 4HGAB 4H9NA 4ZBJC 4J8VD 3B6FC 3X1TC 3C1CC 5CP6D 3KUYC 2CV5D 1M19C 4J8VB 3KFUG 3KWQD 1KX5B 3WA9D 3W99B 5CP6B 2HIOC 3NQJB 3REKB 3NQUB 3H0MC 5AV9A 3AZMA 1P34C 4Z5TC 1ID3A 2DF4C 3RELC 3REHA 3AV1D 3O62C 4CAYB 3MGQA 3AV1B 4WU8D 3VH5T 3MNND 3MNNB 5AV5A 1P3GD 4CSRB 1P3GB 2XD1A 2FJ7C 1P3MC 5GXQD 4QLCD 4H9SC 4J8VA 3B6GC 1ULYA 2CV5A 5CP6A 4QLCB 3KWQA 3WA9A 2RIQA 5CPKC 3NQUA 3TU4C 4YM6C 3WTPC 1U35B 4ZUXD 1P3BC 2F2AC 3A1KA 4JJND 5AVCC 4ZUXB 2NQBD 2Y2JA 3AV1A 5C3IB 1KX5C 3W99C 3C1BC 4WU8A 3MNNA 3REKC 4CSRA 5CPJD 1P3GA 4KUDD 5B24D 2UWXA 5GXQA 5B40C 4QLCA 5B24B 4H9PB 1HQ3D 5F99C 5B1MD 1M18C 4YS3B 1P3PB 4ZUXA 4KGCD 4KHAB 4JJNA 4Z66C 2NQBA 2ZY4A 5B0ZD 3UTAB 2Y2KA 3EG5B 5B0ZB 5CPJA 1U35C 3VH5A 3MVDD 3VH6T 4KUDA 1KX4C 4H9OB 3MVDB 5G49A 5B24A 3LELD 4H9PA 3UT9D 5BT1C 3LELB 1HQ3A 1P3AD 5B1MA 3AZID 1TZYD 5DNMB 3AZIB 2YFVB 4KHAA 3AZNC 3AN2C 1TZYB 5JRGC 1P3IC 4KGCA 3EPHA 4X23D 3AZLB 3B0CT 5B31D 5B1LB 3X1SB 3V9RB 4X23B 5B0ZA 3B6FD 4YS3C 3X1TD 4H9RB 3C1CD 3KUYD 3AZJB 3AFAB 1P3PC 4ZBJB 1M19D 3FDDA 3B6FB 3C1CB 3MVDA 2HIOD 1P3KB 4WNNA 3KXBB 2HIOB 4LD9C 3LELA 1P34D 4NE5A 3UT9A 4Z5TD 5B2JB 3UTAC 4AWLC 3RELD 3O62D 3AV2C 4Z5TB 5B33C 1P3AA 3AZEC 3AZIA 2YFVA 1TZYA 1Q9CA 2G5HC 1Z2CB 2BYKB 5FUGA 3V9RA 4X23A 3H0LC 2FJ7D 1P3MD 5AVBB 3B6GD 3B6FA 5DNMC 1P3MB 3X1TA 3C1CA 1M19A 3KUYA 2Y2QA 3B0BA 5CPKD 3TU4D 3AZLC 1P3FB 2HIOA 3X1SC 5B1LC 4YM6D 3X1VC 3WTPD 1F66C 1S32C 1P3BD 3VH6A 3TU4B 5CPKB 2Y2PA 4YM6B 1N1JA 4UUZB 1P34A 5AVCD 4Z5TA 1P3BB 1B6WA 3AZJC 3O62A 3AFAC 2W8SA 1KX5D 5AVCB 3W99D 3C1BD 1P3KC 5GT0C 3AL0C 3REKD 3KXBC 3C1BB 2JE5A 1B67A 3REIB 4NE3A 5B2JC 3W98B 3KSYA 2FJ7A 1P3MA 3WAAB 5B40D 2Y2HA 4H9SA 4J8WB 4WU9C 3AZGC 3B6GA 5F99D 5B40B 3REJC 5F99B 1P3OB 1M18D 5CPKA 3TU4A 4YM6A 3WTPA 4UUZA 1M18B 1P3BA 5AVBC 3VH5W 2FFFB 5AVCA 4Z66D 5BNXB 5KDMB 1KX5A 3W99A 4Z66B 3C1BA 1BH8B 1P3FC 3NQJA 3WKJC 3REKA 1U35D 2PYOB 5DNNC 1KX4D 4CAYA 3EPJA 3MGPC 1KX4B 5B40A 5BO0B 5BT1D 4DQYB 5F99A 3W96B 2ZY3A 3REIC 1AOIB 1M18A 5B0YB 2Y2IA 3AZHB 3W98C 1P3ID 3AZND 3AN2D 5JRGD 2Y2OA 3WAAC 5KDMA 4J8WC 3AZNB 3AN2B 1P3IB 5JRGB 5B2IC 1F1EA 4Z66A 1BH8A 4J8UB 5E5AB 4Z2MH 1P3OC 4YS3D 2PYOA 1P3PD 4WZSB 1ZLAC 1U35A 3LZ0B 1KX4A 2NZDB 3MGSC 4LD9D 5BO0A 3UTAD 3LZ1B 4LD9B 3X1UB 1WWIA 3AV2D 2LY8A 5AV8C 5B33D 2PYOC 4AWLB 3AZED 3AV2B 1P3LC 2BYMB 5B33B 3A6NB 3AZEB 5BNVB 1R4VA 1P3IA 3AZNA 4M6BA 2VQRA 5JRGA 3AN2A 5GSUB 4H9QB 4R8PC 4WV4B 3W96C 1JFIB 3VH6W 5AV6C 3R45B 1AOIC 5GT3B 5B0YC 5DNMD 3LZ0A 3AZHC 4YS3A 1P3PA 1M1AC 3AZLD 2AROC 5B1LD 3X1SD 3X1VD 1F66D 1S32D 4LD9A 3X1VB 4J8UC 5E5AC 3LJAC 1S32B 3UTAA 1F66B 3AZJD 1H3OB 3AFAD 3AV2A 3LZ0C 5B33A 4J8XC 3B0CW 3AZEA 5BNVA 2YFWB 5GT0D 1P3KD 5GSUA 2NZDC 3KXBD 4H9OA 5GT0B 1TAFB 3AYWC 1JFIA 5B2JD 3LZ1C 2XD5A 3X1UC 2JSSA 5CPIC 4G92C 4WU9D 3AZGD 3A6NC 5DNMA 4WU9B 5GSUC 3MGRB 3REJD 3AZKC 3AZGB 3AZLA 3X1SA 5B1LA 3X1VA 3REJB 1F66A 1S32A 5AVBD 2J8PA 1H3OA 5GT3C 3AZFC 4H9RA 3AZJA 5B32C 3AFAA 5BS7C 1A7WA 5AY8C 1P3FD 1P3KA 5GT0A 3WKJD 1HTAA 1KX3C 1TAFA 4XZQC 3KXBA 3WKJB 1EQZB 5DNND 5B2JA 3W97B 5DNNB 1PZRA 3MGPD 2Y2NA 3EPKA 4WU9A 4XUJC 3MGPB 3AZGA 2BYKA 3REID 3REJA 2RVQC 3W98D 2IO5B 4E45A 5AVBA 3WAAD 1ID3B 4J8WD 5B2ID 3B0DC 3MGQB 5B2IB 3MGRC 1P3OD 1P3FA 3WKJA 1ZLAD 5B32G 2BG1A 1ZLAB 2F8NG 5DNNA 3EPLA 3MGSD 3MGPA 3UTBC 3MGSB 2CV5B 1WWSA 5AV8D 3KWQB 3WA9B 2PYOD 1KU5A 3REIA 1EQZC 5AV8B 1P3LD 3W98A 3W97C 1P3LB 1BH9B 3WAAA 4R8PD 4J8WA 5B2IA 3W96D 5CHLB 4R8PB 5AV6D 1W2EA 4WU8B 1AOID 2DQNC 1P3OA 5B0YD 3AZHD 5AV6B 2IO5C 5AV9C 1M1AD 1ZLAA 3AZMC 4EO5B 1ID3C 3REHC 2AROD 1M1AB 3MGQC 5BNXA 3MGSA 2AROB 5GXQB 5B31G 4J8UD 5E5AD 3LJAD 3A1IA 2ZM5A 5AV8A 5AV5C 4G91C 3LZ0D 3LJAB 4J8XD 1BFMA 4HGAC 1P3LA 1BH9A 2ZY2A 2NZDD 4J8XB 4JJNB 4J8VC 3AYWD 3F6TA 3LZ1D 4R8PA 2NQBB 3X1UD 4UPKA 5CP6C 2JCHA 2CV5C 2ZY5A 3H0RC 2CWEA 3W96A 3KWQC 3AYWB 3WA9C 5AV6A 5CPID 1AOIA 5B0YA 3A6ND 3AZHA 4NFTA 5CPJB 5CPIB 4G92B 1M1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GSU D;  3AZK D;  4KUD B;  3AV1 C;  2ARO A;  3AZK B;  5G49 B;  2L5A A;  2F8N K;  4WU8 C;  5GT3 D;  4J8U A;  5E5A A;  3MNN C;  3LJA A;  3AZF D;  1HQ3 B;  5B1M B;  5B32 D;  3AZF B;  4EO5 C;  1P3G C;  4J8X A;  5AY8 D;  2F8N D;  5B32 B;  1KX3 D;  4XZQ D;  2NZD A;  2F8N B;  5AY8 B;  4KGC B;  5GXQ C;  1KX3 B;  4XZQ B;  4QLC C;  3AYW A;  3LZ1 A;  3X1U A;  4Z2M G;  5CPI A;  4XUJ D;  2BYM A;  3A6N A;  4ZUX C;  4XUJ B;  4JJN C;  3AZK A;  5C3I C;  4H9Q A;  4WNN B;  2NQB C;  2RVQ D;  3UT9 B;  3R45 A;  5GT3 A;  3AZF A;  5CPJ C;  1P3A B;  5B32 A;  5BS7 A;  3MGR D;  3B0D B;  5JA4 B;  4KUD C;  2F8N A;  5AY8 A;  3WTP E;  1KX3 A;  4XZQ A;  5B24 C;  5FUG B;  4E44 A;  5B31 B;  1HQ3 C;  4DRA A;  5B1M C;  2HUE B;  3UTB D;  2YFW A;  3X1T B;  1M19 B;  4XUJ A;  3KUY B;  4DRB A;  3UTB B;  4KGC C;  4NE6 A;  1EQZ D;  3W97 D;  1N1J B;  5B0Z C;  1P34 B;  3REL B;  3O62 B;  4H9N B;  5JA4 A;  3MVD C;  3MGR A;  5AV9 D;  5B31 A;  3LEL C;  3AZM D;  3UT9 C;  2F8N H;  1ID3 D;  5AV9 B;  3REH D;  3AZM B;  3MGQ D;  1P3A C;  3REH B;  3AZI C;  2FJ7 B;  1TZY C;  3B6G B;  3UTB A;  5AV5 D;  1EQZ A;  4X23 C;  5B31 C;  5AV5 B;  4G91 B;  3WTP B;  2HUE C;  3W97 A;  3REL A;  4HGA B;  4H9N A;  4ZBJ C;  4J8V D;  3B6F C;  3X1T C;  3C1C C;  5CP6 D;  3KUY C;  2CV5 D;  1M19 C;  4J8V B;  3KWQ D;  1KX5 B;  3WA9 D;  3W99 B;  5CP6 B;  2HIO C;  3NQJ B;  3REK B;  3NQU B;  5AV9 A;  3AZM A;  1P34 C;  4Z5T C;  1ID3 A;  3REL C;  3REH A;  3AV1 D;  3O62 C;  4CAY B;  3MGQ A;  3AV1 B;  4WU8 D;  3VH5 T;  3MNN D;  3MNN B;  5AV5 A;  1P3G D;  4CSR B;  1P3G B;  2FJ7 C;  1P3M C;  5GXQ D;  4QLC D;  4H9S C;  4J8V A;  3B6G C;  1ULY A;  2CV5 A;  5CP6 A;  4QLC B;  3KWQ A;  3WA9 A;  5CPK C;  3NQU A;  3TU4 C;  4YM6 C;  3WTP C;  1U35 B;  4ZUX D;  1P3B C;  4JJN D;  5AVC C;  4ZUX B;  2NQB D;  3AV1 A;  5C3I B;  1KX5 C;  3W99 C;  3C1B C;  4WU8 A;  3MNN A;  3REK C;  4CSR A;  5CPJ D;  1P3G A;  4KUD D;  5B24 D;  5GXQ A;  5B40 C;  4QLC A;  5B24 B;  4H9P B;  1HQ3 D;  5F99 C;  5B1M D;  1M18 C;  4YS3 B;  1P3P B;  4ZUX A;  4KGC D;  4KHA B;  4JJN A;  4Z66 C;  2NQB A;  5B0Z D;  3UTA B;  5B0Z B;  5CPJ A;  1U35 C;  3VH5 A;  3MVD D;  3VH6 T;  4KUD A;  1KX4 C;  4H9O B;  3MVD B;  5G49 A;  5B24 A;  3LEL D;  4H9P A;  3UT9 D;  5BT1 C;  3LEL B;  1HQ3 A;  1P3A D;  5B1M A;  3AZI D;  1TZY D;  5DNM B;  3AZI B;  2YFV B;  4KHA A;  3AZN C;  3AN2 C;  1TZY B;  5JRG C;  1P3I C;  4KGC A;  4X23 D;  3AZL B;  3B0C T;  5B31 D;  5B1L B;  3X1S B;  3V9R B;  4X23 B;  5B0Z A;  3B6F D;  4YS3 C;  3X1T D;  4H9R B;  3C1C D;  3KUY D;  3AZJ B;  3AFA B;  1P3P C;  4ZBJ B;  1M19 D;  3B6F B;  3C1C B;  3MVD A;  2HIO D;  1P3K B;  4WNN A;  3KXB B;  2HIO B;  4LD9 C;  3LEL A;  1P34 D;  4NE5 A;  3UT9 A;  4Z5T D;  5B2J B;  3UTA C;  4AWL C;  3REL D;  3O62 D;  3AV2 C;  4Z5T B;  5B33 C;  1P3A A;  3AZE C;  3AZI A;  2YFV A;  1TZY A;  1Q9C A;  2BYK B;  5FUG A;  3V9R A;  4X23 A;  2FJ7 D;  1P3M D;  5AVB B;  3B6G D;  3B6F A;  5DNM C;  1P3M B;  3X1T A;  3C1C A;  1M19 A;  3KUY A;  3B0B A;  5CPK D;  3TU4 D;  3AZL C;  1P3F B;  2HIO A;  3X1S C;  5B1L C;  3WTP D;  3X1V C;  4YM6 D;  1F66 C;  1S32 C;  1P3B D;  3VH6 A;  3TU4 B;  5CPK B;  4YM6 B;  1N1J A;  4UUZ B;  1P34 A;  5AVC D;  4Z5T A;  1P3B B;  1B6W A;  3AZJ C;  3O62 A;  3AFA C;  1KX5 D;  5AVC B;  3W99 D;  3C1B D;  1P3K C;  5GT0 C;  3REK D;  3KXB C;  3C1B B;  1B67 A;  3REI B;  4NE3 A;  5B2J C;  3W98 B;  3KSY A;  2FJ7 A;  1P3M A;  3WAA B;  5B40 D;  4J8W B;  4H9S A;  4WU9 C;  3AZG C;  3B6G A;  5F99 D;  5B40 B;  3REJ C;  5F99 B;  1P3O B;  1M18 D;  5CPK A;  3TU4 A;  4YM6 A;  3WTP A;  4UUZ A;  1M18 B;  1P3B A;  5AVB C;  3VH5 W;  5AVC A;  4Z66 D;  5BNX B;  5KDM B;  1KX5 A;  3W99 A;  4Z66 B;  3C1B A;  1BH8 B;  1P3F C;  3NQJ A;  3WKJ C;  3REK A;  1U35 D;  2PYO B;  5DNN C;  1KX4 D;  4CAY A;  3MGP C;  1KX4 B;  5B40 A;  5BO0 B;  5BT1 D;  5F99 A;  3W96 B;  3REI C;  1AOI B;  1M18 A;  5B0Y B;  3AZH B;  3W98 C;  1P3I D;  3AZN D;  3AN2 D;  5JRG D;  3WAA C;  5KDM A;  4J8W C;  3AZN B;  3AN2 B;  1P3I B;  5JRG B;  5B2I C;  1F1E A;  4Z66 A;  1BH8 A;  4J8U B;  5E5A B;  4Z2M H;  1P3O C;  4YS3 D;  2PYO A;  1P3P D;  4WZS B;  1ZLA C;  1U35 A;  3LZ0 B;  1KX4 A;  2NZD B;  3MGS C;  4LD9 D;  5BO0 A;  3UTA D;  3LZ1 B;  4LD9 B;  3X1U B;  1WWI A;  3AV2 D;  2LY8 A;  5AV8 C;  5B33 D;  2PYO C;  4AWL B;  3AZE D;  3AV2 B;  1P3L C;  2BYM B;  5B33 B;  3A6N B;  3AZE B;  5BNV B;  1R4V A;  1P3I A;  3AZN A;  4M6B A;  3AN2 A;  5JRG A;  5GSU B;  4H9Q B;  4R8P C;  4WV4 B;  3W96 C;  1JFI B;  3VH6 W;  5AV6 C;  3R45 B;  1AOI C;  5GT3 B;  5B0Y C;  5DNM D;  3LZ0 A;  3AZH C;  4YS3 A;  1P3P A;  1M1A C;  3AZL D;  2ARO C;  5B1L D;  3X1S D;  3X1V D;  1F66 D;  1S32 D;  4LD9 A;  3X1V B;  4J8U C;  5E5A C;  3LJA C;  1S32 B;  3UTA A;  1F66 B;  3AZJ D;  1H3O B;  3AFA D;  3AV2 A;  3LZ0 C;  5B33 A;  4J8X C;  3B0C W;  3AZE A;  5BNV A;  2YFW B;  5GT0 D;  1P3K D;  5GSU A;  2NZD C;  3KXB D;  4H9O A;  5GT0 B;  1TAF B;  3AYW C;  1JFI A;  5B2J D;  3LZ1 C;  3X1U C;  2JSS A;  5CPI C;  4G92 C;  4WU9 D;  3AZG D;  3A6N C;  5DNM A;  4WU9 B;  5GSU C;  3MGR B;  3REJ D;  3AZK C;  3AZG B;  3AZL A;  3X1S A;  5B1L A;  3X1V A;  3REJ B;  1F66 A;  1S32 A;  5AVB D;  1H3O A;  5GT3 C;  3AZF C;  4H9R A;  3AZJ A;  5B32 C;  3AFA A;  5BS7 C;  1A7W A;  5AY8 C;  1P3F D;  1P3K A;  5GT0 A;  3WKJ D;  1HTA A;  1KX3 C;  1TAF A;  4XZQ C;  3KXB A;  3WKJ B;  1EQZ B;  5DNN D;  5B2J A;  3W97 B;  5DNN B;  3MGP D;  4WU9 A;  4XUJ C;  3MGP B;  3AZG A;  2BYK A;  3REI D;  3REJ A;  2RVQ C;  3W98 D;  2IO5 B;  4E45 A;  5AVB A;  3WAA D;  1ID3 B;  4J8W D;  5B2I D;  3B0D C;  3MGQ B;  5B2I B;  3MGR C;  1P3O D;  1P3F A;  3WKJ A;  1ZLA D;  5B32 G;  1ZLA B;  2F8N G;  5DNN A;  3MGS D;  3MGP A;  3UTB C;  3MGS B;  2CV5 B;  1WWS A;  5AV8 D;  3KWQ B;  3WA9 B;  2PYO D;  1KU5 A;  3REI A;  1EQZ C;  5AV8 B;  1P3L D;  3W98 A;  3W97 C;  1P3L B;  1BH9 B;  3WAA A;  4R8P D;  4J8W A;  5B2I A;  3W96 D;  5CHL B;  4R8P B;  5AV6 D;  4WU8 B;  1AOI D;  1P3O A;  5B0Y D;  3AZH D;  5AV6 B;  2IO5 C;  5AV9 C;  1M1A D;  1ZLA A;  3AZM C;  4EO5 B;  1ID3 C;  3REH C;  2ARO D;  1M1A B;  3MGQ C;  5BNX A;  3MGS A;  2ARO B;  5GXQ B;  5B31 G;  4J8U D;  5E5A D;  3LJA D;  5AV8 A;  5AV5 C;  4G91 C;  3LZ0 D;  3LJA B;  4J8X D;  1BFM A;  4HGA C;  1P3L A;  1BH9 A;  2NZD D;  4J8X B;  4JJN B;  4J8V C;  3AYW D;  3LZ1 D;  4R8P A;  2NQB B;  3X1U D;  2CV5 C;  5CP6 C;  3AYW B;  3W96 A;  2CWE A;  3KWQ C;  3WA9 C;  5AV6 A;  5CPI D;  1AOI A;  5B0Y A;  3A6N D;  3AZH A;  4NFT A;  5CPJ B;  5CPI B;  4G92 B;  1M1A A; 
#chains in the Genus database with same CATH topology
 5GSU D;  3AZK D;  4KUD B;  3AV1 C;  2ARO A;  3AZK B;  5G49 B;  2Y2G A;  2L5A A;  2F8N K;  4WU8 C;  5GT3 D;  4J8U A;  5E5A A;  3MNN C;  3LJA A;  3AZF D;  1HQ3 B;  5B1M B;  5B32 D;  3AZF B;  4EO5 C;  1P3G C;  4J8X A;  5AY8 D;  2F8N D;  5B32 B;  1KX3 D;  4XZQ D;  2NZD A;  2F8N B;  5AY8 B;  4KGC B;  5GXQ C;  1KX3 B;  1T3U A;  4XZQ B;  4QLC C;  3AYW A;  3LZ1 A;  2Y2L A;  3X1U A;  4Z2M G;  5CPI A;  4XUJ D;  2BYM A;  3A6N A;  4ZUX C;  4XUJ B;  4JJN C;  3AZK A;  5C3I C;  4H9Q A;  4WNN B;  2NQB C;  2RVQ D;  3UT9 B;  3R45 A;  5GT3 A;  3AZF A;  5CPJ C;  1P3A B;  5B32 A;  5BS7 A;  3MGR D;  3B0D B;  5JA4 B;  4KUD C;  2F8N A;  5AY8 A;  3WTP E;  1KX3 A;  4XZQ A;  5B24 C;  5FUG B;  4E44 A;  5B31 B;  1HQ3 C;  3P5J B;  4DRA A;  5B1M C;  2HUE B;  3UTB D;  2YFW A;  2G5I C;  3X1T B;  4XUJ A;  3KUY B;  1M19 B;  4DRB A;  3UTB B;  4KGC C;  4NE6 A;  1EQZ D;  3W97 D;  1N1J B;  5B0Z C;  1P34 B;  3IP4 C;  3REL B;  3O62 B;  4H9N B;  5JA4 A;  3MVD C;  3MGR A;  5AV9 D;  5B31 A;  3LEL C;  3AZM D;  3UT9 C;  2F8N H;  1ID3 D;  5AV9 B;  3REH D;  3AZM B;  4WJ3 C;  3MGQ D;  1P3A C;  3REH B;  3AZI C;  2FJ7 B;  1TZY C;  2Y2M A;  3B6G B;  3UTB A;  5AV5 D;  1EQZ A;  4X23 C;  5B31 C;  5AV5 B;  4G91 B;  3WTP B;  2HUE C;  3W97 A;  3REL A;  4HGA B;  4H9N A;  4ZBJ C;  4J8V D;  3B6F C;  3X1T C;  3C1C C;  5CP6 D;  3KUY C;  2CV5 D;  1M19 C;  4J8V B;  3KFU G;  3KWQ D;  1KX5 B;  3WA9 D;  3W99 B;  5CP6 B;  2HIO C;  3NQJ B;  3REK B;  3NQU B;  3H0M C;  5AV9 A;  3AZM A;  1P34 C;  4Z5T C;  1ID3 A;  2DF4 C;  3REL C;  3REH A;  3AV1 D;  3O62 C;  4CAY B;  3MGQ A;  3AV1 B;  4WU8 D;  3VH5 T;  3MNN D;  3MNN B;  5AV5 A;  1P3G D;  4CSR B;  1P3G B;  2XD1 A;  2FJ7 C;  1P3M C;  5GXQ D;  4QLC D;  4H9S C;  4J8V A;  3B6G C;  1ULY A;  2CV5 A;  5CP6 A;  4QLC B;  3KWQ A;  3WA9 A;  2RIQ A;  5CPK C;  3NQU A;  3TU4 C;  4YM6 C;  3WTP C;  1U35 B;  4ZUX D;  1P3B C;  2F2A C;  3A1K A;  4JJN D;  5AVC C;  4ZUX B;  2NQB D;  2Y2J A;  3AV1 A;  5C3I B;  1KX5 C;  3W99 C;  3C1B C;  4WU8 A;  3MNN A;  3REK C;  4CSR A;  5CPJ D;  1P3G A;  4KUD D;  5B24 D;  2UWX A;  5GXQ A;  5B40 C;  4QLC A;  5B24 B;  4H9P B;  1HQ3 D;  5F99 C;  5B1M D;  1M18 C;  4YS3 B;  1P3P B;  4ZUX A;  4KGC D;  4KHA B;  4JJN A;  4Z66 C;  2NQB A;  2ZY4 A;  5B0Z D;  3UTA B;  2Y2K A;  3EG5 B;  5B0Z B;  5CPJ A;  1U35 C;  3VH5 A;  3MVD D;  3VH6 T;  4KUD A;  1KX4 C;  4H9O B;  3MVD B;  5G49 A;  5B24 A;  3LEL D;  4H9P A;  3UT9 D;  5BT1 C;  3LEL B;  1HQ3 A;  1P3A D;  5B1M A;  3AZI D;  1TZY D;  5DNM B;  3AZI B;  2YFV B;  4KHA A;  3AZN C;  3AN2 C;  1TZY B;  5JRG C;  1P3I C;  4KGC A;  3EPH A;  4X23 D;  3AZL B;  3B0C T;  5B31 D;  5B1L B;  3X1S B;  3V9R B;  4X23 B;  5B0Z A;  3B6F D;  4YS3 C;  3X1T D;  4H9R B;  3C1C D;  3KUY D;  3AZJ B;  3AFA B;  1P3P C;  4ZBJ B;  1M19 D;  3FDD A;  3B6F B;  3C1C B;  3MVD A;  2HIO D;  1P3K B;  4WNN A;  3KXB B;  2HIO B;  4LD9 C;  3LEL A;  1P34 D;  4NE5 A;  3UT9 A;  4Z5T D;  5B2J B;  3UTA C;  4AWL C;  3REL D;  3O62 D;  3AV2 C;  4Z5T B;  5B33 C;  1P3A A;  3AZE C;  3AZI A;  2YFV A;  1TZY A;  1Q9C A;  2G5H C;  1Z2C B;  2BYK B;  5FUG A;  3V9R A;  4X23 A;  3H0L C;  2FJ7 D;  1P3M D;  5AVB B;  3B6G D;  3B6F A;  5DNM C;  1P3M B;  3X1T A;  3C1C A;  1M19 A;  3KUY A;  2Y2Q A;  3B0B A;  5CPK D;  3TU4 D;  3AZL C;  1P3F B;  2HIO A;  3X1S C;  5B1L C;  4YM6 D;  3X1V C;  3WTP D;  1F66 C;  1S32 C;  1P3B D;  3VH6 A;  3TU4 B;  5CPK B;  2Y2P A;  4YM6 B;  1N1J A;  4UUZ B;  1P34 A;  5AVC D;  4Z5T A;  1P3B B;  1B6W A;  3AZJ C;  3O62 A;  3AFA C;  2W8S A;  1KX5 D;  5AVC B;  3W99 D;  3C1B D;  1P3K C;  5GT0 C;  3AL0 C;  3REK D;  3KXB C;  3C1B B;  2JE5 A;  1B67 A;  3REI B;  4NE3 A;  5B2J C;  3W98 B;  3KSY A;  2FJ7 A;  1P3M A;  3WAA B;  5B40 D;  2Y2H A;  4H9S A;  4J8W B;  4WU9 C;  3AZG C;  3B6G A;  5F99 D;  5B40 B;  3REJ C;  5F99 B;  1P3O B;  1M18 D;  5CPK A;  3TU4 A;  4YM6 A;  3WTP A;  4UUZ A;  1M18 B;  1P3B A;  5AVB C;  3VH5 W;  2FFF B;  5AVC A;  4Z66 D;  5BNX B;  5KDM B;  1KX5 A;  3W99 A;  4Z66 B;  3C1B A;  1BH8 B;  1P3F C;  3NQJ A;  3WKJ C;  3REK A;  1U35 D;  2PYO B;  5DNN C;  1KX4 D;  4CAY A;  3EPJ A;  3MGP C;  1KX4 B;  5B40 A;  5BO0 B;  5BT1 D;  4DQY B;  5F99 A;  3W96 B;  2ZY3 A;  3REI C;  1AOI B;  1M18 A;  5B0Y B;  2Y2I A;  3AZH B;  3W98 C;  1P3I D;  3AZN D;  3AN2 D;  5JRG D;  2Y2O A;  3WAA C;  5KDM A;  4J8W C;  3AZN B;  3AN2 B;  1P3I B;  5JRG B;  5B2I C;  1F1E A;  4Z66 A;  1BH8 A;  4J8U B;  5E5A B;  4Z2M H;  1P3O C;  4YS3 D;  2PYO A;  1P3P D;  4WZS B;  1ZLA C;  1U35 A;  3LZ0 B;  1KX4 A;  2NZD B;  3MGS C;  4LD9 D;  5BO0 A;  3UTA D;  3LZ1 B;  4LD9 B;  3X1U B;  1WWI A;  3AV2 D;  2LY8 A;  5AV8 C;  5B33 D;  2PYO C;  4AWL B;  3AZE D;  3AV2 B;  1P3L C;  2BYM B;  5B33 B;  3A6N B;  3AZE B;  5BNV B;  1R4V A;  1P3I A;  3AZN A;  4M6B A;  2VQR A;  5JRG A;  3AN2 A;  5GSU B;  4H9Q B;  4R8P C;  4WV4 B;  3W96 C;  1JFI B;  3VH6 W;  5AV6 C;  3R45 B;  1AOI C;  5GT3 B;  5B0Y C;  5DNM D;  3LZ0 A;  3AZH C;  4YS3 A;  1P3P A;  1M1A C;  3AZL D;  2ARO C;  5B1L D;  3X1S D;  3X1V D;  1F66 D;  1S32 D;  4LD9 A;  3X1V B;  4J8U C;  5E5A C;  3LJA C;  1S32 B;  3UTA A;  1F66 B;  3AZJ D;  1H3O B;  3AFA D;  3AV2 A;  3LZ0 C;  5B33 A;  4J8X C;  3B0C W;  3AZE A;  5BNV A;  2YFW B;  5GT0 D;  1P3K D;  5GSU A;  2NZD C;  3KXB D;  4H9O A;  5GT0 B;  1TAF B;  3AYW C;  1JFI A;  5B2J D;  3LZ1 C;  2XD5 A;  3X1U C;  2JSS A;  5CPI C;  4G92 C;  4WU9 D;  3AZG D;  3A6N C;  5DNM A;  4WU9 B;  5GSU C;  3MGR B;  3REJ D;  3AZK C;  3AZG B;  3AZL A;  3X1S A;  5B1L A;  3X1V A;  3REJ B;  1F66 A;  1S32 A;  5AVB D;  2J8P A;  1H3O A;  5GT3 C;  3AZF C;  4H9R A;  3AZJ A;  5B32 C;  3AFA A;  5BS7 C;  1A7W A;  5AY8 C;  1P3F D;  1P3K A;  5GT0 A;  3WKJ D;  1HTA A;  1KX3 C;  1TAF A;  4XZQ C;  3KXB A;  3WKJ B;  1EQZ B;  5DNN D;  5B2J A;  3W97 B;  5DNN B;  1PZR A;  3MGP D;  2Y2N A;  3EPK A;  4WU9 A;  4XUJ C;  3MGP B;  3AZG A;  2BYK A;  3REI D;  3REJ A;  2RVQ C;  3W98 D;  2IO5 B;  4E45 A;  5AVB A;  3WAA D;  1ID3 B;  4J8W D;  5B2I D;  3B0D C;  3MGQ B;  5B2I B;  3MGR C;  1P3O D;  1P3F A;  3WKJ A;  1ZLA D;  5B32 G;  2BG1 A;  1ZLA B;  2F8N G;  5DNN A;  3EPL A;  3MGS D;  3MGP A;  3UTB C;  3MGS B;  2CV5 B;  1WWS A;  5AV8 D;  3KWQ B;  3WA9 B;  2PYO D;  1KU5 A;  3REI A;  1EQZ C;  5AV8 B;  1P3L D;  3W98 A;  3W97 C;  1P3L B;  1BH9 B;  3WAA A;  4R8P D;  4J8W A;  5B2I A;  3W96 D;  5CHL B;  4R8P B;  5AV6 D;  1W2E A;  4WU8 B;  1AOI D;  2DQN C;  1P3O A;  5B0Y D;  3AZH D;  5AV6 B;  2IO5 C;  5AV9 C;  1M1A D;  1ZLA A;  3AZM C;  4EO5 B;  1ID3 C;  3REH C;  2ARO D;  1M1A B;  3MGQ C;  5BNX A;  3MGS A;  2ARO B;  5GXQ B;  5B31 G;  4J8U D;  5E5A D;  3LJA D;  3A1I A;  2ZM5 A;  5AV8 A;  5AV5 C;  4G91 C;  3LZ0 D;  3LJA B;  4J8X D;  1BFM A;  4HGA C;  1P3L A;  1BH9 A;  2ZY2 A;  2NZD D;  4J8X B;  4JJN B;  4J8V C;  3AYW D;  3F6T A;  3LZ1 D;  4R8P A;  2NQB B;  3X1U D;  4UPK A;  5CP6 C;  2JCH A;  2CV5 C;  2ZY5 A;  3H0R C;  2CWE A;  3W96 A;  3KWQ C;  3AYW B;  3WA9 C;  5AV6 A;  5CPI D;  1AOI A;  5B0Y A;  3A6N D;  3AZH A;  4NFT A;  5CPJ B;  5CPI B;  4G92 B;  1M1A A; 
#chains in the Genus database with same CATH homology
 5GSU D;  3AZK D;  4KUD B;  3AV1 C;  2ARO A;  3AZK B;  5G49 B;  2Y2G A;  2L5A A;  2F8N K;  4WU8 C;  5GT3 D;  4J8U A;  5E5A A;  3MNN C;  3LJA A;  3AZF D;  1HQ3 B;  5B1M B;  5B32 D;  3AZF B;  4EO5 C;  1P3G C;  4J8X A;  5AY8 D;  2F8N D;  5B32 B;  1KX3 D;  4XZQ D;  2NZD A;  2F8N B;  5AY8 B;  4KGC B;  5GXQ C;  1KX3 B;  1T3U A;  4XZQ B;  4QLC C;  3AYW A;  3LZ1 A;  2Y2L A;  3X1U A;  4Z2M G;  5CPI A;  4XUJ D;  2BYM A;  3A6N A;  4ZUX C;  4XUJ B;  4JJN C;  3AZK A;  5C3I C;  4H9Q A;  4WNN B;  2NQB C;  2RVQ D;  3UT9 B;  3R45 A;  5GT3 A;  3AZF A;  5CPJ C;  1P3A B;  5B32 A;  5BS7 A;  3MGR D;  3B0D B;  5JA4 B;  4KUD C;  2F8N A;  5AY8 A;  3WTP E;  1KX3 A;  4XZQ A;  5B24 C;  5FUG B;  4E44 A;  5B31 B;  1HQ3 C;  3P5J B;  4DRA A;  5B1M C;  2HUE B;  3UTB D;  2YFW A;  2G5I C;  3X1T B;  4XUJ A;  3KUY B;  1M19 B;  4DRB A;  3UTB B;  4KGC C;  4NE6 A;  1EQZ D;  3W97 D;  1N1J B;  5B0Z C;  1P34 B;  3IP4 C;  3REL B;  3O62 B;  4H9N B;  5JA4 A;  3MVD C;  3MGR A;  5AV9 D;  5B31 A;  3LEL C;  3AZM D;  3UT9 C;  2F8N H;  1ID3 D;  5AV9 B;  3REH D;  3AZM B;  4WJ3 C;  3MGQ D;  1P3A C;  3REH B;  3AZI C;  2FJ7 B;  1TZY C;  2Y2M A;  3B6G B;  3UTB A;  5AV5 D;  1EQZ A;  4X23 C;  5B31 C;  5AV5 B;  4G91 B;  3WTP B;  2HUE C;  3W97 A;  3REL A;  4HGA B;  4H9N A;  4ZBJ C;  4J8V D;  3B6F C;  3X1T C;  3C1C C;  5CP6 D;  3KUY C;  2CV5 D;  1M19 C;  4J8V B;  3KFU G;  3KWQ D;  1KX5 B;  3WA9 D;  3W99 B;  5CP6 B;  2HIO C;  3NQJ B;  3REK B;  3NQU B;  3H0M C;  5AV9 A;  3AZM A;  1P34 C;  4Z5T C;  1ID3 A;  2DF4 C;  3REL C;  3REH A;  3AV1 D;  3O62 C;  4CAY B;  3MGQ A;  3AV1 B;  4WU8 D;  3VH5 T;  3MNN D;  3MNN B;  5AV5 A;  1P3G D;  4CSR B;  1P3G B;  2XD1 A;  2FJ7 C;  1P3M C;  5GXQ D;  4QLC D;  4H9S C;  4J8V A;  3B6G C;  1ULY A;  2CV5 A;  5CP6 A;  4QLC B;  3KWQ A;  3WA9 A;  2RIQ A;  5CPK C;  3NQU A;  3TU4 C;  4YM6 C;  3WTP C;  1U35 B;  4ZUX D;  1P3B C;  2F2A C;  3A1K A;  4JJN D;  5AVC C;  4ZUX B;  2NQB D;  2Y2J A;  3AV1 A;  5C3I B;  1KX5 C;  3W99 C;  3C1B C;  4WU8 A;  3MNN A;  3REK C;  4CSR A;  5CPJ D;  1P3G A;  4KUD D;  5B24 D;  2UWX A;  5GXQ A;  5B40 C;  4QLC A;  5B24 B;  4H9P B;  1HQ3 D;  5F99 C;  5B1M D;  1M18 C;  4YS3 B;  1P3P B;  4ZUX A;  4KGC D;  4KHA B;  4JJN A;  4Z66 C;  2NQB A;  2ZY4 A;  5B0Z D;  3UTA B;  2Y2K A;  3EG5 B;  5B0Z B;  5CPJ A;  1U35 C;  3VH5 A;  3MVD D;  3VH6 T;  4KUD A;  1KX4 C;  4H9O B;  3MVD B;  5G49 A;  5B24 A;  3LEL D;  4H9P A;  3UT9 D;  5BT1 C;  3LEL B;  1HQ3 A;  1P3A D;  5B1M A;  3AZI D;  1TZY D;  5DNM B;  3AZI B;  2YFV B;  4KHA A;  3AZN C;  3AN2 C;  1TZY B;  5JRG C;  1P3I C;  4KGC A;  3EPH A;  4X23 D;  3AZL B;  3B0C T;  5B31 D;  5B1L B;  3X1S B;  3V9R B;  4X23 B;  5B0Z A;  3B6F D;  4YS3 C;  3X1T D;  4H9R B;  3C1C D;  3KUY D;  3AZJ B;  3AFA B;  1P3P C;  4ZBJ B;  1M19 D;  3FDD A;  3B6F B;  3C1C B;  3MVD A;  2HIO D;  1P3K B;  4WNN A;  3KXB B;  2HIO B;  4LD9 C;  3LEL A;  1P34 D;  4NE5 A;  3UT9 A;  4Z5T D;  5B2J B;  3UTA C;  4AWL C;  3REL D;  3O62 D;  3AV2 C;  4Z5T B;  5B33 C;  1P3A A;  3AZE C;  3AZI A;  2YFV A;  1TZY A;  1Q9C A;  2G5H C;  1Z2C B;  2BYK B;  5FUG A;  3V9R A;  4X23 A;  3H0L C;  2FJ7 D;  1P3M D;  5AVB B;  3B6G D;  3B6F A;  5DNM C;  1P3M B;  3X1T A;  3C1C A;  1M19 A;  3KUY A;  2Y2Q A;  3B0B A;  5CPK D;  3TU4 D;  3AZL C;  1P3F B;  2HIO A;  3X1S C;  5B1L C;  4YM6 D;  3X1V C;  3WTP D;  1F66 C;  1S32 C;  1P3B D;  3VH6 A;  3TU4 B;  5CPK B;  2Y2P A;  4YM6 B;  1N1J A;  4UUZ B;  1P34 A;  5AVC D;  4Z5T A;  1P3B B;  1B6W A;  3AZJ C;  3O62 A;  3AFA C;  2W8S A;  1KX5 D;  5AVC B;  3W99 D;  3C1B D;  1P3K C;  5GT0 C;  3AL0 C;  3REK D;  3KXB C;  3C1B B;  2JE5 A;  1B67 A;  3REI B;  4NE3 A;  5B2J C;  3W98 B;  3KSY A;  2FJ7 A;  1P3M A;  3WAA B;  5B40 D;  2Y2H A;  4H9S A;  4J8W B;  4WU9 C;  3AZG C;  3B6G A;  5F99 D;  5B40 B;  3REJ C;  5F99 B;  1P3O B;  1M18 D;  5CPK A;  3TU4 A;  4YM6 A;  3WTP A;  4UUZ A;  1M18 B;  1P3B A;  5AVB C;  3VH5 W;  2FFF B;  5AVC A;  4Z66 D;  5BNX B;  5KDM B;  1KX5 A;  3W99 A;  4Z66 B;  3C1B A;  1BH8 B;  1P3F C;  3NQJ A;  3WKJ C;  3REK A;  1U35 D;  2PYO B;  5DNN C;  1KX4 D;  4CAY A;  3EPJ A;  3MGP C;  1KX4 B;  5B40 A;  5BO0 B;  5BT1 D;  4DQY B;  5F99 A;  3W96 B;  2ZY3 A;  3REI C;  1AOI B;  1M18 A;  5B0Y B;  2Y2I A;  3AZH B;  3W98 C;  1P3I D;  3AZN D;  3AN2 D;  5JRG D;  2Y2O A;  3WAA C;  5KDM A;  4J8W C;  3AZN B;  3AN2 B;  1P3I B;  5JRG B;  5B2I C;  1F1E A;  4Z66 A;  1BH8 A;  4J8U B;  5E5A B;  4Z2M H;  1P3O C;  4YS3 D;  2PYO A;  1P3P D;  4WZS B;  1ZLA C;  1U35 A;  3LZ0 B;  1KX4 A;  2NZD B;  3MGS C;  4LD9 D;  5BO0 A;  3UTA D;  3LZ1 B;  4LD9 B;  3X1U B;  1WWI A;  3AV2 D;  2LY8 A;  5AV8 C;  5B33 D;  2PYO C;  4AWL B;  3AZE D;  3AV2 B;  1P3L C;  2BYM B;  5B33 B;  3A6N B;  3AZE B;  5BNV B;  1R4V A;  1P3I A;  3AZN A;  4M6B A;  2VQR A;  5JRG A;  3AN2 A;  5GSU B;  4H9Q B;  4R8P C;  4WV4 B;  3W96 C;  1JFI B;  3VH6 W;  5AV6 C;  3R45 B;  1AOI C;  5GT3 B;  5B0Y C;  5DNM D;  3LZ0 A;  3AZH C;  4YS3 A;  1P3P A;  1M1A C;  3AZL D;  2ARO C;  5B1L D;  3X1S D;  3X1V D;  1F66 D;  1S32 D;  4LD9 A;  3X1V B;  4J8U C;  5E5A C;  3LJA C;  1S32 B;  3UTA A;  1F66 B;  3AZJ D;  1H3O B;  3AFA D;  3AV2 A;  3LZ0 C;  5B33 A;  4J8X C;  3B0C W;  3AZE A;  5BNV A;  2YFW B;  5GT0 D;  1P3K D;  5GSU A;  2NZD C;  3KXB D;  4H9O A;  5GT0 B;  1TAF B;  3AYW C;  1JFI A;  5B2J D;  3LZ1 C;  2XD5 A;  3X1U C;  2JSS A;  5CPI C;  4G92 C;  4WU9 D;  3AZG D;  3A6N C;  5DNM A;  4WU9 B;  5GSU C;  3MGR B;  3REJ D;  3AZK C;  3AZG B;  3AZL A;  3X1S A;  5B1L A;  3X1V A;  3REJ B;  1F66 A;  1S32 A;  5AVB D;  2J8P A;  1H3O A;  5GT3 C;  3AZF C;  4H9R A;  3AZJ A;  5B32 C;  3AFA A;  5BS7 C;  1A7W A;  5AY8 C;  1P3F D;  1P3K A;  5GT0 A;  3WKJ D;  1HTA A;  1KX3 C;  1TAF A;  4XZQ C;  3KXB A;  3WKJ B;  1EQZ B;  5DNN D;  5B2J A;  3W97 B;  5DNN B;  1PZR A;  3MGP D;  2Y2N A;  3EPK A;  4WU9 A;  4XUJ C;  3MGP B;  3AZG A;  2BYK A;  3REI D;  3REJ A;  2RVQ C;  3W98 D;  2IO5 B;  4E45 A;  5AVB A;  3WAA D;  1ID3 B;  4J8W D;  5B2I D;  3B0D C;  3MGQ B;  5B2I B;  3MGR C;  1P3O D;  1P3F A;  3WKJ A;  1ZLA D;  5B32 G;  2BG1 A;  1ZLA B;  2F8N G;  5DNN A;  3EPL A;  3MGS D;  3MGP A;  3UTB C;  3MGS B;  2CV5 B;  1WWS A;  5AV8 D;  3KWQ B;  3WA9 B;  2PYO D;  1KU5 A;  3REI A;  1EQZ C;  5AV8 B;  1P3L D;  3W98 A;  3W97 C;  1P3L B;  1BH9 B;  3WAA A;  4R8P D;  4J8W A;  5B2I A;  3W96 D;  5CHL B;  4R8P B;  5AV6 D;  1W2E A;  4WU8 B;  1AOI D;  2DQN C;  1P3O A;  5B0Y D;  3AZH D;  5AV6 B;  2IO5 C;  5AV9 C;  1M1A D;  1ZLA A;  3AZM C;  4EO5 B;  1ID3 C;  3REH C;  2ARO D;  1M1A B;  3MGQ C;  5BNX A;  3MGS A;  2ARO B;  5GXQ B;  5B31 G;  4J8U D;  5E5A D;  3LJA D;  3A1I A;  2ZM5 A;  5AV8 A;  5AV5 C;  4G91 C;  3LZ0 D;  3LJA B;  4J8X D;  1BFM A;  4HGA C;  1P3L A;  1BH9 A;  2ZY2 A;  2NZD D;  4J8X B;  4JJN B;  4J8V C;  3AYW D;  3F6T A;  3LZ1 D;  4R8P A;  2NQB B;  3X1U D;  4UPK A;  5CP6 C;  2JCH A;  2CV5 C;  2ZY5 A;  3H0R C;  2CWE A;  3W96 A;  3KWQ C;  3AYW B;  3WA9 C;  5AV6 A;  5CPI D;  1AOI A;  5B0Y A;  3A6N D;  3AZH A;  4NFT A;  5CPJ B;  5CPI B;  4G92 B;  1M1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...