3MOPG

The ternary death domain complex of myd88, irak4, and irak2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
MGPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Helical assembly in the MyD88-IRAK4-IRAK2 complex in TLR/IL-1R signalling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, immune system
molecule keywords Myeloid differentiation primary response protein MyD88
total genus 27
structure length 107
sequence length 107
chains with identical sequence H, I, J
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 3mopG00
4P4HI 4E9MA 1A1WA 2L6AA 2NZ7A 1DGNA 1N3KA 2OF5A 2HM2Q 4IZ7B 2BBZA 2B1WA 2N83A 4QOBA 1E41A 2DBHA 2N97A 2LWEA 2MS8A 2YQFA 3EZQA 4O6XA 3QF2A 1UCPA 2GF5A 2M5VA 3CL3A 4RHWA 2MB9A 4NQKA 2MS7A 2A5YB 1CY5A 4UZ0A 2P1HA 4M9SA 2YGSA 2MN4A 4LWDA 4I16A 4JUPA 1WXPA 1A1ZA 1NGRA 2LWDA 4N1JA 2DBFA 2KN6A 3MOPK 3EZQB 2A9IA 3MOPA 2YU0A 4A2WA 2KM6A 1FADA 4RHWE 2MPCA 4FH0A 4M9XA 1ICHA 3LQRA 1WMGA 2DBDA 4IZ5E 2N7ZA 1YGOA 3YGSC 1C15A 1E3YA 2D96A 2F1SA 4F42A 2N1FA 4O7QA 2L9MA 2OF5H 2DO9A 2N00A 2O71A 4N1LA 3T6PA 1PN5A 3MOPG 2NSNA 4O9LA 1D2ZB 3KATA 2DBGA 4F44A 4P4HA 4M9ZA 2YVIA 2BBRA 3J6JA 2NAQA 1WH4A 4N1KA 2VGQA 4IZAB 2IB1A 1DDFA 2LS7A 4ZBWA 3YGSP 1Z6TA 3CRDA 2G7RA 4A2QA 2N80A 1D2ZA 4DWNA 4JQWA 4EWIA 4O9FA 3LQQA 4D8OA 3J63A 1CWWA
chains in the Genus database with same CATH superfamily
4P4HI 4E9MA 1A1WA 2L6AA 2NZ7A 1DGNA 1N3KA 2OF5A 2HM2Q 4IZ7B 2BBZA 2B1WA 2N83A 4QOBA 1E41A 2DBHA 2N97A 2LWEA 2MS8A 2YQFA 3EZQA 4O6XA 3QF2A 1UCPA 2GF5A 2M5VA 3CL3A 4RHWA 2MB9A 4NQKA 2MS7A 2A5YB 1CY5A 4UZ0A 2P1HA 4M9SA 2YGSA 2MN4A 4LWDA 4I16A 4JUPA 1WXPA 1A1ZA 1NGRA 2LWDA 4N1JA 2DBFA 2KN6A 3MOPK 2XV9A 3EZQB 2A9IA 3MOPA 2YU0A 4A2WA 2KM6A 1FADA 4RHWE 2MPCA 4FH0A 4M9XA 1ICHA 3LQRA 1WMGA 2DBDA 4IZ5E 2N7ZA 1YGOA 3YGSC 1C15A 1E3YA 2D96A 2F1SA 4F42A 2N1FA 4O7QA 2L9MA 2OF5H 2DO9A 2N00A 2O71A 4N1LA 3T6PA 1PN5A 3MOPG 2NSNA 4O9LA 1D2ZB 2MJMA 3KATA 2DBGA 4F44A 4P4HA 4M9ZA 2YVIA 2BBRA 3J6JA 2NAQA 1WH4A 4N1KA 2VGQA 4IZAB 2IB1A 1DDFA 2LS7A 4ZBWA 3YGSP 1Z6TA 3CRDA 2G7RA 4A2QA 2N80A 1D2ZA 4DWNA 4JQWA 4EWIA 4O9FA 3LQQA 4D8OA 3J63A 1CWWA
chains in the Genus database with same CATH topology
4P4HI 4E9MA 1A1WA 2L6AA 2NZ7A 1DGNA 1N3KA 2OF5A 2HM2Q 4IZ7B 2BBZA 2B1WA 2N83A 4QOBA 1E41A 2DBHA 2N97A 2LWEA 2MS8A 2YQFA 3EZQA 4O6XA 3QF2A 1UCPA 2GF5A 2M5VA 3CL3A 4RHWA 2MB9A 4NQKA 2MS7A 2A5YB 1CY5A 4UZ0A 2P1HA 4M9SA 2YGSA 2MN4A 4LWDA 4I16A 4JUPA 1WXPA 1A1ZA 1NGRA 2LWDA 4N1JA 2DBFA 2KN6A 3MOPK 2XV9A 3EZQB 2A9IA 3MOPA 2YU0A 4A2WA 2KM6A 1FADA 4RHWE 2MPCA 4FH0A 4M9XA 1ICHA 3LQRA 1WMGA 2DBDA 4IZ5E 2N7ZA 1YGOA 3YGSC 1C15A 1E3YA 2D96A 2F1SA 4F42A 2N1FA 4O7QA 2L9MA 2OF5H 2DO9A 2N00A 2O71A 4N1LA 3T6PA 1PN5A 3MOPG 2NSNA 4O9LA 1D2ZB 2MJMA 3KATA 2DBGA 4F44A 4P4HA 4M9ZA 2YVIA 2BBRA 3J6JA 2NAQA 1WH4A 4N1KA 2VGQA 4IZAB 2IB1A 1DDFA 2LS7A 4ZBWA 3YGSP 1Z6TA 3CRDA 2G7RA 4A2QA 2N80A 1D2ZA 4DWNA 4JQWA 4EWIA 4O9FA 3LQQA 4D8OA 3J63A 1CWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4H I;  4E9M A;  1A1W A;  2L6A A;  2NZ7 A;  1DGN A;  1N3K A;  2OF5 A;  2HM2 Q;  4IZ7 B;  2BBZ A;  2B1W A;  2N83 A;  4QOB A;  1E41 A;  2DBH A;  2N97 A;  2LWE A;  2MS8 A;  2YQF A;  3EZQ A;  4O6X A;  3QF2 A;  1UCP A;  2GF5 A;  2M5V A;  3CL3 A;  4RHW A;  2MB9 A;  4NQK A;  2MS7 A;  2A5Y B;  1CY5 A;  4UZ0 A;  2P1H A;  4M9S A;  2YGS A;  2MN4 A;  4LWD A;  4I16 A;  4JUP A;  1WXP A;  1A1Z A;  1NGR A;  2LWD A;  4N1J A;  2DBF A;  2KN6 A;  3MOP K;  3EZQ B;  2A9I A;  3MOP A;  2YU0 A;  4A2W A;  2KM6 A;  1FAD A;  4RHW E;  2MPC A;  4FH0 A;  4M9X A;  1ICH A;  3LQR A;  1WMG A;  2DBD A;  4IZ5 E;  2N7Z A;  1YGO A;  3YGS C;  1C15 A;  1E3Y A;  2D96 A;  2F1S A;  4F42 A;  2N1F A;  4O7Q A;  2L9M A;  2OF5 H;  2DO9 A;  2N00 A;  2O71 A;  4N1L A;  3T6P A;  1PN5 A;  3MOP G;  2NSN A;  4O9L A;  1D2Z B;  3KAT A;  2DBG A;  4F44 A;  4P4H A;  4M9Z A;  2YVI A;  2BBR A;  3J6J A;  2NAQ A;  1WH4 A;  4N1K A;  2VGQ A;  4IZA B;  2IB1 A;  1DDF A;  2LS7 A;  4ZBW A;  3YGS P;  1Z6T A;  3CRD A;  2G7R A;  4A2Q A;  2N80 A;  1D2Z A;  4DWN A;  4JQW A;  4EWI A;  4O9F A;  3LQQ A;  4D8O A;  3J63 A;  1CWW A; 
#chains in the Genus database with same CATH topology
 4P4H I;  4E9M A;  1A1W A;  2L6A A;  2NZ7 A;  1DGN A;  1N3K A;  2OF5 A;  2HM2 Q;  4IZ7 B;  2BBZ A;  2B1W A;  2N83 A;  4QOB A;  1E41 A;  2DBH A;  2N97 A;  2LWE A;  2MS8 A;  2YQF A;  3EZQ A;  4O6X A;  3QF2 A;  1UCP A;  2GF5 A;  2M5V A;  3CL3 A;  4RHW A;  2MB9 A;  4NQK A;  2MS7 A;  2A5Y B;  1CY5 A;  4UZ0 A;  2P1H A;  4M9S A;  2YGS A;  2MN4 A;  4LWD A;  4I16 A;  4JUP A;  1WXP A;  1A1Z A;  1NGR A;  2LWD A;  4N1J A;  2DBF A;  2KN6 A;  3MOP K;  2XV9 A;  3EZQ B;  2A9I A;  3MOP A;  2YU0 A;  4A2W A;  2KM6 A;  1FAD A;  4RHW E;  2MPC A;  4FH0 A;  4M9X A;  1ICH A;  3LQR A;  1WMG A;  2DBD A;  4IZ5 E;  2N7Z A;  1YGO A;  3YGS C;  1C15 A;  1E3Y A;  2D96 A;  2F1S A;  4F42 A;  2N1F A;  4O7Q A;  2L9M A;  2OF5 H;  2DO9 A;  2N00 A;  2O71 A;  4N1L A;  3T6P A;  1PN5 A;  3MOP G;  2NSN A;  4O9L A;  1D2Z B;  2MJM A;  3KAT A;  2DBG A;  4F44 A;  4P4H A;  4M9Z A;  2YVI A;  2BBR A;  3J6J A;  2NAQ A;  1WH4 A;  4N1K A;  2VGQ A;  4IZA B;  2IB1 A;  1DDF A;  2LS7 A;  4ZBW A;  3YGS P;  1Z6T A;  3CRD A;  2G7R A;  4A2Q A;  2N80 A;  1D2Z A;  4DWN A;  4JQW A;  4EWI A;  4O9F A;  3LQQ A;  4D8O A;  3J63 A;  1CWW A; 
#chains in the Genus database with same CATH homology
 4P4H I;  4E9M A;  1A1W A;  2L6A A;  2NZ7 A;  1DGN A;  1N3K A;  2OF5 A;  2HM2 Q;  4IZ7 B;  2BBZ A;  2B1W A;  2N83 A;  4QOB A;  1E41 A;  2DBH A;  2N97 A;  2LWE A;  2MS8 A;  2YQF A;  3EZQ A;  4O6X A;  3QF2 A;  1UCP A;  2GF5 A;  2M5V A;  3CL3 A;  4RHW A;  2MB9 A;  4NQK A;  2MS7 A;  2A5Y B;  1CY5 A;  4UZ0 A;  2P1H A;  4M9S A;  2YGS A;  2MN4 A;  4LWD A;  4I16 A;  4JUP A;  1WXP A;  1A1Z A;  1NGR A;  2LWD A;  4N1J A;  2DBF A;  2KN6 A;  3MOP K;  2XV9 A;  3EZQ B;  2A9I A;  3MOP A;  2YU0 A;  4A2W A;  2KM6 A;  1FAD A;  4RHW E;  2MPC A;  4FH0 A;  4M9X A;  1ICH A;  3LQR A;  1WMG A;  2DBD A;  4IZ5 E;  2N7Z A;  1YGO A;  3YGS C;  1C15 A;  1E3Y A;  2D96 A;  2F1S A;  4F42 A;  2N1F A;  4O7Q A;  2L9M A;  2OF5 H;  2DO9 A;  2N00 A;  2O71 A;  4N1L A;  3T6P A;  1PN5 A;  3MOP G;  2NSN A;  4O9L A;  1D2Z B;  2MJM A;  3KAT A;  2DBG A;  4F44 A;  4P4H A;  4M9Z A;  2YVI A;  2BBR A;  3J6J A;  2NAQ A;  1WH4 A;  4N1K A;  2VGQ A;  4IZA B;  2IB1 A;  1DDF A;  2LS7 A;  4ZBW A;  3YGS P;  1Z6T A;  3CRD A;  2G7R A;  4A2Q A;  2N80 A;  1D2Z A;  4DWN A;  4JQW A;  4EWI A;  4O9F A;  3LQQ A;  4D8O A;  3J63 A;  1CWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...