3MOPK

The ternary death domain complex of myd88, irak4, and irak2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
93
structure length
93
Chain Sequence
ACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMEWVQGVSITRELLWWWGMRQATVQQLVDLLCRLELYRAAQIILNWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Helical assembly in the MyD88-IRAK4-IRAK2 complex in TLR/IL-1R signalling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, immune system
molecule keywords Myeloid differentiation primary response protein MyD88
total genus 25
structure length 93
sequence length 93
chains with identical sequence L, M, N
ec nomenclature
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00531 Death Death domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 3mopK00
2YQFA 4NQKA 2OF5H 1WH4A 2OF5A 2A5YB 2GF5A 4DWNA 3CRDA 4F42A 1NGRA 3EZQB 2N80A 2NAQA 3MOPK 2DBFA 3LQQA 2O71A 4LWDA 4ZBWA 3LQRA 4I16A 4O9LA 3J6JA 2LWDA 1A1ZA 4O7QA 3KATA 1D2ZA 1WMGA 4N1KA 2DO9A 2YGSA 4UZ0A 2N7ZA 4D8OA 3QF2A 2DBHA 2HM2Q 1C15A 4O9FA 2A9IA 4A2WA 1CWWA 3J63A 4A2QA 2G7RA 2LWEA 4P4HI 1YGOA 2YU0A 2D96A 3T6PA 2KN6A 4JUPA 2L6AA 1PN5A 4FH0A 2MS8A 1E3YA 2NSNA 4IZ5E 2N83A 2DBGA 1N3KA 1ICHA 2MB9A 4P4HA 1WXPA 3EZQA 4IZAB 2B1WA 1E41A 4JQWA 2IB1A 2MN4A 4F44A 1DDFA 2YVIA 4N1LA 2BBZA 2N00A 3MOPG 1D2ZB 3YGSP 1FADA 1UCPA 2F1SA 4QOBA 1A1WA 2KM6A 3CL3A 2M5VA 2L9MA 4M9XA 2NZ7A 2P1HA 3MOPA 4E9MA 4EWIA 2N1FA 3YGSC 2VGQA 4M9ZA 4O6XA 2LS7A 2MPCA 4RHWE 2N97A 4M9SA 2MS7A 1Z6TA 4N1JA 4IZ7B 2DBDA 2BBRA 1DGNA 1CY5A 4RHWA
chains in the Genus database with same CATH superfamily
2YQFA 4NQKA 2OF5H 1WH4A 2OF5A 2A5YB 2GF5A 4DWNA 3CRDA 4F42A 1NGRA 3EZQB 2N80A 2NAQA 3MOPK 2DBFA 3LQQA 2O71A 4LWDA 4ZBWA 3LQRA 4I16A 4O9LA 3J6JA 2LWDA 1A1ZA 4O7QA 3KATA 1D2ZA 1WMGA 4N1KA 2DO9A 2XV9A 2YGSA 4UZ0A 2N7ZA 4D8OA 3QF2A 2DBHA 2HM2Q 1C15A 4O9FA 2A9IA 4A2WA 1CWWA 3J63A 4A2QA 2G7RA 2LWEA 4P4HI 1YGOA 2YU0A 2D96A 3T6PA 2KN6A 4JUPA 2L6AA 1PN5A 4FH0A 2MS8A 1E3YA 2NSNA 4IZ5E 2N83A 2DBGA 1N3KA 1ICHA 2MB9A 4P4HA 1WXPA 3EZQA 4IZAB 2B1WA 1E41A 4JQWA 2IB1A 2MN4A 4F44A 1DDFA 2YVIA 4N1LA 2BBZA 2N00A 3MOPG 1D2ZB 3YGSP 1FADA 1UCPA 2F1SA 4QOBA 1A1WA 2KM6A 3CL3A 2M5VA 2L9MA 4M9XA 2NZ7A 2P1HA 3MOPA 4E9MA 4EWIA 2N1FA 3YGSC 2VGQA 4M9ZA 4O6XA 2LS7A 2MPCA 4RHWE 2N97A 4M9SA 2MS7A 1Z6TA 4N1JA 4IZ7B 2DBDA 2BBRA 1DGNA 2MJMA 1CY5A 4RHWA
chains in the Genus database with same CATH topology
2YQFA 4NQKA 2OF5H 1WH4A 2OF5A 2A5YB 2GF5A 4DWNA 3CRDA 4F42A 1NGRA 3EZQB 2N80A 2NAQA 3MOPK 2DBFA 3LQQA 2O71A 4LWDA 4ZBWA 3LQRA 4I16A 4O9LA 3J6JA 2LWDA 1A1ZA 4O7QA 3KATA 1D2ZA 1WMGA 4N1KA 2DO9A 2XV9A 2YGSA 4UZ0A 2N7ZA 4D8OA 3QF2A 2DBHA 2HM2Q 1C15A 4O9FA 2A9IA 4A2WA 1CWWA 3J63A 4A2QA 2G7RA 2LWEA 4P4HI 1YGOA 2YU0A 2D96A 3T6PA 2KN6A 4JUPA 2L6AA 1PN5A 4FH0A 2MS8A 1E3YA 2NSNA 4IZ5E 2N83A 2DBGA 1N3KA 1ICHA 2MB9A 4P4HA 1WXPA 3EZQA 4IZAB 2B1WA 1E41A 4JQWA 2IB1A 2MN4A 4F44A 1DDFA 2YVIA 4N1LA 2BBZA 2N00A 3MOPG 1D2ZB 3YGSP 1FADA 1UCPA 2F1SA 4QOBA 1A1WA 2KM6A 3CL3A 2M5VA 2L9MA 4M9XA 2NZ7A 2P1HA 3MOPA 4E9MA 4EWIA 2N1FA 3YGSC 2VGQA 4M9ZA 4O6XA 2LS7A 2MPCA 4RHWE 2N97A 4M9SA 2MS7A 1Z6TA 4N1JA 4IZ7B 2DBDA 2BBRA 1DGNA 2MJMA 1CY5A 4RHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQF A;  4NQK A;  2OF5 H;  1WH4 A;  2OF5 A;  2A5Y B;  2GF5 A;  4DWN A;  3CRD A;  4F42 A;  1NGR A;  3EZQ B;  2N80 A;  2NAQ A;  3MOP K;  2DBF A;  3LQQ A;  2O71 A;  4LWD A;  4ZBW A;  3LQR A;  4I16 A;  4O9L A;  3J6J A;  2LWD A;  1A1Z A;  4O7Q A;  3KAT A;  1D2Z A;  1WMG A;  4N1K A;  2DO9 A;  2YGS A;  4UZ0 A;  2N7Z A;  4D8O A;  3QF2 A;  2DBH A;  2HM2 Q;  1C15 A;  4O9F A;  2A9I A;  4A2W A;  1CWW A;  3J63 A;  4A2Q A;  2G7R A;  2LWE A;  4P4H I;  1YGO A;  2YU0 A;  2D96 A;  3T6P A;  2KN6 A;  4JUP A;  2L6A A;  1PN5 A;  4FH0 A;  2MS8 A;  1E3Y A;  2NSN A;  4IZ5 E;  2N83 A;  2DBG A;  1N3K A;  1ICH A;  2MB9 A;  4P4H A;  1WXP A;  3EZQ A;  4IZA B;  2B1W A;  1E41 A;  4JQW A;  2IB1 A;  2MN4 A;  4F44 A;  1DDF A;  2YVI A;  4N1L A;  2BBZ A;  2N00 A;  3MOP G;  1D2Z B;  3YGS P;  1FAD A;  1UCP A;  2F1S A;  4QOB A;  1A1W A;  2KM6 A;  3CL3 A;  2M5V A;  2L9M A;  4M9X A;  2NZ7 A;  2P1H A;  3MOP A;  4E9M A;  4EWI A;  2N1F A;  3YGS C;  2VGQ A;  4M9Z A;  4O6X A;  2LS7 A;  2MPC A;  4RHW E;  2N97 A;  4M9S A;  2MS7 A;  1Z6T A;  4N1J A;  4IZ7 B;  2DBD A;  2BBR A;  1DGN A;  1CY5 A;  4RHW A; 
#chains in the Genus database with same CATH topology
 2YQF A;  4NQK A;  2OF5 H;  1WH4 A;  2OF5 A;  2A5Y B;  2GF5 A;  4DWN A;  3CRD A;  4F42 A;  1NGR A;  3EZQ B;  2N80 A;  2NAQ A;  3MOP K;  2DBF A;  3LQQ A;  2O71 A;  4LWD A;  4ZBW A;  3LQR A;  4I16 A;  4O9L A;  3J6J A;  2LWD A;  1A1Z A;  4O7Q A;  3KAT A;  1D2Z A;  1WMG A;  4N1K A;  2DO9 A;  2XV9 A;  2YGS A;  4UZ0 A;  2N7Z A;  4D8O A;  3QF2 A;  2DBH A;  2HM2 Q;  1C15 A;  4O9F A;  2A9I A;  4A2W A;  1CWW A;  3J63 A;  4A2Q A;  2G7R A;  2LWE A;  4P4H I;  1YGO A;  2YU0 A;  2D96 A;  3T6P A;  2KN6 A;  4JUP A;  2L6A A;  1PN5 A;  4FH0 A;  2MS8 A;  1E3Y A;  2NSN A;  4IZ5 E;  2N83 A;  2DBG A;  1N3K A;  1ICH A;  2MB9 A;  4P4H A;  1WXP A;  3EZQ A;  4IZA B;  2B1W A;  1E41 A;  4JQW A;  2IB1 A;  2MN4 A;  4F44 A;  1DDF A;  2YVI A;  4N1L A;  2BBZ A;  2N00 A;  3MOP G;  1D2Z B;  3YGS P;  1FAD A;  1UCP A;  2F1S A;  4QOB A;  1A1W A;  2KM6 A;  3CL3 A;  2M5V A;  2L9M A;  4M9X A;  2NZ7 A;  2P1H A;  3MOP A;  4E9M A;  4EWI A;  2N1F A;  3YGS C;  2VGQ A;  4M9Z A;  4O6X A;  2LS7 A;  2MPC A;  4RHW E;  2N97 A;  4M9S A;  2MS7 A;  1Z6T A;  4N1J A;  4IZ7 B;  2DBD A;  2BBR A;  1DGN A;  2MJM A;  1CY5 A;  4RHW A; 
#chains in the Genus database with same CATH homology
 2YQF A;  4NQK A;  2OF5 H;  1WH4 A;  2OF5 A;  2A5Y B;  2GF5 A;  4DWN A;  3CRD A;  4F42 A;  1NGR A;  3EZQ B;  2N80 A;  2NAQ A;  3MOP K;  2DBF A;  3LQQ A;  2O71 A;  4LWD A;  4ZBW A;  3LQR A;  4I16 A;  4O9L A;  3J6J A;  2LWD A;  1A1Z A;  4O7Q A;  3KAT A;  1D2Z A;  1WMG A;  4N1K A;  2DO9 A;  2XV9 A;  2YGS A;  4UZ0 A;  2N7Z A;  4D8O A;  3QF2 A;  2DBH A;  2HM2 Q;  1C15 A;  4O9F A;  2A9I A;  4A2W A;  1CWW A;  3J63 A;  4A2Q A;  2G7R A;  2LWE A;  4P4H I;  1YGO A;  2YU0 A;  2D96 A;  3T6P A;  2KN6 A;  4JUP A;  2L6A A;  1PN5 A;  4FH0 A;  2MS8 A;  1E3Y A;  2NSN A;  4IZ5 E;  2N83 A;  2DBG A;  1N3K A;  1ICH A;  2MB9 A;  4P4H A;  1WXP A;  3EZQ A;  4IZA B;  2B1W A;  1E41 A;  4JQW A;  2IB1 A;  2MN4 A;  4F44 A;  1DDF A;  2YVI A;  4N1L A;  2BBZ A;  2N00 A;  3MOP G;  1D2Z B;  3YGS P;  1FAD A;  1UCP A;  2F1S A;  4QOB A;  1A1W A;  2KM6 A;  3CL3 A;  2M5V A;  2L9M A;  4M9X A;  2NZ7 A;  2P1H A;  3MOP A;  4E9M A;  4EWI A;  2N1F A;  3YGS C;  2VGQ A;  4M9Z A;  4O6X A;  2LS7 A;  2MPC A;  4RHW E;  2N97 A;  4M9S A;  2MS7 A;  1Z6T A;  4N1J A;  4IZ7 B;  2DBD A;  2BBR A;  1DGN A;  2MJM A;  1CY5 A;  4RHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...