3MOJB

Structure of the rna binding domain of the bacillus subtilis yxin protein complexed with a fragment of 23s ribosomal rna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
75
structure length
75
Chain Sequence
MKLYFNGGKKKKIRAVDFVGTIAKIDGVSADDIGIITIMDNASYVEILNGKGPHVLKVMKNTTVKGKQLKVNKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the RNA binding domain of a DEAD-box helicase bound to its ribosomal RNA target reveals a novel mode of recognition by an RNA recognition motif.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Rna binding protein/rna
molecule keywords RNA (69-MER)
total genus 17
structure length 75
sequence length 75
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03880 DbpA DbpA RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mojB00
2VOPA 1R8PA 1N52B 3NMRA 1M5OC 2D9PA 1YWXA 1UW4A 2EK1A 3SMZA 3G96A 3CC7S 2MY8A 3EGNA 1VC0A 2RNEA 2CPDA 2CPXA 2DNLA 2RQ4A 1HA1A 3CCJS 2B0GA 3MD3A 2MQQA 2KM8C 2PEHA 4BS2A 5LJ3Y 1BY9A 2J8AA 5LSOA 2MQNA 2DB1A 1UAWA 2EVZA 3CMES 3G9CA 5HL7Q 1Q86T 1WG5A 3DXBA 4V19X 2V94A 2DH7A 4ZKAA 4CQ1A 1KOHA 1WHWA 1X5TA 2MKCA 1WF2A 2K3KA 3MUTP 1OIAA 1OPIA 5IM0B 3S7RA 4OZ0A 3ZZZA 3HHNB 3IWNC 2OTJS 1P1TA 3SDEB 3S6EA 3MD1A 4CH0S 5LJ5Y 4LMZA 2RQCA 3R1LA 1YI2S 2DH9A 4UQTA 2LEAA 2LYVA 2CPYA 1X5PA 2CQHA 1PGZA 2E5HA 2OSQA 2JVRA 2A3JA 1DBDA 3P3DA 1Q82T 4EGLA 3MUVP 4YUDA 2MQOA 2LA4A 2YH0A 3EGZA 4WFBQ 2MPUA 3UE2A 2KVIA 2NLWA 1ZZFA 2AYBA 2OSRA 4PRFA 1M90T 2ZJPQ 5IM0A 2LMIA 4YOEA 2CQ3A 4Y0FA 1X4FA 3SDEA 2E5JA 2MSSA 2DHXA 2D9OA 2M4MA 3N9UC 3CPWR 5MLCV 2CQDA 1Q81T 1WHVA 1YJ9S 1OO0B 2MKHA 2HGMA 1X4CA 4TLQA 1U1QA 3MOJB 2LQ5A 2ZJRQ 4C7QA 4FXWA 3UWTA 3CC2S 2DISA 5IQQA 2CQ4A 3CCRS 1YITS 3K0JA 2DNRA 1WF1A 1W2BR 1XN9A 2RT3A 1VQ6S 2FY1A 5DDPC 3CULA 1KOOA 2J76E 2DITA 2QEXS 1DRZA 4PKDB 2DO4A 2FHOB 5DM6Q 3Q2TC 1A7GE 5GVQA 1X5OA 2PE8A 2LA6A 2ERRA 4CIOA 1M5VC 2G4BA 1VQ7S 2CPJA 1JJ4A 3Q2SC 1HD0A 3TP2A 3CUNA 3CCQS 2U2FA 3CXCR 2N82B 5LXRA 1JMTA 3MURP 2YH1A 2ZJQQ 1N88A 2HZCA 1QVGR 3B4DA 3RW7A 2M2BA 2LKZA 5DDRC 2XS7A 2L41A 3CCES 1WHXA 3B4MA 4C4WA 3TYTA 3CC4S 1VC6A 1SJQA 1U6FA 2DGTA 2KFYA 2CPFA 2DNMA 2XS5A 3G8SA 2DNNA 4M5DB 3S01A 1VQ4S 5HO4A 4PR6A 3CCSS 3I55S 2DIVA 3HI9A 3V4MA 3VAIA 1N54B 1JJ2R 4RU2A 2MZTA 1FT8A 3G71S 1N8RT 2KT5A 2MKSA 1M1KT 1YTYA 4ERDA 2DNYA 4P6QA 3VAJA 4IOCQ 2CQBA 2UP1A 2Q79A 1NU4A 1D9AA 3FEYB 1QM9A 1SJRA 2KXFA 1D8ZA 3U1MA 4Y00A 1VQ5S 4ED5A 1WF0A 1SJ3P 1NO8A 1H2UX 2M88A 4W90B 3UCUP 1U1KA 3VALA 1F9FA 4Z2XA 2CPIA 2CQPA 2DNGA 4LIRA 2CQGA 2GO9A 2X1FA 3S8SA 5IFMA 1VQ9S 3BS9A 4A8XA 2DHAA 3CCUS 3CD6S 1IQTA 2HGLA 5GADU 2HYIB 2M8DB 4IUFA 4QPTA 2MJUA 3G4SS 1ZZNA 5DDOC 2KRRA 3P5TL 2MZ1A 3G8TA 2J0SD 1M5PC 5CXTA 5CYJA 1WTBA 2F3JA 5GAGU 2M8HA 4WKRA 2MKIA 1VC5A 4LJMA 2E44A 3NS5A 4CH1A 2N3LA 3JB9k 2G0CA 3D2WA 2DNZA 1YHQS 5JVGQ 1O0PA 2MZQA 2CQ1A 3DLLQ 2CJKA 4QQBA 1VQMS 2KG0A 2XNRA 1FO1A 1DHMA 1WG4A 2KXHA 2MYFA 3MUMP 5LXYA 1HD1A 3CTRA 1X4AA 1YIJS 2F9DA 1U1OA 1VQNS 3UCGA 3J7YU 3MI7X 3J7ZT 2XB2D 2YTCA 4UY8T 2MMYA 3NS6A 2CQIA 2QFJA 1R8HA 2J0QD 1URNA 2KH9A 1WEZA 1WI8A 2DGSA 1SXLA 3VAGA 5FJ4A 2JRSA 5D78A 2VODA 5DDQC 4W92B 3LQVA 1WG1A 2XNQA 2DO0A 1WEXA 3CCVS 2KYXA 3US5A 2I38A 1U1NA 1X4DA 2HVZA 1VQPS 5GAEU 1RK8A 2U1AA 1G2EA 5CA5A 2DGWA 2MGZB 1A9NB 3I56S 2L9WA 1U1PA 3OW2R 2AYMA 3L3CA 4WF9Q 2FPHX 2LXUA 2OTLS 3BO4A 1AUDA 2MQLA 3UD3P 2XS2A 2N3OA 4F02A 3SXLA 2ADCA 1VQLS 3H2VE 1FXLA 1X4EA 4OZ1A 2SXLA 1KQSR 1WHYA 2M0GB 1K73T 2DGXA 2KU7A 2DGUA 2MY7A 2AYGA 1X4HA 2DGQA 2JX2A 2M9KA 2DHSA 2DIUA 1ZH5A 2E5GA 3R27A 4C0OC 1WEYA 2L08A 1VQKS 1Q7YT 2RUGA 1DZ5A 3U1LA 1H2VZ 2AD9A 2MKJA 2JVOA 1WELA 1VQOS 3LPYA 5D77A 2RVJA 3CCLS 2KN4A 3FEXB 2DNOA 2MJNA 1K8AT 1VBYA 1OWXA 2MQMA 2VOOA 2DHGA 1U1MA 1UFWA 4IOAQ 2KRBA 3VAHA 2OIHA 1U1LA 1PO6A 4WIIA 2MB0B 4F25A 2LEBA 3P6YC 1B7FA 1JJHA 2OJ3A 4WCEQ 5JVHQ 2MZSA 1U6BA 3P49B 2X1AA 3THTA 3EX7B 4FXVA 1L3KA 2F9JA 2G1DA 2DNKA 3TO8A 3BO3A 2KI2A 3IRWP 2DGOA 2YKAA 2MHNA 5ITHA 1YJWS 3CF5Q 2CPHA 2MXYA 2XSFA 2WBRA 3UCZP 2RRAA 3NNAA 2MGZA 2RS2A 1X4GA 2KM8B 3G6ES 2DNHA 3BO2A 5DM7Q 2LXIA 5EN1A 3VAKA 3CCMS 3ULHA 5BJRA 2DH8A 1M5KC 3H2UB 2DNPA 1S79A 1KC8T 2M7SA 2KXNB 3NNCA 3VAFA 4WFAQ 2RS8A 2JWNA 5DETA 2RRBA 1X5SA 2CPEA 1WWHA 4U67Q 1FJCA 3MDFA 3PIOQ 2I2YA 3ZZYA 3RW6A 1VBZA 2QA4S 2CPZA 2M52A 1UP1A 2M70A 2MKKA 1YJNS 3NNHA 2NZ4A 2BOPA 3R1HA 4WFNQ 2HGNA 2MZRA 3VF0B 1H6KX 3THPA 4TU7A 2EK6A 2RU3A 4QU7A 2X1GA 1FJ7A 1SJFA 2CQ2A 2K8GA 4TU8A 1WI6A 2X1BA 4F26A 1FHTA 1VBXA 1SJ4P 2YWKA 2N7CA 2D3OR 5GAHU 2MZJA 2BZ2A 1FNXH 2MQPA 2KHCA 3VAMA 4J5OA 2FC8A 4TU9A 2CQ0A 5LSLA 3CMAS 2LECA 2GHPA 2DGVA 1KD1T 1U2FA 1FJEB 3MXHP 2LCWA 1X0FA 4YB1P 1X4BA 2CQCA 1RKJA 1CVJA 4IO9Q 1VQ8S 3UD4P 2DK2A 2AYEA 2DNQA 5H1SV 1QVFR 2ADBA 1K9MT 1S72S 3PIPQ 2FC9A 1NJIT 1HL6A 2VONA 3BEGB 1U1RA 4QU6A 5GMKa 1H2TZ 2MSTA 2E5IA 2KG1A 2O3DA 1P27B
chains in the Genus database with same CATH superfamily
3R2CJ 4DR7F 4LBHA 1R8PA 1ZAXA 1M5OC 2C2MB 2HNYB 1QAJA 2EK1A 1RBAA 4IRDA 1TR0A 3GZ7A 3N79A 4EZ9A 4KHPJ 1IBMJ 1S6PA 3GPAA 3FRZA 2RHSB 4DZ6A 3Q24A 1FRHA 2W24A 4KY3A 2WOMB 1HA1A 2QYCA 3LALA 4FF3A 3FC9A 2MQQA 1PILA 2CAJA 3MECB 4OI1A 2DCUB 4KR0B 2DYAA 2XYPB 4DV0J 2CNLB 2OELA 1FD2A 2PEBA 2P9EA 2LDIA 1Q1KA 3MCSA 5KG7A 5LSOA 4X4NA 2MQNA 4NWBA 4ZS6A 2ZOGA 1UAWA 1VK3A 1DAXA 1N36J 1ICEB 1RAJA 2QX0A 1RAFB 3CJQA 3D3CJ 3FMWA 5E3AA 1EQMA 2YNHB 5ETQA 2CVEA 4YS2A 2XC9A 3G9CA 2ZH8A 4TY8A 4O4GA 2BE2A 4NPOA 4C0HA 2WZ1A 1LFPA 1NZ8A 4DR4J 4D3HA 1XMQF 4I69A 3LAKA 2BRLA 3DXBA 3K2YA 1HMVA 1MMDA 1U6ZA 3ZTOA 1SJFA 2RQKA 4KFBA 1RWKB 1SV5A 2DH7A 4AL6A 2UVUA 3TA1A 1AXQA 2YWFA 2IA6A 3UR3C 4I0WA 1F2HA 1I94F 2QJ3A 1PJ5A 1JNZB 1HBOB 2K3KA 1D3WA 3MUTP 2IY5B 5IM0B 4JI3F 1MN7A 4DR6J 2RKIB 4OZ0A 3GB0A 1S1WA 2D7SA 4ANDA 4X64F 2ASJA 4I56A 2KJWA 3Q23A 1T05B 2VFUA 2VFTA 2WVFA 3M1VA 3W65A 1T11A 5KFZA 4CDIA 6FDRA 1TAQA 5C2GA 4URGA 3RRHA 3S6EA 2R7TA 4OLOA 3BZQA 1U0HB 3KLHB 1Q8IA 3H4DA 1R31A 4C0BA 2QTWA 5LJ5Y 1UETA 4DV3J 5D3GB 2HG4A 3R1LA 1HYSA 1YI2S 2DH9A 3GSDA 4UQTA 5DG8A 2LEAA 4GC6A 4B3TJ 1LWCB 3TAMA 4U7UK 2CQHA 2LEPA 3GFZA 5J2QA 1PJ6A 1J2VA 3HT0A 4O3NA 2P8IA 1PGZA 2QE5A 1UPPA 3P3DA 4OI4A 1R8AA 4TYAA 5L39A 4X65F 2EFVA 5KTQA 4DL7A 2DJWA 3MCOA 4B9SA 1IVZA 3LWLA 1TK5A 5D4LA 3QAEA 4JI2F 1QLNA 3MCNA 2CA9A 5HBMA 2P5VA 2CXEA 5H9FJ 2FLLA 4L6V3 4B3TF 4GKJF 3DHWC 2PI5A 4ZK7M 2KVIA 4ID5B 4K5SA 3LP1A 3TA2A 2VG7A 1QE1B 1TL1A 2JDJA 3ZZOA 1Z4UA 1S57A 1GT8A 4NLRA 1NDCA 3C19A 4M5DA 5B08A 4MK7A 3B6BA 2V2VA 1C0TA 2J8SA 4PRFA 1RKIA 2H54B 4RW9A 1RE1B 1R0AB 4QWDA 2GQQA 4PXEA 4DSIA 1F3VA 4X64J 3GCXP 1FF2A 1UFKA 3EMTA 3ET6B 4CTAA 1TUGB 4DWIA 2QL5B 4JI3J 1RT3B 1X4FA 3D4JA 3PJ9A 5FDLA 4R0EA 5K5MA 2Q6CA 1FKPB 2XMJA 3T1HF 2DPJA 2OHDA 3GIMA 4K8RA 4MKBA 1GQEA 2PIIA 1W26A 3TEGA 4ECYA 2JHEA 3AD8C 2ZM6J 1YZ6A 3PX4A 1XMQJ 3PW0A 1RAEB 3B54A 2G1HA 1CJVA 4FDFA 4S0MA 2NPIA 2EPIA 3BR8A 3RBZA 9ATCB 1OO0B 3IA0A 5A8RB 2NR0A 1TZ0A 3GG1A 3M6XA 2XMMA 1RHMB 2HGMA 4RW9B 2YNHA 3CJ5A 1VBKA 2EI5A 3DRSB 1S97A 4RNFA 4LREA 3I4PA 1JXVA 2CDRB 1KNZA 3W9JA 4ZN1A 3PYGA 4V1Ak 4K4WA 4ZCKA 3UWTA 3CC2S 2DISA 3LP1B 3CCRS 3K0JA 1WF1A 3N6LA 5CZVA 5E5NA 2O1PA 2R2UA 8ATCB 2FJVA 4XPCA 4CO3A 3CWJA 5GMDA 3C14B 3ENWA 5DDPC 1TL3A 4LSNA 4OHXA 2DY1A 4FYXB 1IBMF 4DN0A 1DRZA 4PG8A 1RT6A 5GVQA 1U2RA 1N34J 4C3LA 3A8IA 2V4QA 1HPZB 2V9KA 3OSPA 3NMAA 4DSKA 3KHGA 4FXDA 2EFPA 3AH6A 1VQ7S 2NQPA 2FHJD 2QV6A 3QGHA 1ROFA 3TP2A 4FNIA 4QBUA 3BF4A 3CCQS 2B4PA 3GV8B 1NSPA 4KH0B 5EWEA 3HZGA 3M1VB 5AE3A 2ZD1B 4ZMMA 5IXUA 2HZCA 1QVGR 4QIVA 2A6MA 4WFYA 4KB7A 4GMKA 3IP0A 3RW7A 3IWLA 3TZWA 1U49A 4UT4A 2M2BA 3MR6A 4DZDA 1NSKL 1Y3KA 3MPVA 5D4NA 3DHXA 3W61A 3KUGA 4LSZB 3JTPA 3VZIA 3TUIC 2XMAA 2BJ8A 1R8CA 1F6TA 1YRXA 2FZCB 4USJC 1FJGF 4NXNJ 4KQZA 4OJGA 3O1LA 3P96A 1U6FA 4EEYA 5BYSA 3VGVA 2VQFF 1NXIA 1G3OA 3KJFB 4I7FA 3S01A 1VQ4S 3CJRA 3I55S 3MCMA 3GCWP 2B4UA 3EXYA 4I6AA 5L8RC 3TI0A 1FD8A 1FVQA 4LF7F 4Q8EA 3HI9A 4Z37A 1HNVA 2FVCA 5M2UA 3K7RA 2LP4A 2HK2A 2VFRA 2XMWA 3AHPA 4P10A 5KFGA 4RWXA 3CJ8A 5HJXA 4Z7CA 1T9YA 1N8RT 2AIRB 3RB4A 2OMOA 5C25A 5F8GA 4A8YA 3AOBA 1NM2A 2DNYA 4RW4A 2JLGA 4IOCQ 5ETRA 3VR1A 4ERDA 2CQBA 1RT7B 2Q79A 1NU4A 1GNKA 3AT1B 4Z7YA 3OJUA 1D9AA 2OFGX 4ZVOB 3PKMA 4QCLA 3PR4A 1D8ZA 3CSKA 4AE5A 4Q7AA 4H4KA 4ZVGA 2HSEB 3IRXA 4F4AA 2AW0A 4ALZA 4NLQA 3KHLA 1WF0A 3BPSP 3IO1A 4LVNP 3OVBA 3J7A1 1NO8A 3CD5A 3HHDA 4W90B 3O2IA 3DRSA 5KFHA 3VALA 1BQNB 1SIZA 3K17A 3MTJA 2CQPA 2WVCA 1B64A 1U09A 2ZWOA 1YLXA 1VRTB 3GSIA 4RUBA 4ZHRA 3S8SA 1YGYA 4C8KA 2KZMA 4HT5A 3MR2A 3CD6S 2ATCB 1K44A 1REVB 3M8ZA 3NXZA 1I6JA 1QAIA 3HHLC 3KUHA 2RE1A 5KFOA 2HYIB 1OMSA 3KK3A 5KT6A 1S1WB 2ASLA 3G6YA 3D6TB 4WTYA 4ZVSB 1KN6A 3NP5A 5J2PB 1UVJA 5LT5A 4X4VA 1EQ0A 4WE1B 5HI7A 2RUSA 2RHQB 3MEEB 1JLAA 3D66A 5CYJA 2H4YB 3OTBA 2VBXA 2HNDB 2M8HA 4ETXA 1Q16B 3K59A 1VC5A 3PO5A 2ZE2B 3K8VA 4C8MA 2EC0A 4L75A 4LJMA 3NS5A 3UQSA 3PYDA 3HX9A 3N0VA 3O6QA 3D2WA 1RBLA 1NDPA 1XQIA 1U7LA 3HZEA 4O44B 2BQRA 1WKJA 2PSZA 2OD6A 4BWMA 1NK8A 2EFGA 1F1BB 2KG0A 2CJKA 1FO1A 4LRAA 2C3PA 1X31C 2JZ5A 5CYQB 4KC5A 3V6DB 1RP5A 2MYFA 2E29A 3MUMP 4B9MA 2ZVSA 5L38A 3KG4A 4MK8A 1UA0A 1X4AA 3ZNJ1 1YIJS 2FJWA 1OQ3A 3RBEA 5F8MA 2HVIA 3VZHA 4X4OA 2IM0A 1NLKL 4HH0A 4LSLA 1V5IB 2QN6B 3W2VA 2LQJA 3IAS9 2VJUA 4AQYJ 3J7ZT 3K8WA 3BDPA 2QG9B 1MMNA 3NS6A 1HARA 2YWWA 3DGPB 2UVVA 4QYZK 1JLQA 4ZDNA 2BKNA 2H5JB 3HD1A 4DBQA 5DLGA 4DSFA 2Z57B 3C16B 1WNEA 1N48A 3EVOA 3HVWA 3OXLA 2HHXA 3WDOA 2DGSA 1SXLA 2VFSA 2O01C 3VAGA 1AFIA 4ZLPA 5FJ4A 2ZH4A 3Q8YA 2W1BA 5I4MA 5A2QU 1ZTTA 1DTQA 5DDQC 5T7LA 4W92B 4DUYJ 1WG1A 3W2VB 4USHA 1YSJA 4LBPA 4DV7J 4YR0A 4TQSA 2XYGB 4PAAA 2BQ3A 2I38A 3B78A 1VMBA 2DEJA 2YKNB 1VQPS 1TQLA 2YXLA 3CT9A 3T1AA 2Z2YB 3I87A 4PXBA 3AFGA 1RU1A 3HJVA 2BKOA 4MMOA 3I56S 3R97A 6AT1B 2JEJA 2OKQA 5KFJA 3L3CA 1REGX 2LXUA 5CHCB 3MECA 2GNKA 4WF9Q 3R5DA 8AT1B 3DN9A 1NKBA 3UDLA 1GMUA 1H74A 1Q4RA 2VZ9A 3J81Y 3WBZA 4B9LA 1SKUB 1HWKA 4ZIVA 3I32A 1OS5A 2VKZG 2N3OA 1KSPA 1U2CA 5E33A 3SXLA 4DX7A 2ADCA 1IR1A 1S6OA 3H2VE 3VGSA 2OGUA 2DT9A 1FFGB 2JLEA 2GW8A 3FSYA 3ZFVA 3ZTPA 2R8GA 2HHHF 1WORA 2M0GB 3QIPA 3UR0A 2ZH7A 2NUHA 2K2PA 4OZ2A 2AEJA 1Q8KA 1K1QA 3P45B 5J2NA 1JLFA 2M9KA 4ZN3A 2IIHA 4B3SJ 3QJPA 4OYAA 1L3TA 5KG5A 2QLJB 3QAUA 2DR9A 3AB2B 1R6YA 1IUJA 2VA2A 1K0VA 2DKOB 2FJBB 1WEYA 4ZVQB 1Q5YA 4GVBB 3GYXB 1GMWA 2GGPA 3DRPB 1RU2A 2HZAA 2IA0A 3AXMA 1MWZA 4A8OA 5GAEI 2AD9A 2CNOB 3P5BP 1N56A 4DPYA 4QWCA 2JVOA 2GJFA 2AP6A 1VQOS 2HHQA 3Q22A 2GX8A 1GH8A 3LPYA 5D77A 1J27A 2RVJA 4TY9A 5KFSA 4DFPA 2PFFB 1DQ9A 3MPYA 4FNHA 2JC0A 3V81B 3J80Y 1VYAA 1FDDA 4CO0A 2CWKA 2I5JA 4OJ1A 5LMNF 1UFWA 2BM0A 4IOAQ 4URSA 2UZAA 1HPZA 1HQUB 3BH7B 3HK2A 2GC8A 3Q86A 2MB0B 1TU0B 3LGHA 4F25A 2ZH2A 1B7FA 4ITSA 3JSBA 2HFZA 1I3OB 1AYEA 4ECUA 1HWUA 1JLBA 2FHKA 2MZSA 1MWYA 3OUYB 1U6BA 4OMFG 2X1AA 2WVEA 5J1NA 1PYOB 3P49B 2JEIA 1HQ2A 3KUEA 4CP5A 4EMDA 3EX7B 1VCTA 4JV2A 2XZWA 1NDKA 1HWLA 2QMWA 3KDOA 2RIJA 4JI1F 3AQOA 3OFGA 1HBMB 1HBNB 4Q0BB 3FGVA 4I6WA 2DNKA 3NLCA 4ED2A 2EKNA 2KI2A 2XZTB 4I6YA 3FSXA 4F3MA 3PHTA 1HKAA 3RR7A 3NL0A 2IMWP 2BJEA 4QW8A 2YKAA 3QJJA 4RUAA 3JTNA 3LAMA 2CJXB 2E1AA 2C2OB 2RILA 4NYZA 4U8YA 4NLWA 2MXYA 3M8WA 2OEKA 2WBRA 1FA0A 1AFJA 2BMBA 2KM8B 2L9NA 2FYXA 2IJFA 4ZP7A 5EHHA 2VG5A 1RBOB 2DNHA 2NYIA 1FESA 5LSRA 1FXDA 3NRBA 2Y1RI 5CAAA 5HLFA 3UDEA 3QLHA 3D0GE 1SC3B 2BJ1A 3CCMS 1QJHA 4GRSA 4O0IA 2DH8A 2IFXA 3WC0A 5EX3A 5KG6A 4HYKA 4RW8A 2C2DA 2BANA 3MAHA 4WFAQ 3VAFA 4HTJA 4FF2A 3QIPB 3HHLB 4HI2A 3G8QA 4L72B 1X5SA 2HLUA 3GYGA 3IRXB 4PWUA 4EO6A 4QR1A 2CJ9A 4U67Q 2OPPA 1FRMA 4PG6A 2FD2A 3DGPA 4KT0C 1FJCA 1RLDA 3HFKA 3RW6A 3E8OA 5KFMA 1S5ZA 3SZ2A 2M52A 1OY9A 4O3OA 1UP1A 2XMKA 4I68A 4R5PA 3DNCA 3OQ2A 1U4BA 2NZ4A 2BOPA 1R6VA 4GKJJ 1UVIA 1D09B 1RT6B 1NAQA 4A8SA 2GQCA 3VF0B 1FVSA 1KHVA 1S9GA 4ETZA 4K4TA 3MOZA 1FJ7A 2X1GA 1HNIB 3OFHA 3TQEA 1C1BA 1YBUA 2BDPA 3BB5A 2W2MP 3K57A 4RBTA 1VJWA 2R7UA 2IVMA 2WONA 5H9EJ 1OY6A 1EX8A 2YX4A 4NA1A 1HFEL 3POTB 4CM2A 3H59A 2N7CA 4ECXA 2YNFB 5GAHU 2Z58B 2Y1LB 1FNXH 2DRBA 2EG2A 3EUNA 1HBUA 5ETPA 3QSIA 1HNZJ 5K8NA 2VG6B 4LRBA 4MKYA 1QAYA 2CQ0A 1ZBTA 4ZVPB 2LECA 2QLWA 4HEA9 4NZ6A 1D8YA 2B9EA 2GVZB 4LF5F 3EZOA 1XWLA 3BSCA 1KD1T 1PG5B 2ZBQA 3LH2S 3DDNA 1BQXA 4RLEA 3NCQA 5JUMA 2HFOA 3IFEA 4OLPA 3OXFA 2HBRB 3HSGA 5ETMA 4CLFA 4RNNA 3MR5A 4J9OA 2NXUA 2AV5A 2R4FA 2AJ2A 5K14B 3ZZRA 2HS0A 3UD4P 1I94J 1EETA 4OZNA 2FVQA 1RABB 4UTGA 4JV5J 3K89A 3K5OA 1S1VB 4C98A 4ZJLA 4AFFA 2K7JA 2VPXB 1EKSA 5B0AA 3JSYA 4TKTA 1RQ0A 1Z1ZA 2GMLA 4DU8A 1NMEB 4RW7A 5H1SV 5KFDA 4DR4F 4TQRA 4U7UD 1S72S 2E7XA 3W60A 3PIPQ 3H98A 2FC9A 3OR1B 1BQNA 3M8QA 1RTZA 1NK6A 3RGIA 4M5HA 1LK5A 2VD3A 4CLZA 2FHJA 1U1RA 3PRDA 4B3OB 2L9DA 2MSTA 4U8VA 3BSNA 3B8HA 2E5IA 1N36F 5BXIA 3JSMA 3I9V9 2RAQA 4OV6A 4CT8A 4LT6A 3C6TA 3M32B 2D9PA 3PEHA 4B17A 5JJBA 3SMZA 5KFPA 1R8BA 1AA1B 2ZFHA 4UZCA 3NG8A 5B7WA 5KT4A 4ANCA 4NLUA 3G96A 4DSEA 3PX0A 4CYUA 2CPDA 2CPXA 2DNLA 2GHVC 3ADAC 1VK8A 2XI2A 3Q83A 3CCJS 2B0GA 2KM8C 2CJQA 3OTDA 5KFTA 3C15B 3H25A 4K7QA 2ZE2A 1BY9A 2HIQA 3FQLA 2W9CA 2AEMA 1NH8A 4DR7J 3OHAA 5LMUJ 2DB1A 3PO4A 5E3RA 1AZSB 2D69A 3CJ2A 1SH3A 5A6WA 5IS2A 2V2KA 3VQSA 5T7LB 1F60B 3UN2A 2ATLA 1H73A 2R7QA 4LF9J 1UVKA 2JJ4D 3DMJB 3SBMA 1ZPVA 5CQGA 3FVYA 4NE9C 1NJYA 3QPIA 5CH7B 3R5GA 5HL7Q 1SL2A 3MHYA 3KLIA 1T0TV 2IJNA 2ASYA 2YKNA 3OR1A 4WXWA 3IS9A 5DQIA 3SV4A 4P73A 2I5JB 2PC6A 3PR5B 2XMVA 5L9NA 2V94A 1PCAA 1VHIA 2VH7A 1DQ8A 3D54A 4IH7A 2ZZTA 1IKWA 4ZA1A 1LKZA 3CDWA 4F8RA 1KOHA 1X5TA 3QQCD 1N5YA 1XTZA 2CNNB 3MM9A 3ETMA 3R8YA 4QWAA 2UU9F 4ILMA 4X2BA 2UUAJ 4R8UB 3RB3A 1E6YB 1U8WA 4HR2A 6FD1A 4CNYA 2MHEA 1LFWA 3M8RA 1P1TA 2ZWPA 4M63A 4ZPAA 4PQUA 1KVJA 3IR6B 3MAQA 5D8HB 3BYPA 5KT5A 1FERA 2CG8A 3MD1A 2UUWA 5IQ6A 2KT2A 1X8DA 4MFBA 2HVDA 4LF8F 1R89A 3PFEA 1FRJA 1PKUA 1RAHB 1RAIB 2CZ9A 4ILRA 4KPYA 1X5PA 2QRRA 2V4JA 2OSQA 4DSJA 2FTRA 1GEHA 1YJVA 2IDEA 2CZVC 5KFKA 2XO6A 1RTDB 1QDUB 1Q82T 1IKYA 4EGLA 1S1XA 1UEKA 3W9IA 5J1EA 4LF4F 3Q89A 5HBMB 2QC3A 3W3SA 4BC9A 1IR0A 1S4FA 2ZVIA 1SC1B 5DQGA 3UE2A 1W25A 1V9OA 5CCMA 4DR2F 4NMLA 1ZZFA 4YR2A 4K50A 5HQMA 3FBEA 2OSRA 4ZPCA 2XQCA 3RBXA 3DKDA 2OLWA 4ZP6A 5A8RA 1DARA 5AXNA 4LRCA 2BE9B 3GWCA 3CJSA 1TL7A 4DV7F 3NWGA 4M5JA 4J9MA 3EDQB 2RD5C 4PXDA 3R9LA 2W2QP 1IBCB 3AODA 5IM0A 2LMIA 1VS3A 3GILA 3QT7A 4DUYF 1UW9A 4Y0FA 3PKYA 4B3MF 1LW0A 4B3OA 4K4ZA 4DV2J 1KHWA 5K8PA 3G2XA 1FKPA 3LA0A 5KFNA 2DHXA 2D9OA 4HI1A 3KMSA 4J9SA 3BR9A 3PVXA 4I2PB 2NREA 2M4MA 2ZBCA 3N9UC 3NGSA 2FLPA 1XBWA 2H4WB 3GTYX 4NI2B 5MLCV 1IM4A 3CPWR 1TUWA 5IWAJ 4LRDA 1WC0A 4CLKA 4IDKB 3EZUA 4Y3CA 5GAGI 4XIUA 1S6UA 1SIWB 3FBCA 2BBEA 1YJ9S 2V9WA 2AJQA 4HTIA 1BD6A 3OL8A 1TKXA 3QWPA 1UCNA 3PJWA 1TL7B 2HAIA 4TLQA 1Y11A 3BBBA 2MLYA 4QIEA 2XY5A 2PFDA 3MOJB 2LQ5A 3GR1A 2P9CA 2AX0A 2ZJRQ 2AX1A 4FXWA 5K8MA 1YRTA 2RJZA 2A2DA 2DCLA 5IQQA 2MEWA 3WQPA 1HBUB 1T9TA 3IBFB 2WOMA 3HULA 4RKUC 1VQ6S 4RW6B 4I1TA 3RYLA 4PWDB 2VC1A 1KOOA 4CT9A 3FCVA 4YB5A 3SCKE 3CDEA 2R3VA 1F0XA 1X5OA 2KJVA 3D1QA 3MPWA 4M5MA 5KFWA 2XWYA 1TKZB 4YY3F 5KFIA 3JYTA 5FLXU 4DS5A 2ERRA 2E9RX 3JSMB 2CPJA 3QYYA 2ZH5A 1NH7A 2C2RA 3UO0A 4UW2A 4PYAA 3GE9A 5DGAA 4TVAB 4F4KA 3T19A 1HNVB 1R27B 1JMTA 1F2GA 2YH1A 2EXUA 2OPPB 1WD6A 4J7CA 3L09A 1CJVB 4M5KA 4PG7A 5KFVA 3T5JA 2XS7A 3ONQA 1MMLA 4UOGA 3WZ0A 2NS1B 1WHXA 2B8PA 4CH7A 4KV8B 1JK9B 1U0SA 2HHTA 2EWHA 3NOGA 2IMOA 2RU9A 3I9ZA 3M2VB 3KYLA 2V50A 5HK4A 1S1TA 3UN5A 2KFYA 1MU2B 5T14A 2V8HA 2DNMA 4ZPBA 1KS2A 2XS5A 3FSIA 3TZZA 5BYRA 2HWHA 2QA2A 4NLYA 3RB6A 1NK9A 2XYHB 3MMAA 4DR1F 5IC6B 4B9UA 1SL1A 1RWNB 3V4MA 2IM1A 4N77A 4LIWA 4F4WA 1GFWB 4XTTA 4QR2A 4WIQA 3T5HA 1XERA 1JLFB 1FT8A 2MZTA 4JI0F 1UA1A 5A8KA 2GMJA 4DJBA 5KOWA 3DI6A 3TVKA 2XLIA 1EB0A 1M1KT 3C15A 1FFSB 4ZPDA 3KLFB 4X66J 1S12A 2EEYA 4N8OA 3OBIA 4P6QA 2OAUA 3OTOJ 2VHGA 1XNRF 1DY3A 1YG0A 3I0SB 1J5OA 3QO9A 3TX0A 4WZMA 2KXFA 4WYLA 2YNIA 1KLMA 4PG4A 4P72A 4Y00A 4YHHF 1VQ5S 3TNVA 3D5MA 1Y4ZB 4DDFA 1WOPA 4LFCF 4NRTA 3SV3A 5EGYA 1URRA 1ULRA 1VRUA 1KVKA 2R7XA 1BWEA 1NHUA 3ZC4A 2E1RA 1H38A 4LF7J 2K06A 2FJEB 2ILZA 3H42A 4DLEA 5IOLA 4NCGB 3HSZA 2CPIA 1ZA2B 3RJMB 2UUBJ 4R8UA 3EXCX 3H2LA 3M8QB 4C8YA 5KFFA 3BS9A 3NGDA 4BDPA 2M3DA 3MM7A 3EPGA 1IQTA 4NXNF 1FJGJ 1K0TA 2QA1A 3DLHA 3MTKA 2R7WA 3N5FA 5GADU 1T9WA 2AJ1A 2M8DB 4OYWA 4BLGA 4C11A 2AT1B 4IUFA 4ZPVR 2HS4A 2MJUA 2XCPA 2ZBIA 2HFNA 1VIXA 4KBIA 4ZVHA 2GAHC 3SSRA 2MZ1A 1XR5A 1KEKA 2XZDB 2IAJB 5CXTA 4FS1A 5F9NA 1F5BA 1P6TA 1IQZA 1SH2A 4K2XA 1SPBP 4OIXA 2HHVA 2F3JA 5JMNA 2DXFA 2WVBA 3LGMA 3UDCA 2J9DE 2QEXS 3TEHB 2MKIA 4WKRA 3QZ7A 1FDBA 3AJ1A 1Y10A 1WOSA 1R7IA 2H1YA 3A8JA 3CVKA 1TK0A 2N3LA 4AYBD 3JB9k 4PXCA 1NBEB 4OZ5A 4DEZA 4ELUA 3ZTRA 4HHUA 2B7BB 3HKWA 3W8GA 3Q8UA 2O66A 1R43A 3C14A 4RU9A 4IQXA 1UJ6A 5BR8F 3H5XA 4I67A 1E6VA 1C4AA 1WG4A 2FJAB 3M4XA 4Y2AA 5B0EA 4ZJOA 2Z8QA 4XDDA 2HHPA 1HD1A 2GVDA 4TN2A 1VHFA 3BPDA 4H4OA 4MKVA 1TUVA 5EX0A 5B0FA 3SFUA 4KH1B 2BEFA 4KIAA 1VISA 5C42A 4DL5A 3UCGA 4GC7A 1VQNS 2H9ZA 3ILJA 3IR7B 1FTRA 3S1TA 4QYZJ 2D1CA 3J7YU 1H3DA 1MN9A 3IN5A 2BANB 3SQGB 1YX2A 3C3LA 4OI6A 4ZLLA 2W2NP 2WVDA 2M5YA 2GMHA 4KGMA 4NI2A 4WKYA 3Q8SB 1S9EA 4DUZJ 1E6YA 4USUA 4PUOA 4UY8T 4PQUB 1YK9A 1GXUA 4FN5A 3FCWA 2YVSA 4I7FB 3UI3A 1FRXA 4CNZA 3EICA 4USMA 5CD4A 1RGVA 1SV5B 3MMAB 1JLAB 2ZM6F 3EJMA 3MR7A 2W9BA 1EHWA 3MFIA 1VR6A 4DN9A 4DV6F 1IBLF 1K1SA 1WACA 3T1HJ 2FLOA 1OSDA 4E98A 3CIMA 5F3ZA 5HN0A 2KL8A 1SI9A 5D78A 3L7UA 4I2QA 4ENOA 2IM2A 2VODA 3CCZA 3FFIA 4X84A 2XNQA 2OUGA 2EG1A 4IG0A 3BH6B 2GIQA 3IWXA 1NPKA 2X51A 3CCVS 2KYXA 1UKUA 2OO4A 7FD1A 3T5LA 5HROA 1S0MA 3GLJA 2VICA 1C2PA 4DCOB 1U1NA 1U48A 4JI4F 1YJUA 1CS4B 2AJ0A 3NKYA 1RWPB 5GAEU 2OEMA 4ID5A 4DR5J 4UY85 4C8ZA 1G2EA 2MGZB 3HT3A 1Q5VA 2VASA 3OW2R 1FWPA 3VHQA 3NGUA 3KJQB 3GJTB 2VBWA 3H4BA 2HVEA 2NXNA 3M05A 3OD2A 3BO4A 1AUDA 4JI2J 4K4VA 3K58A 2MQLA 3N6NA 2WBMA 4RUHA 3UD3P 4UUXA 3KJNB 4PYDA 4G65A 4DX6A 4X65J 3MM5B 2Z56B 1M0SA 2H5EA 5L1JA 5F3TA 3BKUA 2PA8D 2OPSB 3PG9A 1IJFB 3DLJA 4QIWD 4O3QA 3ZZPA 3IAM9 4F7VA 4DR3F 1X4EA 2P6SA 1S0VA 3CGIA 4Q5VA 1KQSR 3M8SA 3LP2A 1WHYA 2HWTA 2RRNA 2YNGA 4ZPWR 4EU0A 1RUSA 3ILIA 4H4MA 2DGUA 2MY7A 3UVJB 4P71A 2JEGA 4N41A 3X1LB 2C2EA 1UPMB 3D68A 1TELA 3FFIB 3R27A 1RHUB 1H7WA 3F41A 3MMBA 2HVHA 4DR6F 1B99A 3DRPA 1NK4A 2L08A 5DG9A 3EPIA 2MQ8A 4ES2A 2W25A 5HVHA 2JSXA 3HHLA 4J90A 3E3XA 3AJDA 2RUGA 4URQU 3BGFA 4JP8A 4ZVUB 1XR7A 1V5VA 2VU5A 3TVZA 5KG3A 1NNDA 1T03A 3CJKA 2MKJA 1KKHA 4JI8J 1IKXA 2XBPA 3N4WA 3ZTQA 3CIZA 2LLZA 1Q53A 3DLKB 2DRDA 2QMUB 4XK8C 3CCLS 2KN4A 4C2MA 4RNHA 1EAYC 1VBYA 3CCWA 3D1HA 2YY3A 3LTOA 4ZITA 2DHGA 2W9CB 1DTTA 3ZO7A 2AZ1A 5ETLA 3HSJA 2KB2A 4RZRA 1U1LA 4FF4A 2IYGA 4OJHA 2IBKA 3CD7A 3CJTA 4WIIA 4DQQA 4NEZA 4TNOA 4DMZA 4ES3A 4DV0F 4WCEQ 3W1YC 4OYPA 1X9WA 3KHRA 1F9EB 1CULA 1WJ9A 3TR5A 1T9UA 3JQMA 5HMZA 4DQIA 4N7TA 3QBCA 2HMIB 2ZHBA 2W01A 3ICLA 2ZC4A 3E51A 2VC0A 1JLEA 1SQEA 1GTEA 1ZAWA 2WW8A 3L7OA 1KQKA 5I42B 3M6WA 2A2CA 4P2XA 2G1DA 2NPFA 1B0TA 3UN3A 1PBUA 1LWFA 2GIFA 5G4DA 1RTHA 5THWA 3BO3A 5B09A 1UEVA 5EDWA 3C6UB 3IRWP 4HKQA 4JUZA 3PW5A 5L9XA 1NDLA 4NYOA 1YJWS 1DTQB 3HPOA 1N6QA 3JQJA 2XSFA 1NSAA 3J80U 2R42A 2MGZA 3NAIA 2RS2A 1FE0A 5J2MA 3HMJG 3OHBA 4QPXA 3MR3A 3G6ES 3M9NB 1BMQB 5IV3A 4RUCA 3P4UB 4JI8F 4F0KA 2LXIA 2NXEA 3QLHB 3MAAA 5EN1A 1EIYB 3D6MB 1CC8A 5HP1B 5KT3A 2VA3A 3H0PA 2YPYA 2C2NA 3AB4B 1WC4A 3MEDB 3ULHA 5BJRA 3G6VA 2XMUA 4NRUA 2PI4A 4LF6J 4EYIB 2DNPA 4CO2A 3T1YF 1S79A 3DRXA 2M7SA 3O3LA 3T6BA 2C22A 1KC8T 3VVUA 3NNCA 4RJVA 4LFBJ 4JI6F 3HSDA 5DETA 2AQ4A 4QIGA 5L1KA 4IQMA 4DF4A 1RWUA 1WWHA 3OFEA 4MKAA 4WPAA 3WX8A 5CD4H 3PW7A 2Y8YA 1KVIA 3PRVA 3GYNA 3MF5A 4PABA 5C42B 1B4SA 1HBMA 1Y9OA 2RB7A 4ZCMA 2QA4S 2CPZA 5F8HA 4Q0BA 4NCGA 1RB0A 3NNHA 3PTWA 2BW7A 3SQGA 2XGQA 1MSWD 2POKA 3IGNA 4C97A 1B0VA 4U95A 3THPA 4C3KA 4K4XA 2E1MC 4L3NA 4JI7F 2C3UA 4LFAF 3KTQA 3LF0A 2CQ2A 2K8GA 1U25A 4XO0A 4G1QA 1V3ZA 4TU8A 2XLJA 1JLCA 1WI6A 2ZH3A 4DL3A 1YJRA 3EE3A 2ZH1A 2V0NA 3TANA 2YX1A 2F40A 4WTOB 2I8EA 1VBXA 1SJ4P 2IC3B 2D3OR 3EM1A 3DYAB 2MZJA 2BZ2A 1HNXJ 1N5SA 1OJ4A 1V3SA 4KKOB 4OZLA 3H7HB 3VAMA 3MEGB 4J5OA 4WE1A 4DSLA 1XNQF 3UW1A 4JI4J 3CCTA 2C1EB 1S77D 2XMTA 1SB6A 2B56A 1U2FA 3QT6A 2HNDA 2Z4PA 1A0OB 2FHMA 3MXHP 1X0FA 1F5CA 3CJ3A 1UMJA 1FEHA 4RW8B 2K3IA 2RKIA 4WU3A 3K5LA 2E5LF 3R2DJ 3KJVB 2KO1A 2E1CA 4X4UA 1I51B 4KGKA 3AQPA 1FK9B 2Y3YA 3DC2A 3MWBA 2WSFC 1F5AA 2HNZB 3H20A 4H54A 3IBCB 3KK3B 3EYZA 4O23A 2GAGC 2AZ3A 4IH5A 2HLTA 1KFDA 2CYYA 2G13A 3DRYA 1FX2A 4M1KA 3HFVA 4OL8A 4NXMJ 2GS8A 2OI2A 4KGVB 4KFBB 1S1UA 3BSOA 2IYIA 1TL5A 1T7PA 3UFCX 3GIKA 1JQGA 2E66A 1CJUA 3CDBA 4IFVB 1TKZA 4ECVA 3E2EA 1BLUA 2KG1A 4A48A 2O3DA 4HLBA 5I3QA 5J2MB 2GQ2A 3DXSX 5LM7E 1S0OA 2VOPA 1CJKB 1N52B 2DY9A 3NMRA 2WRMA 3TJ9A 3OL7A 1QUVA 4A8MP 4DG1A 2ZZNA 1UW4A 3HXMA 1YRUA 3EVMA 3CMQA 4DQRA 3M9OB 4NCBA 2F1FA 3EGNA 2HQDA 5E3CA 3LP0A 3BQ0A 1B0PA 2YNFA 3VV2B 2VG7B 1VC0A 4IR9A 2QA4G 1UZDA 4FVMA 4EBDA 4NEYA 5IZHA 4ZCIA 4F2SA 1RWXB 1H7XA 4DL6A 2K1RA 4LR7A 4RW4B 1SJ1A 3B82A 3W5XA 2B6AA 2GA7A 4ECTA 1T3NA 1TKDA 2CRLA 4NYPA 3TW0A 4X62J 4DQPA 3CEDA 2J8AA 4E8UA 4J9RA 2OPRA 1AW0A 3EGVA 1BHNA 2AGQA 3M2UB 3OL9A 5DZ6A 1CPZA 3R5CA 3CMES 3MZIA 1BWVA 4DPOA 1DJ0A 1YBTA 4DLGA 1WG5A 2FUG9 3V81A 5J2PA 3C46A 4FF1A 1QAXA 1R0BG 2V8GA 3VVTA 1FXRA 4NLVA 3HVTA 4V19X 1RHKB 4PWWA 1FNOA 5C24A 2VQEF 5AE2A 4GKKJ 4A47A 3SYZA 1REVA 3HHLD 4K2JA 4JI5J 4B3RF 1WHWA 2VF3A 3N28A 2MKCA 1WF2A 2HHWA 3AOAA 4IFYB 1OIAA 1RTIB 1HBOA 1N5VA 1OPIA 1UZHA 2FDNA 2G2ZA 2XG8A 4DX5A 2AMCB 2CVIA 4RWWA 3FZBA 3ZZZA 3T1YJ 1RTJA 4W4MA 5ETSA 3DYAA 3OJSA 3RRKA 3RRGA 3D9BA 4IG3A 3AAWB 3M2UA 3SDEB 1FRLA 3FQKA 3LP2B 3V2UC 3V6KA 2C2ZB 1FCAA 1YKWA 1TL3B 1JXEA 4EYHB 5KOXA 3NCPA 4Y6IA 2DHHA 5J1PA 4U6PA 2LYVA 3UVJA 1C0UA 4KKOA 4FVCA 3C8YA 5MAOA 2E5HA 4EUVA 2N4DA 5F0WA 2JVRA 2A3JA 1DBDA 3GV7B 2J9DA 1XNRJ 3OTOF 4L76A 3RAMA 1HBNA 3QIDA 5ADZA 2QYGA 3QRRA 1TVRA 4YUDA 3MMCB 4ZOSA 4KAIA 2LA4A 3D6HB 2XHCA 2MQOA 3EGZA 2MPUA 4KRWA 3TUZC 3L4BC 2UUCF 5E3PA 1S7HA 2MLXA 2PD1A 4LF2A 3PNIA 3W2WA 5LL6d 2A6OA 2AYBA 1U26A 1CJUB 1RHQB 4IFVA 1BE4A 3N5BA 3O44A 2JFDA 4AUKA 3OSNA 1MG7A 3HM9A 4JV1A 2DVIA 4R25A 4JYAJ 3G82A 2Y1JA 1M90T 1TKTA 3HHEA 2XI3A 1CJKA 5I3UA 5KFUA 1DTTB 1UEUA 1HHSA 4X4TA 2W9AA 3NOCA 4WK1A 3D0HE 5HP1A 2CQ3A 2FY8A 2E9ZA 5K14A 1MU2A 2AJFE 5F0UA 4DXLA 2YWEA 3SCIE 2XY7A 4GO5X 2PA3A 1PYSB 4W98A 1JLQB 4B3RJ 4GKKF 2GGPB 5IT4A 4OX6A 4QYRA 5D4OA 1TTHB 3QT5A 4YDXA 4OX9J 2HBYB 2ZHOA 1IXKA 3MPDA 4HL9A 4JBCA 4CCHA 1T02A 1WTFA 4DV5F 2IJRA 2RDDA 2ZOFA 4A8QA 2WSCC 4Y65A 1Y3JA 2C3OA 2YWHA 3W64A 1IBKF 1WHVA 4Q2MA 4ZVFA 2AJ4A 4MYUA 5AJ3F 4NA2A 3LGNA 3DGVA 5I3UB 2WHOA 3AOCA 4Y2KA 4YY3J 5G0RB 2V4RA 4GO7X 2IDLA 3CDAA 3IG1B 1S99A 4DPXA 1N5QA 1N6QB 1S9GB 1NB2A 5HQ8A 2CQ4A 4CYUB 3HKZD 2FLNA 2DNRA 3KG0A 2WONB 4LF1A 4EO8A 5ETNA 3RU0A 1VRUB 2IRYA 4CO5A 3GIRA 4YEAA 3TVYA 1YBAA 5E0OA 5KFBA 5L1IA 3DDKA 2FY1A 2IBOA 3LUYA 2GHWA 5CYQA 3KLVA 1BQMB 3ENVA 4WYWA 2J76E 4ZP8A 1LEOA 5JXSA 4CI0B 5DM6Q 2DO4A 1LOUA 2FHOB 2NSCA 2ZKTA 1N32J 3ISZA 4RNOA 1HI8A 5F8LA 4XAKA 3BQ1A 4IG0B 4Q45A 2G4BA 2GCFA 2ROPA 1WDDA 3U1NA 1TL4A 4P2MA 1NK0A 3MM8B 1UWBB 4D3GA 3IG1A 3QWUA 2U2FA 2HKEA 1IN0A 3GFYA 1IWAA 3U7JA 4CZCA 1B70B 2EFNA 2ZJQQ 1EETB 1PYTA 3PRBA 2QL9B 3B4DA 1JNRB 4OI2A 3M7VA 1W7WA 1P9QC 3BBCA 4X4RA 2LKZA 4RO0A 2L41A 3BGOP 3CCES 2Y0BB 4RL1A 2W7PA 5ETVA 1VRTA 3J81U 3OVSA 3M2VA 2R7VA 3KK2B 3MM6B 3F73A 3TYTA 3CC4S 1CQMA 2CPFA 4NASA 1EARA 2J7WA 3BGRA 3G8SA 2DNNA 2IRUA 2F4FA 4QZVB 4IO1A 4PR6A 3CCSS 2KTQA 1GX6A 3SIPB 4AD6A 5F8NA 1XNQJ 1S49A 2Y9HA 2DIVA 4KHRA 4TYBA 3CJ4A 3QRQA 2Z2LA 3POTA 3VAIA 4H4MB 1N54B 2QLFB 4RU2A 3SI8A 3BDEA 3WX4A 5KFLA 4OZJA 1LXNA 1M1GA 1CC7A 2EFQA 2VG6A 3KWMA 4F0MA 3G71S 4ECSA 2KT5A 1AZSA 1ZOTA 4HH1A 3JYTB 4WU2A 2J9CA 2GO8A 4LFAJ 2FJDB 2KT3A 2Z30B 5D4PA 2BJ3A 2L48A 5AE1A 2AKWB 1D9DA 2UP1A 4F0HA 1HLWA 3D3BJ 5KG2A 3KOAA 3FEYB 4FPRA 4OHZA 5KG0A 2KYZA 4CLLA 3U1MA 3TAQA 3DLEA 1PJ7A 4OQJA 2HS3A 2HQFA 2NUUG 2HPUA 1TMMA 3D6FB 3F44A 1YZ7A 2V2QA 4ED5A 5A76A 3PW2A 3I5AA 4AL5A 4RR5A 1S10A 1SJ3P 3R6GB 2M88A 4WFXA 3BV8A 2R9LA 1WC3A 5CZXA 1U1KA 2HBZB 2IVFB 1L5UA 1NJXA 2KFZA 4ZVEA 2NXCA 1CS4A 4Z2XA 1IKVB 1Q8BA 2DNGA 1HI0P 5GADI 4DU7A 3ILLA 4QW9A 4NLDA 2X1FA 1W2IA 2FZKB 5GAHI 5IFMA 4UF4A 4K59A 1KDNA 1XJWB 2DHAA 2JNJA 4K4YA 2OH2A 2UU9J 3CD0A 2D74B 2NSBA 1S1VA 2NXJA 1Q7LB 3NWRA 3GJSB 3PX6A 1NK5A 1DLOA 2HGLA 1CEZA 3K5NA 1RYRA 1RTJB 2LU1A 2N4CA 2UXCF 4KTQA 5KG1A 5DDOC 3EGWB 1ZZNA 3VWSA 3P5TL 2XCAA 3G8TA 4K4SA 2QLBB 4CM0A 3RG6A 2HHUA 2VL1A 1CJTA 3AD7C 3JAMY 5IT0A 4UZBA 1JJCB 1WTBA 5GAGU 3HVAA 2C2KB 4EZ6A 1DQAA 1QY7A 4ED4A 2E7WA 3HLUA 4QWEA 4LF9F 3ILOA 5DJBA 2CZ4A 1UFLA 1DURA 2E44A 3T41A 2KKHA 4AXJA 1FNMA 4CH1A 5DLFA 1HIYA 3QRPA 5LMUF 4RBVA 1J5OB 3PV8A 1SC6A 1U24A 2G0CA 3BN7A 1S9EB 1ZYQA 4PUOB 3CJ0A 1RADB 2DNZA 2DEIA 1YHQS 1SCJB 4KE5A 3OVAA 5JVGQ 3MMCA 3TARA 2MZQA 1RTDA 1JWWA 2CQ1A 3DLLQ 2WK4A 2DRAA 2F4VJ 1VQMS 3NAHA 4R0JA 1HW9A 2V6AA 4PZVA 4EFAC 2DR8A 1DHMA 1FDNA 2V8VA 4LSNB 2J0WA 5B0GA 2P6TA 4Q43A 1KQGB 3IBWA 4NXMF 2G9OA 2W7AA 5DS7A 3CTRA 1WOOA 3FUYA 2HRUA 2F9DA 5J2QB 4J37A 2KVQE 4PCQA 4HACB 2I0XA 3L7PA 1O6XA 3BM7A 3M30A 3HP6A 5I3PA 2F63A 3MI7X 4G6VB 5G0RA 1JKHA 4EBEA 5B0DA 4NLTA 2W7OA 4XDCA 1O51A 1XEZA 2HZVA 4OHVA 4B08A 4O3PA 2CQIA 1D9FA 2B4OA 1Y5NB 3TUJC 3F56A 2G2YA 1R8HA 1F3FA 1UJ4A 1TKXB 4Q44A 1FWKA 4OYXA 4RW7B 2J0QD 1URNA 3IS9B 1WEZA 3AA9A 2KH9A 1G7CB 2QGFB 2WAQD 3DU6A 4IDKA 4KV8A 1WUUA 4DPUA 1HMVB 3V6HA 3TUPA 2NZCA 2VDIA 4CWBA 4JV5F 3T9ZA 2B8QA 2JRSA 3A8KA 4I2QB 4F4XA 1V3RA 2LQ8A 4B9TA 1HQEB 2LQBA 3V4IB 3GMGA 5KAKA 4P7TA 3CDUA 2O67A 3HD2A 4MIAA 2DO0A 1S4EA 2XWXA 1WEXA 1T3OA 1UWAA 2MTLA 2D41A 3M8PB 1JIHA 1TMJA 3M2RB 3MM8A 3Q8VA 4NMXA 1BC6A 1WC6A 1RSCA 1X4DA 3RZAA 2YWGA 4ES1A 1TAUA 2ZDOA 1IM6A 1HNZF 2W4DA 3SEOA 4UOCA 2R7RA 1RK8A 2GFFA 3GG0A 3OPKA 4ZVTB 1X9SA 1UVLA 2L9WA 1U1PA 4PWDA 4H4OB 2ZBPA 4UQGA 3V6JA 2FPHX 3BYRA 2K1RB 4M5IA 3Q8PB 2R2SA 1OYDA 1VLOA 2OTLS 1NCLA 4DR3J 4MJKA 1RT7A 4OYZA 2XS2A 1J5EJ 2XGPA 3N01A 1TFWA 1G6BA 2RDIA 2QT7A 2V4JB 3ISNC 3W9HA 2FJXA 3BGUA 1X9MA 4WBFA 1LW2A 4CRJA 1S6PB 2UVWA 3GJRB 1FXLA 1YJTA 3ZXWA 2H3EB 4YP3A 4OZ1A 3QSYB 2SXLA 2YKOA 5AXLA 1K73T 2GV1A 4DR5F 2FQQB 2DGXA 1MW7A 2VPWB 2AYGA 3DOMA 1IWGA 4A4JA 2C28A 4C8LA 1VJQA 1N33F 4LRFA 2DIUA 2E5GA 1B3TA 2PMWA 3SSSA 2HAFA 4WP8A 4BHQA 3MM9B 4C3MA 2CKWA 3CO0P 3A12A 3M2RA 2UV8G 1SQGA 3ETOA 4C11B 2XTJP 3QATA 1Q7YT 3PYEA 5E2QA 4NLXA 1DZ5A 1KTQA 1UL3A 3U1LA 1H2VZ 5KFQA 3Q8QB 5C2CA 1RT2B 2QO3A 1WELA 2G0IA 4DV1J 5DGBA 1IKWB 1RT1A 2D3O1 1FRIA 3DRRB 2MJNA 2QZ8A 3G82B 1K8AT 4NL5A 1OWXA 4DUZF 3NBPA 1JKHB 3PDNA 2YQ3A 3C6UA 1HW8A 3DLEB 3W62A 2HIYA 4N47A 3D1OA 1FKAF 1HNIA 1FKOA 4F3QA 4DL0C 2BM1A 3P6YC 3FJ2A 2ZITA 3TRGA 5JVHQ 1FDAA 4ANEA 3HJFA 2BE7D 5RUBA 3M9MB 3FNNA 3R7NB 5BR8J 4FXVA 3T5KA 1L3KA 2F9JA 4P2SA 2AU0A 4ZP9A 2MLZA 1RT4B 3QFWA 2YQ0A 2UXDF 2Z2ZA 1RAGB 4CLSA 4F4ZA 3TO8A 3NBPB 1HR0F 2OP5A 3I5CA 3GIJA 2JFKA 3C2PA 3E01B 2DGOA 4KSEB 4OI0A 1LWCA 4FZVA 1H0HB 3ITHA 4NLPA 1ZS6A 2MHNA 3TAMB 4DF8A 4N76A 5LMNJ 4IG3B 5AJ3J 4OHWA 3UCZP 1RT2A 3TOQA 2ZH6A 1X4GA 5C7PA 1IBKJ 1NHVA 1VLYA 4KGZB 2LVWA 4DFKA 1RWOB 3BO2A 1HHQA 3K5MA 3IM8A 5KFEA 4ZIWA 4FKXA 5DM7Q 3A3OB 2ZZMA 4OX9F 1KONA 3FEZA 4C9DA 2MKYA 3VAKA 4QU7A 1KRPA 3MEEA 1RT3A 4ECWA 1GXTA 2EW9A 3ENAA 2HRYA 2Y1IA 1XMOF 2YX7A 4IR1A 1M5KC 1JLGB 5KFCA 4AL7A 3PJXA 4B02A 1VIOA 3BBFA 2KXNB 5DG7A 4X4SA 1QSSA 4M95A 4BCAA 2RS8A 4ECRA 4USTA 3IC1A 2RRBA 5ETKA 2UUBF 2HFUA 4B3SF 1RHRB 5IT9U 3PFOA 2OPRB 3OTCA 4J9UE 1WC1A 3D7SB 5K20B 3BJYA 1LW2B 2RSQA 3FCHA 3MDFA 1CBKA 3PIOQ 1XK8A 2W8KA 3MEGA 4P74A 3NCRA 2I2YA 1VBZA 4N5SA 4NA3A 2UXBF 1E6VB 2AHOB 4FS2A 3KFWX 1QSLA 1NKEA 2BV3A 3PCOB 2MKKA 4J9LA 2UUCJ 4YHHJ 1SKSA 4WFNQ 1RACB 2BA9A 2HGNA 3CO9A 1S9FA 2DR7A 4FBTA 3GONA 4USWA 2GVDB 1BUXA 4TU7A 2HBQB 1SUQB 3TX8A 5C25B 2YPZA 2XM3A 4ICLB 2F65A 4X66F 3AD9C 2ALZA 4I64A 4E0DA 3ZZ0A 3KNAA 5IV4A 2X1BA 4F26A 3IM9A 5J1EB 1FHTA 2E7VA 1C1CA 4JI0J 3V6DA 1PC4A 2UXBJ 4CO4A 3CNQP 4MK9A 2BVZA 2G0JA 5E7OB 1O8BA 3J7AN 1RAAB 3DFEA 3DM2A 4KGXB 2W4CA 3GFXA 1Q78A 4OX7A 1Q0NA 4TU9A 1R3NA 5LSLA 3CMAS 4DR1J 1GX5A 1WDTA 4B9VA 2GHPA 4K4UA 1FKOB 2VPZB 3N6MA 3OLBA 4QJVA 1JB0C 1U8SA 3FBBA 2VKRA 1ZM2A 3MPUB 3KK2A 1ZTWA 2BX6A 2JEFA 2OD4A 1X4BA 2CQCA 5DO2A 4A46A 1QTMA 1YQHA 1S1TB 2B9XA 2HRTA 1AUSL 1XMOJ 4IO9Q 3TQ1A 5H9EK 1VQ8S 4C8NA 1VOMA 3O5TB 3A13A 2BJ7A 3TZXA 2AYEA 1M1HA 2G2OA 1ZM9A 3GJQB 4WJBA 2DNQA 2VQEJ 3RAXA 3JTOA 1ZETA 1LV5A 2ALYB 1I5OB 2P9GA 2BE2B 1PIEA 3KXDA 4USIA 1QVFR 1K9MT 1N32F 1NJIT 4OX8A 4EWTA 4NLOA 1NUEA 4G1PA 2RF2B 1WSRA 3D0IE 1WSVA 2X3GA 3W2WB 3BEGB 1XR6A 4QU6A 2J6UA 1H2TZ 2ZUGA 2YQ1A 1YDLA 3AJ2A 1PSDA 3I82A 5FLXY 2LDYA 1HR0J 3FKBA 1UVNA 1UWBA 1JLCB 1GAOA 2WB4A 2UXDJ 4X62F 2C3MA 3QJLA 1YWXA 5AT1B 4K5RA 3ITHB 3CC7S 2ZHAA 2BXJA 3OT9A 3PEJA 2MY8A 4HHHA 3M8YA 4QOTA 4WP3A 4F67A 3T6JA 2ZKUA 2RNEA 4ZLJA 3AXKA 2RQ4A 5F8IA 2A10A 2CNKB 1RA6A 2ZDPA 4P9SA 1K47A 2FGOA 3MD3A 2BACA 2PEHA 4BS2A 2B3TB 4KPCA 2F8HA 1LWEA 4E2FB 3HF5A 5K9FA 3K5PA 3KG1A 5LJ3Y 4X4PA 4YR3A 2Q3PA 2IVYA 2JLFA 3IMQJ 4DPTA 2KFNA 2ROEA 4IH6A 2FVSA 4NOHA 3MFHA 4HT7A 3MMJA 4FYVB 1XMBA 2J9EA 4ZLNA 1LQ9A 2EVZA 5B0BA 1ELOA 2ASDA 3FBFA 3FMBA 3IR5B 1T9VA 2H51B 2WB1D 3H90A 4OYOA 3L9ZA 3OFFA 4Y28C 1T94A 5KFRA 1M5SA 1TP7A 4ECQA 1Q86T 1RWMB 1U47A 4DPWA 2YBVA 5FD1A 1WC5A 4DV1F 3HVTB 1QTNB 3GP9A 1RCXB 9RUBA 1IKXB 1SVDA 1BXNA 2V8PA 3DU5A 3PYFA 3TAPA 4ID8A 3VTIA 4MAKA 8RUCA 1T03B 2EFOA 2V63A 4ZKAA 2F8MA 2Q43A 2J6TA 4O3SA 1NRKA 1NSQA 4CQ1A 1R0AA 1L3VA 1GMWD 2E5LJ 1N5YB 4LMZA 2I9SA 4KYZA 5LOQA 3OV7A 4ILLA 3S7RA 3DLBA 3LW5C 1FEEA 1HHTP 1EP4A 4BC7A 5FDLB 5HVGA 3IWNC 2D3ZA 4DS4A 1N33J 1OY8A 4MT1A 5A0YA 3OR2A 2OTJS 4OZ3A 3TZYA 1SKRA 1Y00A 2W8LA 2B9YA 2Q1LA 4CH0S 2XSJA 1LWFB 2C3YA 5C5JA 1LWEB 4MH8A 1TKTB 5HMYA 4ZCLA 2RQCA 4O3RA 3DOMB 4C48A 1LNQA 2DR6A 2CPYA 5U47A 3D67A 1EKRA 3GU0A 1JLEB 5AXMA 3EWGA 4F04B 1RT4A 2B7CB 4O0NA 4NLSA 4JI7J 4JB8B 4HACA 3HHNB 5DQHA 4WFZA 4BWJA 3KLFA 1J5EF 3MUVP 3NGKA 4ED7A 1D1UA 2VFVA 2R8IA 1Q79A 1RDRA 2PGCA 3M32A 2YH0A 3QO9B 3I31A 4WFBQ 3WIVA 4MYTA 2NLWA 5L1LA 4LF8J 1S7IA 4A8KA 3M6UA 3KK1B 4ELVA 3PY8A 4IRKA 2QMXA 5M2RA 4O44A 4UOFA 1HWIA 1T9XA 3Q8RB 4FKYA 2VJVA 4ED0A 3CW2C 1JLGA 3VGTA 3JQKA 4IFYA 2ROGA 5F8JA 1N4LA 4F36A 4RPFA 2ZJPQ 2HW3A 4CLYA 1S1UB 3PM9A 2YKMA 2XLKA 5F9LA 2UUAF 1EP4B 4YOEA 2V5HG 3MEDA 3SDEA 4G3IA 4TLRA 1LW0B 2E5JA 5IC4B 4M5LA 2X7IA 1NHKL 2MSSA 3VGUA 2J6SA 1NB7A 1RYSA 3PW4A 1GXLA 4TY8B 3QFHA 3J81j 5F41A 4EBCA 2CFXA 5D0HA 4F3OA 2RH3A 2CQDA 4PEOA 3U02A 4NLGA 1Q81T 1NJWA 2R7OA 2GJIA 5HSPA 2RDJA 3I6PA 2NYHA 2H48B 3PACA 1A6LA 1OSCA 2MKHA 4Q2LA 3EVWA 5A8WA 3GV5B 1X4CA 4USVA 3M30B 2B6AB 4OYBA 2R2TA 4YDDB 3TA0A 1U1QA 3HFZB 1RTHB 2ZC3A 4O4GB 2XEXA 3QNWB 4C7QA 2QLXA 1LXJA 3RR8A 1N34F 3R3TA 2J7KA 2IC3A 2ILYA 2YNIB 3KK1A 2OPSA 1DFDA 5HVFA 2WTFA 1YITS 3LOUA 2B9WA 4JOUA 1Y5IB 1CG2A 2PMZD 4M5NA 1W2BR 1XN9A 1KBRA 2RT3A 4MIWA 4RW6A 2XO7A 4G1QB 4F50A 1G4CA 3JSRA 1C1CB 1CULB 3FRYA 2EC2A 5BYQA 3H5YA 3BREA 3CULA 3KLEA 2F4VF 1SC4B 5SUHA 3W5YA 2DITA 2V69A 5CABA 4PKDB 5KG4A 3DLGB 3OL6A 2PO4A 3MM5A 1A7GE 2J7UA 3LPEA 4M94A 1KP6A 3Q2TC 2PE8A 5A2QY 4ECZA 2R8HA 2LA6A 4H4KC 4L74A 2WCXA 4CIOA 1X60A 1M5VC 1SH0A 3O8WA 1JJ4A 3Q2SC 2BW2A 1HD0A 2FVPA 2CJBA 3CUNA 2IPOB 2WW4A 3CXCR 2UUTA 3LO3A 2N82B 5KT7A 4PPDA 5LXRA 1FK9A 1U45A 3MURP 1G1XA 5J2NB 1FFWB 5ETOA 1N88A 2QIFA 3MAAB 5HANA 3ZTSA 2HFVA 7AT1B 1H72C 1RISA 5DDRC 2UXCJ 4J9KA 1OPZA 3VCDA 1V6HA 3WHIA 3B4MA 1RWWB 1SQFA 3Q0AA 4C4WA 1VC6A 1SJQA 2DGTA 3BKFA 4GVLA 1TV6B 3THVA 3CB4A 2BABA 4M5DB 2HK3A 3GR0A 4OYIA 5HO4A 4LF5J 1UJ5A 2F7VA 1PAUB 4FYWB 2E9TA 4O4RA 1RT5B 1O5JA 1RAOA 4X4QA 4QWBA 1FWLA 3L95X 1JJ2R 3KDNA 2CG4A 4LBIA 1IKVA 2KDOA 1VRQC 2H5IB 1M5HA 2DR5A 1TFYA 4J9VA 3BN4A 2DPIA 4AXIA 2MKSA 1PC5A 3R5AA 1FTCA 2ZUAA 1IKYB 1YTYA 3VAJA 2W2OP 4DCJB 1X7VA 3HO1A 4QR0A 2J5AA 2W4PA 3OUYA 1QM9A 1SJRA 2OPQA 3MEKA 4YQWA 1GTHA 3I0RB 3KLGA 2W2PP 2HQCA 3NGRA 4P7VA 3J7YI 1S6QA 4DL4A 4DV3F 2BRKA 4U96A 4N56A 1UVMA 2VB6A 1H2UX 2PN6A 5A8WB 1RZMA 3CE8A 3UCUP 2ZNYA 4Y2MA 1F9FA 1RTIA 5EWGA 3W66A 4DI6A 2IRXA 5D0EA 4LIRA 1P9YA 2CQGA 2GO9A 4PPZA 2RF2A 1EJ7L 3W7BA 1VQ9S 3HHKA 4HVZA 4A8XA 3CCUS 1HWJA 3OLAA 4NZ7A 4I2PA 4JV0A 4J9PA 3UNYA 1SL0A 4NZ0A 3LWMA 4DV6J 3QGPA 4OJ3A 4QPTA 4CLWA 1T8EA 1IBLJ 2CIMA 3G4SS 2ACMA 2KRRA 2XULA 4YFUA 1F9HA 2AF6A 2ZD1A 2J0SD 1M5PC 3BKTA 4C8OA 3P8BB 3GFHA 2HNZA 5HLFB 5AXKA 2APOA 3W5ZA 2N7YA 3DM2B 4KO0B 4UOHA 3RTVA 1YJ7A 3TJ8A 3G87A 4WXOA 4DL2A 4WZQA 2L3MA 1ACMB 1PAEX 3C66A 2Y0SD 4IKAA 4TXSA 2XHWA 5CYMA 5D0GA 5KFAA 3NY0A 3GQCA 4DQSA 4FYYB 4FBUA 2BOAA 2BUNA 2OFHX 2WSEC 3SQOP 2C42A 5D6GA 1XC9A 4FP9A 2COLA 5T41A 1SUQA 2R8KA 2K7KA 4RX6A 1KLMB 2I1RA 3ELHA 3U27A 1O0PA 4BBYA 4RNMA 3G6XA 3RBDA 1JXLA 2B43A 4JI1J 3BSAA 4QQBA 2BYCA 5HAOA 2CADA 2EBEA 4DG1B 3A8EA 4R5PB 2XY6A 1L3SA 2XNRA 2KXHA 3R5JB 5D3GA 5LXYA 4KHPF 5A8KB 5I42A 1U02A 1FI4A 1U1OA 2B5JB 3TJAA 3DOLA 4F4YA 4OV1A 1KR4A 3AA8A 1VDHA 3JXOA 2AGOA 2LXFA 4LQ9A 2ZH9A 3JAMU 2DXDA 2HQIA 1BGXT 4YMEA 3QGGA 2YKPA 2XB2D 2CJYB 2YTCA 1ZAVA 1ZM3A 4J91A 5HMWA 5IT9Y 2MMYA 3OR2B 5D15A 1FE4A 3CJKB 4DV5J 2Q6BA 2QFJA 1Q95G 5C24B 3GIIA 4OHYA 2V2ZA 1CJTB 5KT2A 2W9BB 1RT1B 1Y5LB 1VGYA 3BQ2A 1TK8A 2J0XA 1WI8A 3ZZUA 4KJIA 3W63A 3R5BA 4NX9A 1HQEA 5KFXA 3V4IA 4DFJA 1RCOB 1IJEB 3MMBB 4DV4F 3QGIA 3RB0A 2BJDA 3LQVA 3I5BA 2GJ2A 2H65B 4GVBA 3KHHA 1RI7A 2X3DA 2QFIA 3DMJA 1GMVA 1KQFB 4OFZA 3JS9A 3H5UA 1SBRA 2HEKA 2OEJA 4YB6A 3US5A 2VIHA 1OYEA 2HHSA 4JYAF 3NEKA 3LANA 2CUYA 1QE1A 1TL1B 2HVZA 2LQ9A 2P2CB 1RLCL 2QL7B 4ZHRB 1I1GA 1YVFA 2U1AA 1RXOB 2DGWA 1GK8A 3A4TA 5CA5A 2HHHJ 1A9NB 2Y8WA 1C4CA 1C0TB 2AYMA 4P2FA 4EK2A 5EUHA 4LFCJ 3MGJA 3KLEB 2YKQA 3OXGA 1CQNA 2Z0GA 5KFYA 1MWQA 4PQAA 3BGLA 1XIQA 1QSYA 2IM3A 4ER8A 5E3QA 4IOBA 1S0NA 1ZPWX 4F02A 1FX4A 4K0KF 2HURA 2PMHA 2ZNZA 3R6LB 4Y34A 1VQLS 5D0RA 1C1BB 3NGTA 4LR8A 1MROA 2QSWA 2R2RA 2HQ3A 3C6TB 2VDHA 2XSJB 2E1PA 1H98A 2KU7A 2QSFA 4XPEA 2R8JA 1RHJB 2GIRA 4A8FA 1X4HA 1S76D 4IRCA 2DGQA 2RMLA 2JX2A 1HNWJ 2AEFA 2DHSA 1TV6A 2ZEJA 4LVOP 1ZH5A 4C0OC 1Z2ZA 5A6PA 1ITPA 3M6VA 1KWMA 5HJYA 3SCJE 4Y2IA 1VQKS 5HQLA 3UPFA 5HROB 3WC2A 4JI5F 3MM6A 2FIUA 1VQSA 2A1BA 1T95A 3DCAA 5DZ7A 2D3UA 1JX4A 1S48A 2CJAA 3QMQA 4MIBA 3SCLE 2VG5B 3SSQA 4F2RA 4DHVA 3RAQA 4DOZA 3C16A 1NK7A 4M8LA 2GVZA 4J9QA 4HDHA 1Y0HA 2DNOA 2VBYA 1Q8LA 3FEXB 3PHEA 4UUWA 3ZZTA 4J9NA 2MQMA 3TWZA 2VOOA 4L73A 1U1MA 4HHJA 4AQYF 1WKLA 3E01A 2BJ9A 3IGVA 2VUGA 1N5TA 2KRBA 2OPQB 2YKMB 3VAHA 2OIHA 1PO6A 5HATA 2V67A 2V8DA 1MROB 2BQUA 2LEBA 4Q8FA 4USKA 1JJHA 2OJ3A 1S59A 1KLNA 1KFSA 1R0CB 2PDAA 1Y7PA 2ZOMA 2YNGB 2CWXA 3I0RA 3THTA 3NS7B 1P8GA 2UVRA 5L46A 3UDVA 4ED3A 4ED6A 3LP0B 1HYSB 2MDAA 3PZPA 3H5SA 3WIUA 2B51A 1VFJA 3VQTA 2DBBA 3HDSA 3KLHA 4M5GA 1ZM4A 2F8EX 1S1XB 2FZGB 3D28A 4MFBB 1D0EA 2BKPA 2IHR1 2RQMA 5FIIA 4HDGA 3RUBL 2A18A 4DCPB 4DX8H 1PBAA 2V34A 4ZJQA 5HMXA 3R7BB 4U7CA 2Q66A 1T05A 1QD1A 3DOKA 4DUTA 2B4VA 5ITHA 3CF5Q 2CPHA 2BR0A 4NCAA 2RRAA 3NNAA 2VPYB 2AWZA 3BGRB 1APSA 1WKKA 4KO0A 1FRKA 1N0UA 4B9NA 3HCXA 2ZBRA 3M8PA 3FDSA 4YB7A 5H9FK 2O5DA 5IWAF 3A3PB 5GMEA 4CLUA 3DLKA 5CYMB 7FDRA 1VI7A 3I4HX 2PT0A 4FPIA 5E41A 1NZAA 5DRKA 5M2PA 2FGCA 4N8NA 3SFGA 3J7Z5 1SKWA 1CLFA 2JOQA 4CLPA 1IR2A 1NJZA 4KHMA 4P52A 3EDRB 4DV2F 1NPPA 4L3KA 3H2UB 4B3MJ 1UTAA 3DDIA 3F0NA 1NKCA 3PXGa 4WP9A 2CDQA 4LSLB 4ED8A 1HI1A 2JH3A 1ZA1B 4MTPA 2JWNA 2JL9A 3ET6A 1QUPA 3UD5A 4CTAB 3KJVA 4ELTA 2HWIA 1P1LA 1HNWF 1Z2LA 3H8YA 1EZZB 2CPEA 4Y2CA 3KLGB 4LR9A 3H40A 1RJJA 3W8PA 1HNXF 1S6QB 3ZZYA 2DD8S 5K8OA 4DR2J 1CSJA 2HQGA 2M70A 3A3NB 1BQMA 1YJNS 4ATNA 1AT1B 3R1HA 2FVRA 3DLGA 4EI2A 1RWVB 2MZRA 4LF4J 1C0UB 3ISND 4K0KJ 4WWSA 1B7YB 1H6KX 1AROP 2EKYA 3DOLB 4ZPTR 1N0VC 2F5GA 2OMLA 2EK6A 3AY0A 4ICLA 2I6WA 3UNGC 2RU3A 4I4BA 1X0PA 2A0FB 4PG5A 1TVRB 2KZZA 3I0SA 3T9NA 1RA7A 1JLBB 4YN3B 4ZVRB 2HFSA 4OYMA 2HNYA 1VQYA 2YWKA 4A8WA 1RT5A 2HMIA 1L3UA 2AGPA 4LUBA 1MNEA 2MQPA 2KHCA 2Z2MA 3DI6B 4U9RA 3X3UA 2FC8A 2GZOA 1HQUA 5A0YB 4LQ3A 2DTJA 2R7SA 1U0HA 2NCKL 5SZTA 3FK4A 4CLTA 3DRRA 3HVRA 2DGVA 2VBZA 4JI6J 2VQFJ 3KMQA 5ETTA 1FJEB 1MLAA 4LFBF 2LCWA 3G86A 4P75A 2ACYA 4C6AA 5B0CA 1DLOB 1OQ6A 4RBUA 3QT8A 2JC1A 5CCLA 2V68A 4YB1P 4DV4J 4G1IA 4ED1A 3ZNUA 1RKJA 2DXEA 4LF6F 4V19J 1CVJA 3T3FA 2VV5A 3KNGA 3QZ8A 1LWXA 2ABYA 3KKFA 3R7SB 5EWFA 2DK2A 2IAJA 2UV8A 4DFMA 3A1YG 3V5RA 3KLIB 4IYQA 1AB8A 4WK3A 4QIFA 4AT1B 4CO1A 2ADBA 2KHDA 1HL6A 3I96A 4FYDA 3IXQA 3DOKB 2VONA 2B5JA 4OI3A 1KTVA 3MM7B 5GMKa 2EBGA 2FB0A 1NEEA 2LFVA 2LU2A 1LK7A 1NPRA 3FZ2A 3EZ5A 3OTEA 3ENQA 1P27B
chains in the Genus database with same CATH topology
4DR7F 1R8PA 1ZAXA 1M5OC 2HNYB 1QAJA 2EK1A 1TR0A 3GZ7A 3N79A 1S6PA 3FRZA 3Q24A 1FRHA 2W24A 2WOMB 1HA1A 2QYCA 3LALA 4FF3A 2MQQA 1PILA 3MECB 4OI1A 2DCUB 4KR0B 1FD2A 2P9EA 2LDIA 1Q1KA 3MCSA 4X4NA 5LSOA 2MQNA 4NWBA 4ZS6A 2ZOGA 1UAWA 1VK3A 1DAXA 1RAJA 3FMWA 5E3AA 2XC9A 2YNHB 2CVEA 3G9CA 2ZH8A 4TY8A 4O4GA 2BE2A 4NPOA 4C0HA 1LFPA 4D3HA 1XMQF 4I69A 3LAKA 2BRLA 3DXBA 3K2YA 1HMVA 1MMDA 1U6ZA 1SJFA 4EZ9A 2RQKA 4KFBA 1SV5A 4AL6A 2DH7A 2UVUA 3TA1A 1AXQA 2YWFA 2IA6A 3UR3C 4I0WA 1I94F 1JNZB 1HBOB 2K3KA 1D3WA 3MUTP 5IM0B 4JI3F 2RKIB 4OZ0A 3GB0A 1S1WA 2D7SA 4X64F 2ASJA 1T05B 4I56A 2KJWA 3Q23A 3HHNB 2VFUA 2VFTA 3M1VA 5KFZA 6FDRA 1TAQA 4URGA 3RRHA 3S6EA 2R7TA 4OLOA 3BZQA 3KLHB 1Q8IA 3H4DA 1R31A 4C0BA 5LJ5Y 1UETA 5D3GB 2HG4A 3R1LA 1HYSA 1YI2S 2DH9A 3GSDA 4UQTA 5DG8A 2LEAA 4GC6A 1LWCB 3TAMA 4U7UK 2CQHA 2LEPA 3GFZA 5J2QA 1PGZA 1J2VA 4O3NA 2QE5A 3P3DA 4OI4A 4TYAA 1R8AA 5L39A 4X65F 4DL7A 2EFVA 5KTQA 2DJWA 4B9SA 3LWLA 1TK5A 5D4LA 3QAEA 4JI2F 1QLNA 5HBMA 5H9FJ 2P5VA 4B3TF 4GKJF 2FLLA 4L6V3 3DHWC 2PI5A 4ZK7M 2KVIA 4ID5B 4K5SA 3LP1A 3TA2A 2VG7A 1QE1B 1TL1A 2JDJA 3ZZOA 1Z4UA 4M5DA 1GT8A 4NLRA 5B08A 4MK7A 1C0TA 4PRFA 1RKIA 4RW9A 1R0AB 4QWDA 2GQQA 4PXEA 4DSIA 1FF2A 4CTAA 4DWIA 1RT3B 1X4FA 5FDLA 4R0EA 5K5MA 2Q6CA 1FKPB 2XMJA 3T1HF 2DPJA 3GIMA 4MKBA 1GQEA 2PIIA 4ECYA 2JHEA 3PX4A 3PW0A 1QSLA 2NPIA 2EPIA 3BR8A 1OO0B 3IA0A 5A8RB 2NR0A 1TZ0A 3GG1A 3M6XA 2XMMA 2HGMA 4RW9B 2YNHA 3CJ5A 2EI5A 3DRSB 1S97A 4RNFA 3I4PA 1KNZA 4K4WA 4ZCKA 3UWTA 3CC2S 2DISA 3LP1B 3CCRS 3K0JA 1WF1A 3N6LA 5CZVA 5E5NA 2O1PA 2R2UA 2FJVA 4XPCA 4CO3A 3CWJA 3ENWA 5DDPC 1TL3A 4LSNA 4OHXA 1IBMF 4DN0A 1DRZA 4PG8A 1RT6A 5GVQA 1U2RA 4C3LA 2V4QA 1HPZB 2V9KA 3OSPA 3NMAA 4DSKA 3KHGA 4FXDA 2EFPA 3AH6A 1VQ7S 2NQPA 2FHJD 2QV6A 3QGHA 1ROFA 3TP2A 4FNIA 4QBUA 3BF4A 3CCQS 2B4PA 3GV8B 5EWEA 3HZGA 3M1VB 5AE3A 2ZD1B 4ZMMA 2HZCA 1QVGR 4QIVA 4WFYA 4KB7A 4GMKA 3RW7A 3IWLA 1U49A 2M2BA 3MR6A 1Y3KA 3MPVA 5D4NA 2ZH6A 3DHXA 3VZIA 3JTPA 3TUIC 1R8CA 1YRXA 4USJC 1FJGF 4KQZA 4OJGA 3O1LA 3P96A 1U6FA 4EEYA 5BYSA 2VQFF 1G3OA 4I7FA 3S01A 1VQ4S 3I55S 2B4UA 3EXYA 4I6AA 5L8RC 3TI0A 1FD8A 1FVQA 4LF7F 4Q8EA 3HI9A 4Z37A 1HNVA 2FVCA 5M2UA 3K7RA 2VFRA 2XMWA 3AHPA 5KFGA 4RWXA 1N8RT 3RB4A 2OMOA 5C25A 5F8GA 4A8YA 2JLGA 4ERDA 2DNYA 4RW4A 4IOCQ 3VR1A 2CQBA 1RT7B 2Q79A 1NU4A 1GNKA 3OJUA 1D9AA 2OFGX 3PKMA 4QCLA 3PR4A 1D8ZA 3CSKA 4AE5A 4Q7AA 4H4KA 4ZVGA 3IRXA 2AW0A 4ALZA 4NLQA 3KHLA 1WF0A 3IO1A 4LVNP 3OVBA 3J7A1 1NO8A 3CD5A 3HHDA 4W90B 3O2IA 3DRSA 5KFHA 3VALA 1BQNB 1SIZA 1B64A 3MTJA 2CQPA 1U09A 1VRTB 4ZHRA 3S8SA 1YGYA 4C8KA 2KZMA 4HT5A 3MR2A 3CD6S 1REVB 1I6JA 1QAIA 3HHLC 2RE1A 5KFOA 2HYIB 3KK3A 5KT6A 1S1WB 2ASLA 3G6YA 4WTYA 1KN6A 3NP5A 5J2PB 1UVJA 5LT5A 4X4VA 4WE1B 5HI7A 3MEEB 1JLAA 5CYJA 3OTBA 2VBXA 2HNDB 2M8HA 4ETXA 1Q16B 1VC5A 3PO5A 2ZE2B 3K8VA 4C8MA 4LJMA 3NS5A 3UQSA 3HX9A 3N0VA 3O6QA 3D2WA 2BQRA 1U7LA 3HZEA 4O44B 2CJKA 4BWMA 2PSZA 2OD6A 1NK8A 2EFGA 2KG0A 1FO1A 3V6DB 2C3PA 2JZ5A 5CYQB 4KC5A 1RP5A 2MYFA 2E29A 3MUMP 4B9MA 2ZVSA 5L38A 3KG4A 4MK8A 1UA0A 1X4AA 2FJWA 1YIJS 1OQ3A 3RBEA 5F8MA 2HVIA 3VZHA 4X4OA 2IM0A 4HH0A 3W2VA 4LSLA 2LQJA 3IAS9 3J7ZT 3K8WA 3BDPA 1MMNA 3NS6A 1HARA 2UVVA 1JLQA 4ZDNA 4DBQA 5DLGA 4DSFA 1WNEA 1N48A 3HVWA 3OXLA 2HHXA 3WDOA 2DGSA 1SXLA 2VFSA 2O01C 3VAGA 1AFIA 4ZLPA 5FJ4A 2ZH4A 1ZTTA 5I4MA 1DTQA 5DDQC 5T7LA 4W92B 1WG1A 3W2VB 4USHA 1YSJA 4YR0A 4TQSA 2BQ3A 2I38A 3B78A 1VMBA 2YKNB 1VQPS 1TQLA 3CT9A 3T1AA 4PXBA 3I87A 2JEJA 4MMOA 3I56S 2OKQA 5KFJA 3L3CA 4WF9Q 2LXUA 5CHCB 3MECA 2GNKA 3R5DA 3DN9A 1NKBA 3UDLA 1Q4RA 2VZ9A 3J81Y 3WBZA 1HWKA 3I32A 1OS5A 2VKZG 2N3OA 1KSPA 5E33A 3SXLA 2ADCA 1S6OA 3H2VE 2DT9A 2JLEA 2GW8A 3FSYA 3ZFVA 2R8GA 2HHHF 2M0GB 3QIPA 3UR0A 2ZH7A 2NUHA 2K2PA 1K1QA 1JLFA 2M9KA 3QJPA 1L3TA 5KG5A 3QAUA 2DR9A 3AB2B 1R6YA 1IUJA 2VA2A 1K0VA 2FJBB 1WEYA 3GYXB 2GGPA 3DRPB 2IA0A 1MWZA 4A8OA 5GAEI 2AD9A 1N56A 4QWCA 2JVOA 2AP6A 1VQOS 2HHQA 3Q22A 2GX8A 1GH8A 3LPYA 5D77A 5KFSA 2RVJA 4TY9A 4DFPA 2PFFB 1DQ9A 3MPYA 4FNHA 2JC0A 3V81B 3J80Y 1FDDA 4CO0A 2I5JA 4OJ1A 5LMNF 1UFWA 2BM0A 4IOAQ 4URSA 2UZAA 1HPZA 1HQUB 3HK2A 2GC8A 2MB0B 4F25A 2ZH2A 1B7FA 4ITSA 3JSBA 2HFZA 4ECUA 1HWUA 1JLBA 2FHKA 2MZSA 1MWYA 3OUYB 1U6BA 4OMFG 2X1AA 3P49B 5J1NA 2JEIA 3EX7B 4JV2A 2XZWA 1HWLA 2QMWA 2RIJA 4JI1F 3AQOA 3OFGA 1HBMB 1HBNB 4Q0BB 3FGVA 4I6WA 2DNKA 3NLCA 4ED2A 2KI2A 3NL0A 4I6YA 4F3MA 3FSXA 3RR7A 2HHUA 2IMWP 2BJEA 4QW8A 2YKAA 3QJJA 4RUAA 3JTNA 3LAMA 2E1AA 2RILA 4NYZA 4NLWA 2MXYA 2WBRA 1FA0A 1AFJA 2KM8B 2L9NA 2IJFA 4ZP7A 5EHHA 2VG5A 2DNHA 2NYIA 1FESA 5LSRA 1FXDA 3NRBA 2Y1RI 5HLFA 3QLHA 3D0GE 3CCMS 1QJHA 4O0IA 2DH8A 2IFXA 3WC0A 5EX3A 5KG6A 4HYKA 4RW8A 2C2DA 2BANA 3MAHA 4WFAQ 3VAFA 4HTJA 4FF2A 3QIPB 3HHLB 4HI2A 3G8QA 4L72B 1X5SA 2HLUA 3IRXB 4PWUA 4EO6A 4QR1A 2CJ9A 4U67Q