3MOPK

The ternary death domain complex of myd88, irak4, and irak2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
93
structure length
93
Chain Sequence
ACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMEWVQGVSITRELLWWWGMRQATVQQLVDLLCRLELYRAAQIILNWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Helical assembly in the MyD88-IRAK4-IRAK2 complex in TLR/IL-1R signalling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, immune system
molecule keywords Myeloid differentiation primary response protein MyD88
total genus 25
structure length 93
sequence length 93
chains with identical sequence L, M, N
ec nomenclature
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00531 Death Death domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 3mopK00
4LWDA 2N1FA 2MPCA 2F1SA 2OF5A 1N3KA 2HM2Q 4F42A 2DBDA 2O71A 4UZ0A 1WXPA 4E9MA 4DWNA 1YGOA 1D2ZA 3EZQB 4JQWA 3YGSC 3CRDA 2DBHA 1C15A 4M9SA 2N97A 2KN6A 2P1HA 4EWIA 4M9ZA 4FH0A 2YVIA 3KATA 4NQKA 4M9XA 2BBRA 2NSNA 2M5VA 2A9IA 4N1KA 3QF2A 2OF5H 1UCPA 4IZ7B 2YQFA 4JUPA 3T6PA 4O9FA 2L6AA 1NGRA 1Z6TA 2LWDA 2N83A 4ZBWA 4O7QA 2N80A 2DBGA 4P4HA 1DGNA 4O6XA 2LS7A 2G7RA 2GF5A 1D2ZB 1FADA 4RHWE 2BBZA 4I16A 3MOPK 2N7ZA 4O9LA 1DDFA 4A2QA 4P4HI 3MOPA 2MS8A 1CY5A 2KM6A 3J6JA 4A2WA 4IZAB 2MS7A 2N00A 2YU0A 2MN4A 4D8OA 4N1JA 4IZ5E 4QOBA 1A1ZA 1WH4A 3LQQA 2VGQA 2NAQA 2NZ7A 4RHWA 3EZQA 1WMGA 2B1WA 4F44A 3LQRA 1ICHA 1E41A 2MB9A 1PN5A 1CWWA 2L9MA 1A1WA 2DO9A 2DBFA 3J63A 3YGSP 2A5YB 1E3YA 4N1LA 2IB1A 2YGSA 3CL3A 2D96A 3MOPG 2LWEA
chains in the Genus database with same CATH superfamily
4LWDA 2N1FA 2MPCA 2XV9A 2F1SA 2OF5A 1N3KA 2HM2Q 4F42A 2DBDA 2O71A 4UZ0A 1WXPA 4E9MA 4DWNA 1YGOA 1D2ZA 3EZQB 4JQWA 3YGSC 3CRDA 2DBHA 1C15A 4M9SA 2KN6A 2N97A 2P1HA 4EWIA 4M9ZA 4FH0A 2YVIA 3KATA 4NQKA 4M9XA 2BBRA 2NSNA 2M5VA 2A9IA 4N1KA 3QF2A 2OF5H 1UCPA 4IZ7B 2YQFA 4JUPA 3T6PA 4O9FA 2L6AA 1NGRA 1Z6TA 2LWDA 2N83A 4ZBWA 4O7QA 2N80A 2DBGA 4P4HA 1DGNA 4O6XA 2LS7A 2G7RA 2GF5A 1D2ZB 1FADA 4RHWE 2BBZA 4I16A 3MOPK 2N7ZA 4O9LA 1DDFA 4A2QA 4P4HI 3MOPA 2MS8A 1CY5A 2KM6A 3J6JA 4A2WA 4IZAB 2MS7A 2N00A 2YU0A 2MN4A 4D8OA 4N1JA 4IZ5E 4QOBA 1A1ZA 1WH4A 3LQQA 2VGQA 2NAQA 2NZ7A 4RHWA 3EZQA 1WMGA 2B1WA 4F44A 3LQRA 1ICHA 1E41A 2MB9A 1PN5A 1CWWA 2L9MA 1A1WA 2DO9A 2DBFA 3J63A 3YGSP 2A5YB 1E3YA 4N1LA 2IB1A 2YGSA 3CL3A 2D96A 3MOPG 2LWEA 2MJMA
chains in the Genus database with same CATH topology
4LWDA 2N1FA 2MPCA 2XV9A 2F1SA 2OF5A 1N3KA 2HM2Q 4F42A 2DBDA 2O71A 4UZ0A 1WXPA 4E9MA 4DWNA 1YGOA 1D2ZA 3EZQB 4JQWA 3YGSC 3CRDA 2DBHA 1C15A 4M9SA 2KN6A 2N97A 2P1HA 4EWIA 4M9ZA 4FH0A 2YVIA 3KATA 4NQKA 4M9XA 2BBRA 2NSNA 2M5VA 2A9IA 4N1KA 3QF2A 2OF5H 1UCPA 4IZ7B 2YQFA 4JUPA 3T6PA 4O9FA 2L6AA 1NGRA 1Z6TA 2LWDA 2N83A 4ZBWA 4O7QA 2N80A 2DBGA 4P4HA 1DGNA 4O6XA 2LS7A 2G7RA 2GF5A 1D2ZB 1FADA 4RHWE 2BBZA 4I16A 3MOPK 2N7ZA 4O9LA 1DDFA 4A2QA 4P4HI 3MOPA 2MS8A 1CY5A 2KM6A 3J6JA 4A2WA 4IZAB 2MS7A 2N00A 2YU0A 2MN4A 4D8OA 4N1JA 4IZ5E 4QOBA 1A1ZA 1WH4A 3LQQA 2VGQA 2NAQA 2NZ7A 4RHWA 3EZQA 1WMGA 2B1WA 4F44A 3LQRA 1ICHA 1E41A 2MB9A 1PN5A 1CWWA 2L9MA 1A1WA 2DO9A 2DBFA 3J63A 3YGSP 2A5YB 1E3YA 4N1LA 2IB1A 2YGSA 3CL3A 2D96A 3MOPG 2LWEA 2MJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LWD A;  2N1F A;  2MPC A;  2F1S A;  2OF5 A;  1N3K A;  2HM2 Q;  4F42 A;  2DBD A;  2O71 A;  4UZ0 A;  1WXP A;  4E9M A;  4DWN A;  1YGO A;  1D2Z A;  3EZQ B;  4JQW A;  3YGS C;  3CRD A;  2DBH A;  1C15 A;  4M9S A;  2N97 A;  2KN6 A;  2P1H A;  4EWI A;  4M9Z A;  4FH0 A;  2YVI A;  3KAT A;  4NQK A;  4M9X A;  2BBR A;  2NSN A;  2M5V A;  2A9I A;  4N1K A;  3QF2 A;  2OF5 H;  1UCP A;  4IZ7 B;  2YQF A;  4JUP A;  3T6P A;  4O9F A;  2L6A A;  1NGR A;  1Z6T A;  2LWD A;  2N83 A;  4ZBW A;  4O7Q A;  2N80 A;  2DBG A;  4P4H A;  1DGN A;  4O6X A;  2LS7 A;  2G7R A;  2GF5 A;  1D2Z B;  1FAD A;  4RHW E;  2BBZ A;  4I16 A;  3MOP K;  2N7Z A;  4O9L A;  1DDF A;  4A2Q A;  4P4H I;  3MOP A;  2MS8 A;  1CY5 A;  2KM6 A;  3J6J A;  4A2W A;  4IZA B;  2MS7 A;  2N00 A;  2YU0 A;  2MN4 A;  4D8O A;  4N1J A;  4IZ5 E;  4QOB A;  1A1Z A;  1WH4 A;  3LQQ A;  2VGQ A;  2NAQ A;  2NZ7 A;  4RHW A;  3EZQ A;  1WMG A;  2B1W A;  4F44 A;  3LQR A;  1ICH A;  1E41 A;  2MB9 A;  1PN5 A;  1CWW A;  2L9M A;  1A1W A;  2DO9 A;  2DBF A;  3J63 A;  3YGS P;  2A5Y B;  1E3Y A;  4N1L A;  2IB1 A;  2YGS A;  3CL3 A;  2D96 A;  3MOP G;  2LWE A; 
#chains in the Genus database with same CATH topology
 4LWD A;  2N1F A;  2MPC A;  2XV9 A;  2F1S A;  2OF5 A;  1N3K A;  2HM2 Q;  4F42 A;  2DBD A;  2O71 A;  4UZ0 A;  1WXP A;  4E9M A;  4DWN A;  1YGO A;  1D2Z A;  3EZQ B;  4JQW A;  3YGS C;  3CRD A;  2DBH A;  1C15 A;  4M9S A;  2KN6 A;  2N97 A;  2P1H A;  4EWI A;  4M9Z A;  4FH0 A;  2YVI A;  3KAT A;  4NQK A;  4M9X A;  2BBR A;  2NSN A;  2M5V A;  2A9I A;  4N1K A;  3QF2 A;  2OF5 H;  1UCP A;  4IZ7 B;  2YQF A;  4JUP A;  3T6P A;  4O9F A;  2L6A A;  1NGR A;  1Z6T A;  2LWD A;  2N83 A;  4ZBW A;  4O7Q A;  2N80 A;  2DBG A;  4P4H A;  1DGN A;  4O6X A;  2LS7 A;  2G7R A;  2GF5 A;  1D2Z B;  1FAD A;  4RHW E;  2BBZ A;  4I16 A;  3MOP K;  2N7Z A;  4O9L A;  1DDF A;  4A2Q A;  4P4H I;  3MOP A;  2MS8 A;  1CY5 A;  2KM6 A;  3J6J A;  4A2W A;  4IZA B;  2MS7 A;  2N00 A;  2YU0 A;  2MN4 A;  4D8O A;  4N1J A;  4IZ5 E;  4QOB A;  1A1Z A;  1WH4 A;  3LQQ A;  2VGQ A;  2NAQ A;  2NZ7 A;  4RHW A;  3EZQ A;  1WMG A;  2B1W A;  4F44 A;  3LQR A;  1ICH A;  1E41 A;  2MB9 A;  1PN5 A;  1CWW A;  2L9M A;  1A1W A;  2DO9 A;  2DBF A;  3J63 A;  3YGS P;  2A5Y B;  1E3Y A;  4N1L A;  2IB1 A;  2YGS A;  3CL3 A;  2D96 A;  3MOP G;  2LWE A;  2MJM A; 
#chains in the Genus database with same CATH homology
 4LWD A;  2N1F A;  2MPC A;  2XV9 A;  2F1S A;  2OF5 A;  1N3K A;  2HM2 Q;  4F42 A;  2DBD A;  2O71 A;  4UZ0 A;  1WXP A;  4E9M A;  4DWN A;  1YGO A;  1D2Z A;  3EZQ B;  4JQW A;  3YGS C;  3CRD A;  2DBH A;  1C15 A;  4M9S A;  2KN6 A;  2N97 A;  2P1H A;  4EWI A;  4M9Z A;  4FH0 A;  2YVI A;  3KAT A;  4NQK A;  4M9X A;  2BBR A;  2NSN A;  2M5V A;  2A9I A;  4N1K A;  3QF2 A;  2OF5 H;  1UCP A;  4IZ7 B;  2YQF A;  4JUP A;  3T6P A;  4O9F A;  2L6A A;  1NGR A;  1Z6T A;  2LWD A;  2N83 A;  4ZBW A;  4O7Q A;  2N80 A;  2DBG A;  4P4H A;  1DGN A;  4O6X A;  2LS7 A;  2G7R A;  2GF5 A;  1D2Z B;  1FAD A;  4RHW E;  2BBZ A;  4I16 A;  3MOP K;  2N7Z A;  4O9L A;  1DDF A;  4A2Q A;  4P4H I;  3MOP A;  2MS8 A;  1CY5 A;  2KM6 A;  3J6J A;  4A2W A;  4IZA B;  2MS7 A;  2N00 A;  2YU0 A;  2MN4 A;  4D8O A;  4N1J A;  4IZ5 E;  4QOB A;  1A1Z A;  1WH4 A;  3LQQ A;  2VGQ A;  2NAQ A;  2NZ7 A;  4RHW A;  3EZQ A;  1WMG A;  2B1W A;  4F44 A;  3LQR A;  1ICH A;  1E41 A;  2MB9 A;  1PN5 A;  1CWW A;  2L9M A;  1A1W A;  2DO9 A;  2DBF A;  3J63 A;  3YGS P;  2A5Y B;  1E3Y A;  4N1L A;  2IB1 A;  2YGS A;  3CL3 A;  2D96 A;  3MOP G;  2LWE A;  2MJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...