3MOZA

Structure of the ptp-like phytase from selenomonas ruminantium in complex with myo-inositol (1,2,3,5,6)pentakisphosphate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
314
structure length
314
Chain Sequence
QTVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHAEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myo-inositol hexaphosphate phosphohydrolase
publication title Substrate binding in protein-tyrosine phosphatase-like inositol polyphosphatases.
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
total genus 110
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mozA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3mozA02
4QBWA 3M4UA 4PYHA 2NZ6A 2ESBA 2P4DA 2JJDA 2AZRA 3F9AA 1Q1MA 4GFUA 3V0JA 5I6VA 1SUGA 3ZM2A 4KYRA 2BGEA 3CM3A 1I9TA 3OLRA 1YZ4A 3QCDA 2CNGA 4NNDA 2QCTA 3GXHA 5AWXA 4GE2A 3PS5A 3AWGA 1WRMA 4DGXA 3QCIA 4JNBA 2HXPA 2ZN7A 1U26A 2NV5A 5BUGA 1U24A 1ZC0A 2HB1A 1L8GA 1OHDA 1WCHA 4MBBA 4ERCA 2I6IA 1FPRA 2C46A 4RH5A 5BZXA 2QDPA 4WU2A 4Z6BA 2Y96A 3S4EA 2F6YA 2F6FA 3O4TA 1BZJA 1R6HA 3F99A 2F6ZA 2QBQA 2SHPA 5K9VA 1C85A 1G4US 1FQ1A 3RO1A 2H4KA 1NL9A 3ZMQA 1WAXA 2B4PA 2Q47A 5K23A 1YTNA 1NWEA 1KAKA 2CNHA 2NLKA 2CJZA 3OMHA 4HJQA 4ICZA 4OHIA 5J8RA 5BZZA 1C87A 4I8NA 2I6JA 2RF6A 1OEVA 1RXDA 2CMBA 3EZZA 3AWEA 5IBSA 1J4XA 2WGPA 3QCKA 3BLUA 2M3VA 3I36A 4GS0A 3F9BA 3AWFA 1YFOA 4DGPA 4GRYA 4AZ1A 3QCBA 3V0FA 4RI4A 4NWFA 1OHEA 2VEWA 1M3GA 1QXKA 2I4EA 3F41A 4RI5A 5M43A 2I6PA 3EMUA 4D3PA 4J51A 1Q6TA 5BX1A 1PTYA 2QBPA 4H1OA 1XRIA 5MMZB 1PYNA 3QKPA 2GWOA 3QCCA 1XM2A 4NYHA 3O5XA 1YTWA 1YPTA 2VEYA 2HC2A 2NT7A 2J16B 2PT0A 2NT2A 3S3HA 3D1OA 2QBRA 2CNIA 2P6XA 2G59A 2G6ZA 2HCMA 1YGUA 2I1YA 4YAAA 4QUMA 3LJ8A 4RKKA 4TVVA 1FPZA 3U96A 1ZCKA 2BIJA 2GJTA 1C84A 4KI9A 1D5RA 2F46A 4NWGA 1XXPA 4GE5A 2Y2FA 4NX8A 3V0HA 3QCLA 1G1GA 3MOZA 4D3QA 2CMCA 2HNQA 2VEUA 4GFVA 4KYQA 4GRZA 3ZM1A 2VEVA 1T48A 3D1HA 2I6OA 2PI7A 2OUDA 3QCFA 2H4GA 5KAAA 2QCJA 2H02A 4PVGA 3ZMPA 4YR8B 5KA8A 3O3LA 4D3RA 4QAPA 3RZ2A 1A5YA 1I9SA 1G7GA 4ZN5A 2I5XA 4Y14A 3O4SA 1NZ7A 4Y2EA 1QZ0A 2FJNA 1YN9A 5EHRA 1ECVA 4JBCA 2R0BA 5K22A 1G1FA 1OEUA 1P15A 4JMJA 4QUNA 3QCGA 2QBSA 2QDMA 3H2XA 3ZM0A 3QCEA 4RDDA 3SMEA 5KA3A 3S3KA 5K25A 3V0GA 4HRFA 2QDCA 1ZZWA 2I75A 2GP0A 1OHCA 4QAHA 3BLTA 2NTAA 1Q6JA 1NNYA 3BM8A 2B07A 2BGDA 1NWLA 1VHRA 2HVLA 1YGRA 2HNPA 3D1QA 4R30A 2I6MA 2C7SA 1C86A 3QCJA 2CFVA 5K24A 5KA9A 1OEOX 2F6VA 3QCMA 2H03A 2CM2A 3S3FA 1BZHA 3V0EA 2DXPA 2VEXA 2FH7A 3MOWA 1RPMA 4WOHA 3EU0A 2A3KA 5IBMA 2J16A 2H04A 1JLNA 1LQFA 1Q6MA 4WTYA 1OETA 4HJPA 3A5KA 5KA7A 2BZLA 4RH9A 1X24A 2PBNA 4BPCA 2B4UA 4IKCA 5KADA 1NO6A 1YTSA 1G7FA 2A8BA 4WU3A 4R0SA 2IMGA 5GTJA 1Q6NA 3N0AA 3F81A 2BV5A 2F71A 1PTTA 2HY3A 1L8KA 2AHSA 4RHGA 2CM3A 2B4SA 1OEMX 2F6WA 1ONZA 2QEPA 1PH0A 1KAVA 1LYVA 2I4GA 4QBEA 1I57A 2B4OA 4S0GA 1OESA 3NMEA 2CM8A 2F6TA 2I42A 2HC1A 3QCHA 1AAXA 3ZM3A 1ONYA 4OHHA 3EB1A 1MKPA 3QCNA 2Q05A 2I3UA 5K9WA 3O4UA 1U25A 3CWEA 3QKQA 1C83A 5KA4A 2J17A 2ZMMA 3ZV2A 1PXHA 1PA9A 3D44A 3BRHA 2PSZA 1EEOA 5HDEA 2YDUA 4OHLA 3V0IA 5EHPA 1LARA 2MBCA 2F70A 3I80A 3RGOA 3EAXA 2PA5A 3RGQA 2OZ5A 1EENA 1YWFA 1GWZA 3D9CA 3S4OA 1PTVA 2B49A 1V3AA 2CNEA 4OHDA 2I3RA 2CMAA 4JMKA 4R0TA 1C88A 2CM7A 4OHEA 1G1HA 2B3OA 4H34A 2H4VA 1T49A 5KABA 1Q6PA 1XBOA 3B7OA 5KA2A 3MMJA 2CNFA 4ZI4A 3S3EA 3SR9A 3D42A 1ZCLA 5KA1A 3V0DA 3I7ZA 1PTUA 2OC3A 3A5JA 1BZCA 1GFYA 4BJOA 1JF7A 4GE6A 2E0TA 2PQ5A 5KACA 1XXVA 2I4HA 2OOQA 1Q6SA 4ZRTA 2FJMA 1G4WR 3GXGA 1PA1A 5LXQB 1T4JA 4B04A 5KA0A 4GWFA
chains in the Genus database with same CATH superfamily
2VASA 2D3O1 4P52A 2M52A 4OYAA 2AF6A 3LP1A 2IFXA 4CYUA 4CRJA 4DV5J 2AJQA 4ZK7M 4Y2MA 1DBDA 2GHVC 1YZ4A 4DU7A 2QLWA 3EDRB 3J7YU 3PCOB 4CT8A 2Y3YA 1YKWA 1XNRJ 2BABA 1IBMF 1EETB 1RTJB 1AA1B 4B3MJ 1WF1A 4F4AA 1PBAA 1SQGA 3GSDA 5MAOA 2JWNA 2QO3A 1H6KX 2BQ3A 3EXCX 1PIEA 1G1XA 2X1FA 2V94A 2G0IA 3J7ZT 2VFUA 3PHEA 2LA6A 3A8JA 2AEJA 1NK9A 2R8GA 1YTNA 1S76D 3NGKA 2HIYA 4FP9A 4P74A 2YNIB 3Q8QB 3PW4A 2XLJA 2RDIA 3OFFA 3D0GE 2L9WA 4XDDA 1MMLA 3BKUA 3PW2A 2W9BA 3GR0A 3AWFA 5BYRA 1FXRA 3ETOA 3G6XA 4DR5F 2C1EB 3KK2B 4ELTA 2FTRA 1OHEA 3I9V9 2KZMA 2AW0A 3ZZTA 2IC3A 2UVRA 2W8LA 3T1HF 4NOHA 5SUHA 2A6MA 3I0SA 2AZ3A 1AUDA 3EMUA 1VISA 1TAUA 2OIHA 1XRIA 1H74A 4K4TA 1HBUA 1PC4A 3EPIA 1VLOA 3QIPA 2DNKA 2W25A 1YTWA 1SC3B 4USWA 1B3TA 2YNHB 3MAAA 2P6XA 3BSNA 1KFDA 4QUMA 4OFZA 3KLIA 1YX2A 1FDNA 4NRTA 3U96A 3IWNC 5J2MB 4ZVTB 3I9ZA 2UP1A 2F5GA 3CCVS 4H4OA 4UOCA 1RK8A 3PNIA 1SL0A 1RI7A 4M5IA 1N32F 2FJAB 2QLBB 4NXNJ 3G86A 3UDLA 1AXQA 2NXUA 1IM4A 3PRDA 1TELA 2QJ3A 3CMQA 1DURA 2FPHX 3NGUA 2V2QA 4FYYB 4PVGA 1YVFA 2BYCA 2Z0GA 4BWMA 4DR4F 2ZITA 5F8NA 5L1JA 3UVJB 1F2HA 1EX8A 3D6MB 1BQMB 3TX8A 2DNOA 4QUNA 3V6KA 3P96A 1X8DA 4QU6A 4TU8A 1LOUA 2V50A 1C0UA 4LVOP 3DU6A 5HATA 4UY8T 2XY6A 2NTAA 1VQLS 1GTEA 5AXNA 1NWLA 4R30A 4PEOA 1DY3A 3J80U 3RW7A 5CZXA 4CLSA 2CFVA 3OTEA 1JLCA 5HJYA 4O0NA 1T03A 1N34F 1UWBB 3BYPA 2EI5A 2H03A 4ED1A 4RUHA 4L76A 4OLOA 5LMUF 2VPZB 3J81Y 4HI1A 2XSJB 1SL1A 2EK1A 2RNEA 1DTQB 4USHA 2DR6A 1HMVB 1DRZA 3UN3A 3BBBA 1XK8A 4NLOA 3G87A 3UN5A 3G82A 2E44A 3NGTA 1N0UA 1BD6A 2ZOGA 1O6XA 5GTJA 3C6TB 2VJVA 3DLKB 1XEZA 4OYPA 3ZM5A 4X4SA 2BJEA 5KG3A 1SH3A 2W24A 3TJ9A 1GAOA 5K8PA 1CULA 4BDPA 1I3OB 4JI3F 4KFBA 1M5SA 2HNYB 4WFZA 3QGIA 1E6VA 4DV4F 3DLEB 1ACMB 3BRHA 3LP0B 3AD9C 3QJJA 4RZRA 3UD5A 5GAHI 1TK0A 3MECB 2NR0A 3RGQA 2VKZG 3PXGa 3OTOF 3IGNA 4TN2A 2L41A 2Z8QA 4DG1A 1YTYA 1P27B 3AFGA 5F3TA 3AT1B 3HD2A 2ZZMA 1H3DA 2PEHA 2R7RA 1LV5A 1IR2A 2UXBJ 4LRBA 1W2IA 3KUGA 2ZBQA 1GK8A 1HNZJ 5EWEA 4TKTA 3IM8A 1BY9A 4DS5A 1SIWB 3SR9A 3J7AN 2E1PA 5KT2A 4IFVA 1R89A 1PTUA 4DCPB 3H59A 1S4FA 4U8VA 4JI1J 3KLVA 4B3OA 1SVDA 3C14A 3CJKA 4TLRA 3T19A 1SJ3P 3PX0A 3HM9A 4OYMA 1XXVA 2XMMA 4EBEA 2FLPA 1RT3B 1T3OA 2D41A 4XTTA 1NB7A 1T4JA 3HZGA 2A2CA 1FJEB 5DQHA 4KPYA 5KT6A 2RQMA 2QFIA 4QWBA 5EUHA 3EVMA 4DUZJ 3E3XA 2QCTA 3GXHA 3SXLA 2PEBA 2C2RA 1NCLA 2HXPA 1NDLA 1FGSA 3SFUA 4Q43A 2QMUB 2QSWA 1P3DA 4OI2A 2XB2D 2HNDA 1TZ0A 2HGMA 4LRAA 3A12A 1PJ6A 4X64J 4WFAQ 3SCKE 4O3PA 4Z6BA 4ID8A 5J1EB 3CJ2A 3OR2B 3GE9A 2HQCA 5A8RA 2WTZA 3GB0A 2CRLA 4HL9A 2MKCA 2MGZB 1PCAA 4WKYA 3OSPA 5J2QB 2XI3A 1KOOA 1U2RA 2ZZNA 1FA0A 2V4JA 2QTWA 1YJTA 1Q7YT 3G4SS 2W7OA 3OVSA 3IR6B 4RW7B 4GKJJ 1DAXA 1PAUB 2V67A 3KNAA 5GAEU 4IKAA 3BLUA 1REVA 2IYGA 1AZSB 2CJBA 4CI0B 3F9BA 2EFPA 3ILLA 2A2DA 2VQFJ 4USIA 4P2FA 2YWGA 4P73A 2YPZA 2I6PA 4NLTA 1RTHB 1NK8A 3QATA 1Q6TA 2HZVA 5FLXU 2J9EA 2RQCA 2BKOA 2QLFB 3V6DA 3GJRB 2AJ1A 1UPMB 3A8EA 2PN6A 4PG6A 3N2AA 3H2LA 3JYTA 1WUUA 2MYFA 1BHNA 2VEYA 1LWXA 4WP3A 2IVMA 3IRXA 1QLNA 2ZZTA 5HK4A 6FDRA 4ED8A 4PPZA 2DRBA 2V8HA 3DRPB 2E5GA 1TKZB 3IC1A 2PA3A 2UVWA 5KFYA 4F0HA 1HYSB 2F1FA 2PMWA 3BSAA 2CVIA 2F63A 3CCWA 2HRYA 5T14A 4OI6A 3MDFA 4IDKB 3V81B 3HSZA 5LSRA 4QR2A 2YH0A 2RF2A 2P9CA 3EMTA 4DPTA 3ZTPA 4X4OA 3R3TA 3AQOA 3G8SA 1S79A 4X62J 3NNHA 2HLUA 5H1SV 1OPIA 4XAKA 4Y6IA 4KRWA 2OPPB 4F2RA 4Y2EA 3D67A 5F8IA 2WB1D 2MQ8A 1RQ0A 2XZDB 1H72C 2GC5A 1UA1A 3QCGA 4IG0B 3GYNA 2OAUA 3H8YA 1J6UA 1V3RA 4BBYA 4BUCA 4UT4A 3CJ5A 2RIJA 4EWTA 2RS8A 2QLXA 4V1Ak 1SC6A 4CTAA 1F5AA 3PRVA 4WKRA 4HACB 2HWHA 3MOJB 3W63A 5HO4A 2R7WA 5IM0A 1MLAA 2GAHC 1IKXA 2KHCA 5L39A 3CD0A 4M1KA 2R3VA 3R5DA 3MPYA 3LGMA 5KFAA 2WBRA 3L9ZA 3ISNC 2LEPA 3HVAA 2BEFA 1LQFA 3BREA 2A3JA 1RTDB 4K59A 4HJPA 3PHTA 1WEYA 1RYRA 3O5TB 4JI4F 2B5JA 4AL7A 2BE7D 3CTRA 2XY7A 1RAIB 3HHDA 5L1IA 1YJWS 4YB6A 1KONA 3ZFVA 2E7WA 1VRUB 1R6YA 4KB7A 3P6YC 1Q4RA 3U1MA 2B4SA 2L08A 2GQCA 3D0IE 2V2ZA 3G6VA 4LSNA 3FZBA 3NCPA 5T41A 4DR1J 2LP4A 2CUYA 2B4OA 3BQ0A 4S0GA 3KOAA 3RG6A 4OI0A 3QCNA 1GMWD 1YIJS 1Q82T 3IBCB 1CJKA 2GIRA 5CD4H 1LARA 2CDRB 4H4KC 1YQHA 4GO5X 1U2FA 1VS3A 1P31A 4M95A 2KXFA 4G1QB 1VCTA 3D5MA 4K4WA 2MZQA 2DBBA 3RB0A 2W7AA 4ZMMA 1CJVB 1Y3KA 4P72A 2CPEA 1Y4ZB 5J2PB 5A8KA 3M2RB 4KPCA 1WF2A 2N3OA 5M2PA 1VQNS 2EG2A 2HBZB 2B3OA 3NWRA 3MMBA 1XBOA 3HT3A 4JI6J 1X5SA 2YX4A 4CDIA 3DXSX 4J9KA 2IA6A 3MEDA 1BZCA 2MLXA 3RB3A 2E1RA 2MLZA 1GMVA 4UQGA 2FYXA 4PWDA 4TU9A 4NI2B 1RAJA 2KDOA 4B3RF 2I6WA 3KLGA 3MR6A 2BJ7A 5KA0A 3DI6B 2AJ2A 1VQ6S 2WVDA 2CZ4A 3P4UB 3Q24A 1TU0B 4GFUA 2ZEJA 3DOKA 3GWCA 4EUVA 1HBOA 3GSIA 3DFEA 4ECUA 3F73A 4M5DA 1YDLA 2PI5A 4IG3B 5HMYA 1I94F 3C15A 2CNGA 1QUVA 4GE2A 1QJHA 1VQ5S 4FDFA 1NUEA 2IDLA 3TZZA 3MEKA 1PG5B 2KL8A 1FKOB 5HQ8A 3VAFA 4KO0A 2VPYB 4JV1A 4JI2J 1GX5A 4CLLA 2QL5B 1FPRA 2J7WA 1SUQB 3Q86A 2C46A 5IC6B 2R4FA 4C7QA 2QZ8A 3K7RA 2ZJRQ 2XO7A 3OR1B 1M5VC 1RHJB 2ZOFA 1YJ9S 2HQ3A 1RT4B 3Q8YA 2Z2MA 1FQ1A 4IQMA 2RU3A 3C2PA 1WKJA 2O3DA 3R9LA 1ICEB 4RBTA 4IOBA 2NLKA 3MMAB 5J8RA 3HT0A 3NMRA 3IWXA 3CCRS 5H9FJ 3UDCA 2YWHA 2GIFA 1I51B 3J7YI 1G6BA 3FQLA 1G2EA 3OUYB 1O0PA 3KG0A 2IJFA 3H2UB 5LMNJ 3OVAA 3BKTA 4X4NA 1T9YA 4A8FA 2B43A 2NYHA 1P1TA 1FI4A 3POTB 1M5PC 2Z30B 1RAGB 1RKIA 1JNRB 2ALYB 3P3DA 2NXNA 4I2PB 2AGOA 4YHHF 3PEHA 3M05A 3QCCA 1VRTB 1FKAF 3DYAB 4NYHA 1F3VA 3PO4A 4MMOA 4OZNA 2N7YA 3LH2S 1YHQS 2BJ3A 5KFOA 3MXHP 3R1LA 1TL1B 2VD3A 3EGNA 5F8JA 1RCXB 2ZBIA 3LJ8A 2HVIA 1HW9A 5KFNA 2CFXA 1WHYA 4FXVA 2UV8G 1EETA 1RTJA 3BO3A 3A8KA 3B4DA 1IWGA 1VBZA 1WC4A 4ZKAA 2BQRA 1LK7A 5DLGA 2QCJA 4NXMJ 4TY9A 1FEHA 4A8WA 4F67A 4D3RA 4CVLA 2MJNA 1YI2S 5AJ3F 1ZTWA 4ZN5A 2FJXA 1PYSB 3TA0A 2I5XA 1LWFB 2IYIA 1ZAXA 5EHRA 2PMHA 2YNIA 2N7CA 4C0BA 1R0AB 1Y10A 4DV3F 3WX4A 2DHAA 2BRLA 1BQXA 2MJUA 3ZM0A 1VQKS 5DETA 2ACYA 1ZZWA 2GP0A 5HI7A 1IKVB 3KK2A 3E01B 2B07A 3GCWP 1FRIA 4OZ0A 3QGGA 2KO1A 2DR8A 2I6MA 1F2GA 4M5MA 4F4KA 4NX9A 1V9OA 4RW6A 1RADB 4JV0A 4NYPA 3CT9A 1BZHA 4M5LA 1KDNA 1SJQA 1KC8T 2E5LF 1KQSR 3EU0A 4K4XA 1FRXA 4QW9A 3DHWC 2YNHA 1NPRA 5DO2A 5KFWA 4U67Q 1Q6MA 3KJNB 1YGYA 4Q0BB 4UOHA 3OTDA 4PQUB 1FNXH 3GJQB 4R0JA 3TANA 2RHQB 2HK3A 3GQCA 1P9YA 2Z2ZA 4IUFA 1G7FA 3HJVA 2NPIA 4NLYA 4WU3A 8ATCB 1RHMB 3HMJG 2BMBA 1PTTA 2P9EA 1UFLA 3TQEA 2QX0A 1H38A 4N8OA 2DT9A 1WHWA 3FK4A 2B0GA 1UVIA 3W7BA 4KC5A 4K5SA 3UVJA 4UUWA 3LO3A 2H5JB 3F56A 4USMA 2ZM6F 4C8ZA 1X0FA 1BQMA 2NS1B 2YDUA 5B0FA 4DSLA 1CBKA 3EAXA 4ZPCA 1N36J 1N5YA 1EENA 1UW4A 1YBTA 2F8HA 3FFIB 2ASJA 1S0OA 1UZDA 3WIVA 4MAKA 1WD6A 1FE4A 3I5CA 1G1HA 2RQKA 2JEFA 4H34A 4OJ1A 3NGRA 2KTQA 5KABA 3HD1A 3RW6A 1UWBA 3B7OA 4KBIA 4DV0J 2CNFA 1QDUB 3CNQP 2FZCB 4MK9A 2JLEA 4K4UA 4ELVA 2UU9F 2XSJA 3FDSA 1DTQA 4QU7A 2PQ5A 2LXUA 1KD1T 2R8KA 2CQHA 2YKQA 1N6QB 1Q6SA 4ZRTA 2F00A 1CC8A 4QBWA 3AOBA 5A76A 4ED6A 3O6QA 2E5JA 2AZRA 3C6TA 1UFKA 3DLKA 2YVSA 3GIMA 1SUGA 1N33J 1U1RA 4C3KA 4WYWA 3HHLD 3OLAA 4HT7A 1RHUB 2E1CA 4TVAB 4ANCA 2KG0A 1RT5B 4AXJA 2YKNA 3HSJA 1X5TA 2B8QA 1RAEB 2HNYA 4OHWA 3RBEA 1YLXA 1YITS 2M7SA 4X4QA 3DLEA 2F65A 2F6YA 4LT6A 2BJ1A 2RKIB 3O4TA 1BZJA 1U45A 1MMNA 3B54A 5IOLA 1LW0B 3PFEA 4I6WA 3M6VA 2NPFA 1HNWF 1VQYA 3ENWA 3MECA 2OSQA 3T41A 3I31A 2ZKTA 2JVRA 1S6QB 1YJRA 2L48A 3Q22A 1CJTB 3M8QB 1KFSA 3VCDA 4WK1A 3EZUA 3HSGA 4N41A 2B51A 2I6JA 1H7WA 4I56A 3WZ0A 3TO8A 1RTZA 2M2BA 1EJ7L 4FN5A 3W2WB 1SH0A 3TAQA 3CUNA 2QMWA 3DLJA 3LWMA 1JX4A 4I7FB 4QIWD 1FJGF 1U48A 4YMEA 2N4DA 3ZTQA 4FPRA 4J51A 4I2QB 3OFEA 1SCJB 1RT3A 1S9FA 2VL1A 4TXSA 1K73T 4DUYF 1VC5A 1QD1A 3BH7B 3C19A 3R7BB 3O5XA 3IR5B 5D4LA 2QA4G 4DR6J 1BC6A 3S3HA 2ZWOA 5ETLA 2AX0A 5HJXA 4LRCA 3NBPB 1FPZA 3NS7B 5GAEI 3QRRA 1E6YB 4UUXA 2HYIB 2B8PA 2IM3A 4ECYA 4F4ZA 4X4UA 2Y1RI 2FHMA 2F4VJ 4U7CA 1L5UA 1PBUA 2DCUB 2GO8A 4ZVPB 4LF7J 3ZZOA 1OYEA 3VAKA 3VQTA 1PGZA 2AX1A 2ZVSA 5J1EA 3I82A 3OR2A 4NCAA 2JC1A 1RAOA 2CJQA 2G2YA 1C1CA 2MGZA 3JQKA 5J2QA 2H9ZA 1QAXA 3ENVA 1IBKF 1VIOA 2DXDA 2GGPB 3PYGA 3OV7A 4RW7A 1H2UX 1URRA 1G1FA 4B9SA 1U7LA 2HRUA 1P15A 3HX9A 3SYZA 4C8LA 2WTFA 1UFWA 1XMQF 3FRYA 1AZSA 1T7PA 4XIUA 3V0GA 4B02A 2XMTA 1NSAA 1R8HA 1Q1KA 3NOGA 5IWAF 3BM8A 5IT4A 2KKHA 3IG1B 1R31A 1XR5A 3A3PB 3SFGA 4ANDA 2VTDA 1RTHA 2FVCA 3TNVA 2AHOB 3DC2A 4DV2F 4FYXB 2VBXA 2JDJA 4U95A 2A3KA 2HG4A 2R2RA 4ZLLA 2MSTA 3HVWA 3DRPA 1TKZA 1SKUB 3KUEA 1HYSA 2ERRA 2VUGA 8RUCA 1YTSA 1VQOS 3UW1A 5M2RA 1A9NB 4IDKA 2UUOA 4OX8A 3V81A 5KFGA 4LSZB 5ETKA 4Z37A 3ZXWA 2V0NA 2Z58B 2XNRA 1HNIB 2GZOA 4U6PA 1FRKA 5KFLA 4QBEA 1IBLJ 3JTNA 3GG1A 2D3UA 2OD6A 3L7UA 1AAXA 1MKPA 1FT8A 4ZN3A 3D54A 3TW0A 4Y0FA 2OPPA 2V4RA 1HWUA 1LWCB 5DQGA 4HV4A 3D0HE 2QC3A 2V9KA 4Y2IA 2HFNA 3RBZA 4OHLA 3RR7A 3FCWA 2MBCA 4IG0A 2YNFB 4LF9J 6AT1B 3E2EA 4JI0J 5I42B 1VK3A 2MQQA 4KGKA 3HSDA 2AYBA 2IY5B 2VBWA 3S4OA 1V3AA 2UUTA 3PR4A 3TOQA 4LJMA 4OI1A 5AE1A 4HACA 2Q43A 2ZH8A 1C88A 4IH6A 1UMJA 1TQLA 1DQAA 2CQ1A 2DNRA 1FFSB 4LF1A 4WIIA 3LUYA 5CABA 4LFAF 3D6HB 3ZZPA 2DNYA 4DSKA 5DDRC 2HFOA 4ZCKA 3K8VA 1J5EJ 2K3IA 1RTDA 2N4CA 3KWMA 4RU9A 1NB2A 2VQEF 1V6HA 1TUVA 2ESBA 1UEKA 4DPOA 1VRUA 4QCLA 5K14B 4WE1B 4ZLPA 3ZM2A 4DPWA 4J9SA 1SC4B 3M9MB 3QCDA 1U6FA 1URNA 3THPA 7AT1B 1WRMA 3M8ZA 2BW7A 2ZN7A 3BN7A 4C8KA 4KGZB 1Q7LB 4JV5J 1YZ7A 2JNJA 1K0VA 2IAJB 2QDPA 1M90T 2HIQA 2F40A 4ZIYA 4USVA 2J0XA 4NCBA 3RRGA 2BQUA 1F5BA 2V8PA 1R6HA 1JXEA 4G1QA 1D0EA 4GC7A 2HQFA 3QRPA 2MQOA 4MK7A 1UJ5A 1WAXA 1KAKA 2CNHA 2QA1A 5J2PA 4C13A 4OHIA 3M2RA 2WVBA 4NLUA 1BE4A 4D3HA 3I87A 3I5BA 2EBEA 2DRDA 3LA0A 2NXCA 1S1VB 4J91A 1Q86T 2ZNZA 4DFJA 3W9HA 2P5VA 4ECQA 1B7YB 1Q53A 3MVNA 2W2NP 4GKKF 3N6MA 3P8BB 5C2GA 3D6FB 3M7VA 2EW9A 2VDHA 4NI2A 4MTPA 2ZH2A 2QBPA 3PG9A 4P71A 3OL6A 1SJ1A 3PEJA 2JFKA 4NA3A 2GVDB 2C42A 3DI6A 4EBDA 2Y9HA 1SJRA 4ZP6A 3TZXA 3NCRA 2Z2YB 3KHHA 4IG3A 2QBRA 3HKZD 1S1TB 4NA1A 4QF5A 1KKHA 1KQFB 1IKWB 4TNOA 2F3JA 4UOGA 1ZCKA 3A13A 3THTA 3K5NA 2BIJA 5LL6d 4WXOA 2CAJA 1FKOA 1X9SA 4E2FB 1VQ8S 4D3QA 2C3MA 1SUQA 3PJ9A 2W4CA 2RT3A 3CCTA 3MMCB 2XM3A 1U6BA 3B82A 3OR1A 4QZVB 5KAAA 5HBMB 2V4QA 1UVNA 2J0SD 5JVHQ 3O3LA 3CVKA 1RT4A 2IRYA 1JMTA 4HYKA 1S1XB 1XC9A 2HZCA 3Q89A 2G4BA 3GFXA 4FBTA 3MMAA 3VZHA 4LFCF 4NEZA 4OHXA 4NLDA 3IWLA 3PIOQ 4DSEA 2J9CA 1BXNA 3GIJA 2VU5A 1TV6B 5T7LB 2QDMA 1VHFA 4B3TJ 4DV1F 3QCEA 4RDDA 5KA3A 2R9LA 3CO9A 5C25B 2IVFB 2EKYA 3OUYA 1FERA 4ZVGA 1FK9B 2HVLA 2UVUA 3POTA 3GFHA 2FIUA 5KG5A 1JJCB 2G0JA 5KA9A 4HH1A 2ZFHA 2C22A 3MWBA 2WOMB 2EKNA 3R5BA 4I2PA 3M9OB 4J9NA 2R7TA 2CA9A 5L38A 5KFHA 1VRTA 1X7VA 3DYAA 4P7TA 2MZSA 3TJ8A 4HT5A 3W8PA 4DPXA 1XMOJ 3JAMU 1TL1A 5K8MA 3TYTA 3SCLE 3LQVA 4RNNA 3R7NB 5KA7A 2N3LA 2XGPA 4R0SA 1F9FA 1CQMA 1Q6NA 3R7SB 2HY3A 4ECWA 4RUBA 1NK0A 3BSOA 3M9NB 5EHHA 2IHR1 2DITA 1WF0A 2FZKB 1Y3JA 3OFGA 2NUHA 4MK8A 5IQ6A 5A6WA 2DGWA 2CQDA 3PDNA 1BWEA 4L73A 1LWFA 4DLGA 3CWEA 1FVSA 3AJ1A 1C83A 3JQMA 2J17A 2OGUA 1C4AA 1EEOA 3RAQA 1R0AA 1RBOB 3CJRA 1HARA 2W2OP 3OHAA 3H7HB 1X4CA 3HF5A 1VHIA 1IKVA 3QT8A 3CCJS 2CNEA 3E01A 2I3RA 2QG9B 1F3FA 2LLZA 3QO9B 4JI7F 2DGSA 3NP5A 1YRUA 5KTQA 1R7IA 4N8NA 1RU1A 1B0VA 3RUBL 1N5SA 3KJVB 3KHRA 1SV5B 3Q8SB 1MW7A 4K0KJ 2EG1A 2OC3A 2WHOA 2RRNA 2RMLA 2OO4A 2KB2A 5F8LA 4OLPA 4FYWB 4Q0BA 1NSKL 3TAMB 4WF9Q 4PQUA 1Y5IB 1RWWB 4CM2A 2HFUA 2FJMA 5KFTA 5LXQB 5L1KA 4GWFA 5B0BA 4LUBA 1XERA 1C0TB 2JJDA 1F1BB 3GPAA 2QV6A 2Q6CA 4F3OA 1FF2A 4K4YA 1HNVB 4H54A 1Q16B 3OL8A 2BGEA 2PFDA 2AD9A 1SKWA 1ZM9A 3OD2A 3PS5A 3QGHA 4J9RA 2E7XA 3R1HA 4OYWA 3HHKA 2DGVA 2HQIA 3AA9A 1U8WA 4GC6A 1S1WB 2HB1A 2XMAA 4P10A 2IM0A 3DGPB 1L3TA 5J1NA 3NNCA 5BZXA 4TQRA 4FNIA 4LIWA 2POKA 2Y66A 2Y96A 2MMYA 2CZ9A 1KBRA 4R5PB 1C85A 2M88A 1G4US 4QWAA 4LBIA 4NYZA 2ZH3A 3FFIA 1NWEA 2JFFA 4M5HA 3HN7A 2QLJB 5EX0A 3NLCA 5B0AA 2RF6A 4C8NA 2IMOA 2HWIA 3OJUA 1X0PA 4FS2A 4KQZA 4J9VA 3I36A 4GS0A 4C48A 1MSWD 4P7VA 1ZM4A 1KSPA 5RUBA 2ZC4A 3ITHB 3W5XA 2LXFA 3M30B 1YJNS 4TYAA 1ELOA 1FRHA 1IQZA 2FJVA 4KYZA 2HVHA 2W01A 5BX1A 1N6QA 2J7KA 4DOZA 3DDKA 2WAQD 1X4DA 3WC0A 4DL4A 5E3QA 4OL8A 2HC2A 4YP3A 4YOEA 4OX7A 4DU8A 2PT0A 2BRKA 1P1LA 1PJ7A 2AIRB 1HFEL 4A8KA 5D8HB 2ACMA 5KFIA 1Z2ZA 1Z4UA 2D69A 3TA1A 2N82B 5A0YB 3NL0A 3W8GA 5HROB 2H4YB 3CJ3A 1RE1B 2CWKA 1Q5VA 4I67A 4F4XA 4RW9B 3ZMPA 2QYGA 1LW0A 2DH7A 3JS9A 4LR9A 4TQSA 4AQYJ 2GCBA 3V4MA 2HHWA 4HTJA 2CPDA 3ILJA 1CJTA 3M8QA 3NOCA 1ZAWA 3UCUP 2NCKL 2I8EA 4LSLB 1R8BA 3UFCX 3PM9A 2XULA 3SZ2A 3W9JA 2C2NA 2KXHA 2FJEB 2XHWA 4YUDA 4A8XA 3T1AA 1NH8A 1NRKA 3K57A 1U1LA 1FDAA 1TL7B 1YGRA 3MR5A 3TZWA 1C86A 1PAEX 3J7A1 4DL3A 1FWKA 2FHJA 2UXCJ 2YBVA 4I2QA 3N79A 1WI8A 5D4NA 3ISZA 4NRUA 2DNQA 3QJPA 5GAGU 4BHQA 4L3KA 4EZ6A 4Q45A 4RW8B 3WDOA 4DV6J 2ZHAA 1Q8KA 1VIXA 4PAAA 2XYPB 3BN4A 2H04A 2KZZA 3M6WA 3NBPA 4WTYA 1FKPB 4ATNA 1RU2A 4OZ5A 1X9WA 4B9LA 1RYSA 1DJ0A 4QQBA 1E6YA 1U47A 3PRBA 3G6YA 4IKCA 2F7VA 4A47A 3TX0A 3QCZA 4I68A 3D6TB 1NDKA 3G9CA 1L3VA 4YB1P 4OJHA 2D3ZA 2F6WA 3AB2B 3CC7S 3IS9A 3TVKA 4YR3A 3D4JA 3VAHA 1F5CA 5GMEA 2KYXA 1FVQA 3MHYA 3VAJA 1ONYA 3C6UB 2ALZA 3PIPQ 2GGPA 1D3WA 5EWFA 3GLJA 1K8AT 2VG7A 4BWJA 1WTBA 1PXHA 4FXWA 2IBKA 5DLFA 1MMDA 1UTAA 2DEIA 5DG7A 3MEGB 4NZ7A 4QWEA 4JOUA 3PR5B 2UV8A 3BS9A 5E3RA 5DS7A 3CF5Q 4HH0A 5CYQB 2XS7A 2ZNYA 4OHDA 3IG1A 2GVZB 3THVA 3ZZ0A 5CD4A 2BM0A 3NAHA 3NS6A 4Z2XA 3PX4A 2HRTA 5A2QU 4DSJA 3GV5B 2X7IA 4KSEB 4ZI4A 2E5HA 2YWKA 3S3EA 2F4FA 4HDHA 2J0QD 5D15A 1TK5A 3A5JA 2QRRA 3EVWA 1V5IB 1Z2LA 4ES2A 4CLUA 3BV8A 2W4DA 4JI5J 2UUCJ 3HHLC 3CC4S 2KM8C 1T9UA 2D1CA 3L09A 2X1AA 2ABYA 2ILZA 2E1MC 1BGXT 3I32A 1KWMA 4DR2F 5I6VA 5KT3A 1HNIA 3X3UA 4KT0C 1FXDA 3I56S 4DGXA 3GZ7A 1HI8A 1S12A 3M1VB 3HXMA 3AD8C 3GU0A 4H4MB 3W5YA 1LWCA 3W9IA 4G1IA 5L9XA 3CCSS 2F6FA 4OYOA 4RNMA 2YNFA 2ADCA 2XMKA 3OW2R 1L3SA 5I3UB 1X4AA 1WG4A 5I42A 1S99A 2DO0A 3PV8A 5A2QY 4AFFA 2NQPA 2GJ2A 2CQPA 3OMHA 5BZZA 4ZITA 3CIMA 3RU0A 4DQSA 1GXTA 4OZ1A 4Y34A 2X3GA 5THWA 4YS2A 1I6JA 4DV7F 3HDSA 4KAIA 2J0WA 3AHPA 2YWWA 1M3GA 3BM7A 1S59A 4WZMA 2VOSA 4IYQA 4B3SF 2E7VA 1KLMB 4X84A 1IR0A 2AU0A 5K14A 4WE1A 3UAGA 4RO0A 2PE8A 2GV1A 4CCHA 3J81j 4RKKA 5A5EA 3S7RA 2QEXS 4DJBA 4ZVHA 1B99A 2CPZA 2XYGB 2EFGA 3GR1A 1NMEB 5KFZA 2OHDA 1NJIT 2IM1A 1Q5YA 2LQJA 3I0RB 1OIAA 2KG1A 4LFBF 3G8QA 2VEUA 1PKUA 4MKVA 4CO3A 2IAJA 2WSCC 2FC8A 4YY3F 1NPKA 2C3PA 1HKAA 1UEUA 4F2SA 2Y1OA 2XS5A 1A5YA 3T9ZA 3LPEA 2AGQA 2L9DA 4CNZA 4ITSA 2M0GB 3QSIA 3ADAC 2NLWA 1QZ0A 4NLXA 1SL2A 1LKZA 3MEEB 4JBCA 2FC9A 3QZ8A 2RSQA 2GHWA 1Y5NB 3D28A 1ZH5A 1S1VA 1QAJA 4HHJA 2DGTA 2M9KA 3CDAA 1HPZB 3TZYA 2BZ2A 3TEGA 2Q66A 3QLHB 1N5VA 2XMJA 1JJ4A 2BXJA 2X1GA 1M1HA 3DDIA 1M5OC 5BYSA 3I96A 3UI3A 2GVDA 1S0VA 3FSIA 1LNQA 2H54B 2MHNA 4JI8F 5C42B 1N8RT 2PO4A 4C11B 3TVYA 2CPJA 3MR3A 4G6VB 1S1TA 2DPJA 2K8GA 1D8YA 1IKWA 4MIWA 3JXOA 1HWLA 1X24A 4O44B 3TUIC 5LSLA 4LQ9A 4XPEA 1KN6A 2AT1B 4Q2LA 2W7PA 1YSJA 1EZZB 3A3OB 2F71A 2AHSA 3VQSA 1RT6B 5IV4A 5ETMA 3MMCA 4WFYA 4CH7A 3AA8A 4Y2AA 3OLBA 4JYAF 4DF8A 1FDDA 4EI2A 1AW0A 1S1XA 4RL1A 2XQCA 2BOAA 3JSRA 2H3EB 3W64A 1EP4B 3NG8A 4ED5A 1L3UA 2G9OA 2J7UA 1DHMA 4DR7J 5KT5A 2QMXA 1T9XA 4KJIA 1TV6A 3I80A 2E5IA 1KHWA 4J9QA 3L4BC 4DS4A 4QR1A 2OZ5A 5C25A 2ADBA 1GWZA 1PTVA 2B49A 1FK9A 1SXLA 4N47A 2X1BA 5KFSA 4R0TA 4WP9A 7FDRA 4I1TA 2WOMA 4QYRA 1Q8BA 1ZPWX 3OBIA 1W26A 1JJ2R 4Q2MA 1RWUA 3MR2A 1CJUB 3UD4P 1RDRA 2K7KA 4DF4A 2DY9A 4PXEA 4ILMA 4LBHA 2W9CB 2DXEA 2JEIA 2A6OA 1U02A 2QFJA 2OOQA 2FLLA 3M4UA 2AWZA 2WSFC 2VC0A 3T1YJ 1YJ7A 1W2BR 5KOWA 3CC2S 3LP1B 1NBEB 2HBRB 5AWXA 2VFTA 1BUXA 5J2NB 2ZJPQ 2HHVA 3QCIA 3UCZP 1R8AA 4KHPJ 4LF5J 2DIUA 2JLGA 4K7QA 4PCQA 4LQ3A 4MBBA 1QSLA 2YKMB 3N6LA 1D09B 1V5VA 5LT5A 3W2VB 1TFWA 5H9EK 2BE9B 4OYBA 2PFFB 4FVMA 1IXKA 1TMMA 1SIZA 1KLNA 3VAMA 4EZ9A 1T05B 3JSMB 3DLGB 4LF8F 2D7SA 5K8NA 3QO9A 1YG0A 4ZOSA 1C87A 3MAQA 2DGOA 4QIEA 3MM7B 3AWEA 1J4XA 4F7VA 2WGPA 5E3CA 4CO4A 3K5LA 2XI2A 2VB6A 2R2UA 2ZVIA 3KJVA 1SV5A 1IBMJ 1Q78A 4AZ1A 5JMNA 5SZTA 2VDIA 3MPUB 4C3LA 4K2XA 3P5BP 2MQPA 1WOOA 4NYOA 3TAMA 5KFBA 1FRJA 1NJWA 4DUTA 2EEYA 1S77D 2K06A 1NAQA 2O66A 2GWOA 4XDCA 3V6HA 1C0TA 1YZ6A 4DX8H 1DLOB 1HNVA 2ZBRA 3BO2A 3C66A 2GHPA 2NT2A 5F8GA 5E3PA 1KVJA 3KLIB 4IRDA 2F46A 4NWGA 1XXPA 1GTHA 3MOZA 2VFVA 2V8GA 1S1WA 3O2IA 5IQQA 4NMXA 5F0WA 4KYQA 3DGPA 4DR5J 4LF4F 2LDYA 3M8PA 3T3FA 2KI2A 3BGRB 4NASA 3R6LB 2CQIA 2PI7A 4V19J 3R6GB 3T1HJ 2OPSB 1A6LA 1DTTA 3P49B 1X4GA 3HHLB 3K89A 3UO0A 4DDFA 2KM8B 4B9UA 5H9FK 2V9WA 4EYIB 2F8EX 3FJ2A 3Q83A 2DGUA 2DYAA 5BR8F 1UAGA 3H2XA 2QIFA 3J80Y 1R0BG 3NY0A 2HHHF 1ZAVA 2HAIA 9ATCB 1N32J 3ITHA 3M30A 3BPDA 1NJYA 4L72B 5IT9U 3ZO7A 1XNQF 2OTJS 1VQ4S 3E8OA 2R7UA 5KFEA 3CGIA 2CXEA 2B3TB 2EPIA 2HVEA 4MKAA 3EGVA 3PACA 1JLAB 2EK6A 2DGXA 3QNWB 4DR4J 2EC2A 4WOHA 3H2VE 2MHEA 2P8IA 3M4XA 1RKJA 2MZTA 2C2EA 2WCXA 4F36A 4WWSA 2JEJA 4G65A 3VF0B 2DGQA 3JSBA 4ZA1A 4DEZA 2RU9A 3M6XA 2HVDA 4URQU 1V3ZA 4AL5A 2U1AA 4AYBD 5A0YA 5CA5A 5HROA 2BV5A 5E7OB 4NEYA 4RHGA 1SH2A 1OEMX 2J9DA 2Z4PA 4OHZA 2RILA 2YKPA 4IOCQ 4RW9A 3H5UA 5HP1B 1CC7A 1N34J 3NMEA 2I42A 5GAGI 4Q5VA 3Q2SC 4DV6F 1QSSA 1HR0F 4YEAA 1HNXF 4KFBB 2I3UA 3GYXB 3L7OA 1HHSA 2GMLA 5KG1A 3CDEA 5KA4A 2G1HA 3VWSA 1E6VB 1RBLA 2XC9A 4LSLA 2KN4A 4CIOA 1CG2A 2AJ4A 5IT9Y 1TKTB 2KVIA 3R97A 1APSA 4DPUA 2MKSA 1HLWA 3S8SA 4TY8A 3K2YA 2NZCA 4OHVA 3G6ES 2L9NA 3CO0P 1RWNB 1TL7A 3FMBA 2CMAA 1PYTA 2D74B 4QBUA 3T5HA 1NHKL 3BDEA 3ZL8A 5HL7Q 1Y0HA 2G13A 1VQMS 4K5RA 3AJ2A 4J9MA 2E1AA 3MMJA 4JI3J 4ZS6A 4RW8A 1Y00A 5HQMA 2QSFA 1OY8A 3TA2A 2U2FA 3OPKA 5DM7Q 1GFYA 4GE6A 1IKYB 3QFHA 5KG4A 4ETXA 1FKPA 4DV4J 4OYIA 1LK5A 3JTOA 1PC5A 5G0RB 1KVKA 2BBEA 1UVKA 4Y2CA 3OTOJ 2FDNA 5IXUA 1N56A 1K47A 4OX9F 3MFHA 2EFNA 1MWQA 4RJVA 3C6UA 4EEYA 2WB4A 1UJ4A 3R5GA 1FEEA 1NO8A 1U1QA 3MEGA 4O3OA 3NS5A 4E0DA 4X66F 2ZH4A 4CLPA 2MDAA 4CH1A 1H73A 2I5JB 5CYQA 5K23A 4X65F 5LXYA 1JQGA 3EXYA 1FX4A 3B6BA 2GVZA 1AYEA 2MLYA 3IA0A 2HAFA 2IRUA 4FZVA 5IBSA 3QJLA 3QCKA 4IOAQ 3QWPA 1EAYC 3CD7A 4CO5A 5CZVA 4ZPAA 2HBYB 2X5OA 1TMJA 5FLXY 3W66A 4DBQA 2UXDF 2J9DE 4F02A 2UAGA 3KLEA 2GC6A 3F41A 4OI3A 5BJRA 3SDEB 4UW2A 2MQLA 3ZZRA 5KFJA 2XCPA 3W60A 1UA0A 1FTCA 1EQMA 1RHKB 3LGHA 4PWUA 3H40A 2HCMA 1H2TZ 4P2SA 3QGPA 4NCGB 1WJ9A 1KQKA 4EO8A 3M1VA 3T9NA 2Y2FA 4IH7A 1JBVA 1JK9B 4ED0A 4H4MA 3FEYB 3ILIA 5JJBA 2PGCA 2IA0A 2OSRA 2K3KA 3MCOA 2HS4A 1F6TA 1PJ5A 3BB5A 4QJVA 2NXJA 3D1HA 2LU1A 3N01A 4DX7A 3OXLA 2H02A 4ID5B 4ED3A 5CCMA 5I3UA 1D1UA 1IJFB 4P6QA 3FC9A 3E51A 3VGUA 3CXCR 2Z2LA 2R0BA 3MUTP 3M8RA 2GW8A 1RLCL 2B9EA 5H9EJ 1GMWA 1A7GE 2R7SA 2FGOA 1NK4A 2OPRB 3JSYA 3SCJE 3UDVA 5CAAA 1Q6JA 1S6PA 3UCGA 2RHSB 4A8YA 1HQ2A 3KLFB 2EFQA 1UCNA 4GVBB 5ETPA 4ED4A 1KLMA 2VEXA 4M5GA 4OQJA 4FPIA 1F9HA 3CPWR 4O3RA 2JX2A 4NA2A 1IVZA 2J6SA 1JLEB 2GQQA 3RB4A 1NXIA 3SEOA 4ES1A 3A5KA 1IWAA 2GO9A 2DRAA 1XQIA 2FJWA 3ENAA 1GQQA 1D9DA 4KV8B 3H5SA 2BUNA 4PWWA 2HEKA 3PW5A 3RR8A 2GMJA 3I0RA 4MH8A 3ZTOA 5KOXA 3F81A 4WBFA 5CQGA 2ZDPA 3OSNA 4O4GB 3EVOA 4LF6F 2DHXA 3MM6B 5B09A 2VTEA 1MWZA 2ZH9A 2KHDA 5LXRA 4HDGA 4AL6A 4PQAA 5KFQA 4DFKA 4DFMA 4PRFA 4HHUA 3H0PA 3MEEA 3HZEA 3EDQB 1SKRA 5LSOA 3D44A 2KFNA 2PSZA 3HHEA 3QAUA 2ZWPA 3SSRA 2KFYA 1HPZA 4JI4J 1DZ5A 4E8UA 1YRXA 1CQNA 3QLHA 3CCQS 3Q23A 1UKUA 2PIIA 3B8HA 1RWOB 2BJDA 4DV5F 3CE8A 4OIXA 2C3YA 5A8KB 1T02A 2W2MP 2MKJA 4J9OA 4CNYA 1XNRF 4WFNQ 4B3MF 3LANA 2UUBJ 3D42A 5C42A 2UUPA 3D9BA 3V0DA 1Q79A 4ED2A 1MN9A 2Y0BB 4RKUC 3AB4B 1RSCA 2VV5A 2OUGA 3AAWB 2H48B 2OTLS 2WSEC 3FZ2A 4EFAC 4PG8A 1KTQA 2DR5A 1U1KA 1G4WR 5I3PA 4O44A 3HCXA 4IH5A 4LR8A 4UQTA 2B6AB 2HS0A 5FJ4A 6FD1A 3BR8A 2HLTA 1RT6A 2FD2A 1FWLA 5DGBA 2DY1A 1IN0A 2LMIA 1DQ8A 2MZ1A 1B0PA 4B08A 2NV5A 3DMJB 1AFIA 1ZC0A 1EP4A 3M2UB 1RT7B 2RAQA 3EZ5A 5DG8A 3BGFA 2UUAJ 2HMIB 4OYZA 4CO0A 4WFBQ 4HI2A 4ELUA 3S4EA 3HLUA 1I5OB 1SJFA 3F99A 2FY8A 5ETOA 4B3RJ 4OJ3A 4R8UB 2P2CB 3FGVA 4G3IA 5DZ7A 1ZA1B 2HVZA 2RH3A 4QIGA 4P9SA 1AT1B 1I94J 4CWBA 2PC6A 5HVFA 4E98A 2VPWB 3EZZA 2YQ1A 4TYBA 1M0SA 5JVGQ 2AYEA 1OWXA 2CPHA 4LBPA 4ECRA 1GXLA 4KHPF 1ZOTA 1VQPS 4TLQA 4URGA 4NXNF 4GRYA 1CJUA 3MD3A 4HVZA 4NWFA 1C4CA 3NCQA 3LK7A 3F0NA 3ZC4A 1PTYA 3I6PA 2W9CA 2NXEA 3V2UC 1N52B 3CMES 4NE9C 4F0KA 1BLUA 4F8RA 1YBUA 3DRSB 2XMWA 3ICLA 1YK9A 4NLVA 1YGUA 5IFMA 1HHTP 4TVVA 5J2MA 5J2NA 2VIHA 2ZH6A 3KKFA 3K59A 1VC0A 3GIIA 4BS2A 3IXQA 2HNQA 2YKMA 2CYYA 2GIQA 1VLYA 3W2VA 2BOPA 2J8SA 2D9OA 1CLFA 2OUDA 2GMHA 1ZYQA 4YR8B 1WNEA 4WCEQ 4ZVEA 4OHYA 5DDQC 1Q8LA 2K1RB 2IJNA 4IRKA 5DJBA 4YHHJ 4K8RA 1T05A 2JZ5A 5KFRA 1EHWA 2KXNB 2APOA 3DCAA 3DLGA 3JSMA 1WOSA 2CPIA 2H1YA 2FUG9 4BUBA 2CJXB 3MM7A 3D3CJ 3EM1A 1RT1B 1CS4B 1NKBA 3SMEA 4C9DA 3FSXA 3U27A 4P75A 1FNOA 5C24B 2AEMA 4ZLNA 1YBAA 4DX6A 1MG7A 2BGDA 3PJWA 1F60B 3D1QA 2JVOA 4PG5A 1TUGB 5K8OA 3KXDA 3NGDA 2G2OA 2JFGA 1MWYA 2AJ0A 2MKHA 4RW6B 4M5NA 3TUPA 4FYDA 1QTNB 2FH7A 3A1YG 3G71S 2ZD1B 1S97A 5AJ3J 2HFZA 4PYDA 3NXZA 1DLOA 4LMZA 2RUGA 3FBCA 1KOHA 2AEFA 1HMVA 3DLLQ 5EGYA 2O5DA 4DV3J 3HPOA 1IUJA 1NSQA 4GMKA 3J81U 4JP8A 5ETSA 3MGJA 3GMGA 4DHVA 3SQOP 3V4IB 4KHMA 5A5FA 2UXBF 1TKXB 3BGRA 3D7SB 4QOTA 4OMFG 1HNZF 1S48A 2OPSA 4ZPDA 1WC1A 1WTFA 2VG5B 5DDPC 3HHLA 3ZM3A 2HHXA 4PKDB 4OHHA 3EB1A 3Q2TC 2E5LJ 2Q05A 4JI1F 1O8BA 1RA6A 4DFPA 1OO0B 5AT1B 1P8GA 2ZMMA 3EGZA 5K20B 3LP0A 5HDEA 2F8MA 1KHVA 1NZ8A 2CJ9A 3ILOA 1GG4A 2LEBA 3OL7A 2MB0B 3PO5A 4W4MA 2PA5A 2FGCA 2Q79A 1N5YB 3GIKA 1Y11A 2GA7A 2R7VA 4DUZF 4A8SA 4C8YA 2CM7A 3H90A 1RJJA 2KVQE 4ZPWR 4ZLJA 4I0WA 1JLAA 3MM9B 3CJ4A 2MY8A 1G3OA 1ZCLA 3PY8A 2A1BA 1Y5LB 1LFWA 4ZCIA 4X64F 3CW2C 4HHHA 2ZM6J 2HKEA 2OH2A 1AUSL 3LAKA 3LTOA 4PG7A 3P45B 3JB9k 2VH7A 5IT0A 4A46A 1QTMA 2FY1A 2OP5A 2FVSA 1BWVA 1H7XA 2FZGB 3KYLA 5ADZA 3VTIA 1EKSA 4ZPBA 1RGVA 5EWGA 2BJ9A 4GKJF 3CM3A 4L75A 2J6UA 2V2VA 5HP1A 3GP9A 4JNBA 4PR6A 1A0OB 1U24A 1WCHA 2CPYA 2YKNB 2UU9J 4ERCA 2VQFF 5J1PA 2YPYA 5LJ5Y 4HR2A 3KHLA 3BEGB 2B9XA 2JRSA 3MR7A 1YJUA 3BBFA 2BX6A 4WFXA 3SSQA 2CJAA 3ENQA 5F9NA 1TKTA 2F6ZA 3NWGA 2QBQA 1T8EA 1GNKA 2XGQA 3SSSA 3RO1A 2EFOA 4DMZA 3N28A 4C12A 1HBNB 1JLQB 4X4RA 1T95A 4W98A 5A6PA 5D3GB 1X4HA 2HURA 1KP6A 3R5JB 2DPIA 4J7CA 4ICLB 2DTJA 1WC5A 1Q8IA 3UQSA 2XHCA 2M3VA 5HAOA 2OD4A 1GT8A 3QIDA 2R7OA 3QCBA 2W8KA 1O51A 4MYTA 2HZAA 1QXKA 2O01C 1IKYA 4ZCMA 1R43A 2UUWA 3D68A 5M43A 2BA9A 3LALA 4X62F 1PYNA 4AXIA 2LVWA 2R7QA 5G0RA 5L8RC 4UZBA 4GO7X 1HNWJ 3NMAA 5AXLA 3KG1A 2QL7B 3X1LB 3D1OA 1RWPB 4F0MA 2DJWA 1NK7A 2P6TA 1KQGB 4J9LA 1VYAA 4K50A 3TEHB 1RBAA 1QY7A 2Q3PA 1D5RA 2A10A 4ENOA 2CADA 3HULA 3MI7X 4AD6A 5HVHA 1WDTA 5L9NA 3U7JA 4O3QA 4USUA 2I6OA 2DHGA 1FJGJ 1FD8A 3R8YA 1VBXA 2H4GA 2I9SA 1S7HA 1NKCA 5B0CA 2GAGC 2RD5C 1JWWA 1NNDA 5F3ZA 2YWFA 3KJFB 3TRGA 1C1CB 2OPQB 1I9SA 4WXWA 4DUYJ 4PUOB 1VR6A 3PW0A 2I5JA 1B7FA 2VA3A 1PO6A 4R0EA 1LXNA 3NEKA 3CMAS 4PABA 2CPXA 4KR0B 1H0HB 2XJAA 1LW2B 4C4WA 3BSCA 3C3LA 2ASDA 3S3KA 1WC0A 1JBWA 3KJQB 1EB0A 2XZWA 4QAHA 2FJDB 3RAXA 1LWEB 3CCMS 4IFYB 3ZZUA 4CLZA 1UVJA 3LAMA 4DR1F 1Q0NA 3MUVP 1S5ZA 4QIVA 3SDEA 5IS2A 1M1KT 4XK8C 5DZ6A 1FFGB 3V0EA 4QDIA 5HMXA 2DXPA 2H5IB 3QT7A 1T9TA 4USJC 4ZIWA 2DNZA 1IBKJ 1EARA 1YWXA 1NDPA 4ZPTR 1OETA 4OZJA 3T6JA 2YQ0A 4RPFA 3JQJA 4NCGA 1JLBB 5IC4B 3ULHA 3DOLB 4M5JA 3KG4A 1XMQJ 3VVUA 3IGVA 1RABB 1ZM3A 1RA7A 1GMUA 3FCHA 3FVYA 1NO6A 1HBMB 2BANB 5IZHA 3V6JA 3UNGC 4FVCA 2H65B 3N0AA 4FBUA 4J90A 3TQ1A 1QAIA 1CPZA 5IWAJ 3L95X 4LIRA 3SI8A 2CZVC 1JKHB 1ONZA 3IN5A 4ID5A 2ZHOA 4JI6F 2DNNA 4ZVSB 1QE1B 2HNZB 2COLA 2IPOB 2CM8A 2F6TA 4J9UE 1N5TA 4OJGA 4DV2J 1VGYA 3VR1A 1WHXA 1X4FA 5K9WA 1WSRA 3QKQA 5ITHA 1PA9A 1YJVA 2AJFE 1FCAA 2DH8A 2LDIA 1J5OB 2FHKA 2A0FB 3RGIA 5U47A 4O3NA 2MKKA 4YN3B 1ZTTA 1D9FA 1CJVA 4ZCLA 2OPRA 3CDBA 3VAIA 1EQ0A 5F41A 2RB7A 2K7JA 3W5ZA 1RAHB 2ZBCA 3DLBA 4OV6A 1DARA 4UZCA 3KLFA 4EGLA 4I6YA 1Q95G 5AE3A 2H4VA 4GVBA 2V2KA 4X4TA 2B9YA 4F4YA 3MPDA 4MKYA 1FD2A 4JI2F 3N5BA 3OJSA 1M1GA 2BKPA 4HKQA 2KYZA 4DCOB 3CB4A 2JC0A 4LR7A 1S1UB 3OVBA 3AH6A 1JLEA 3BF4A 5KFKA 5D4PA 2YX1A 5KACA 2I4HA 5GADU 4DR3J 1NU4A 4DN0A 4CZCA 3GXGA 3KK1B 4KV8A 4Q7AA 4PXBA 4PYHA 4J9PA 1U49A 1J2VA 3DM2B 2HSEB 3R5CA 4O4GA 1I9TA 1S72S 2DR7A 3MM6A 2HHSA 3PKYA 2RDJA 3CSKA 2DNGA 3RRHA 2V34A 1D8ZA 2UUBF 1SB6A 5LMNF 2ROGA 4LFAJ 2XWXA 2J76E 3N5FA 2R2TA 4DL0C 2YX7A 2DVIA 2Y0SD 3G8TA 1ZZNA 1P6TA 2CJYB 3HFVA 2CNNB 3MCSA 3RBXA 2MY7A 2SHPA 4OI4A 3VGTA 4YR2A 3IP0A 4CLTA 2DISA 2VQEJ 2CIMA 3ZMQA 1AROP 1EIYB 4NZ6A 4NPOA 1NM2A 3AODA 3ZZZA 4ZVUB 1WWHA 2V63A 3WX8A 2ZH7A 2OFHX 2XSFA 2Z56B 2ZE2B 2FVPA 4B17A 4B9VA 3ZZYA 3GJTB 3P5TL 3T6BA 2ZBPA 5GMDA 1WG5A 4BC7A 2D3OR 1FE0A 2GJFA 2VBYA 2MKIA 2UUAF 1MU2B 1PILA 4JUZA 1FHTA 4NXMF 1TVRB 3QKPA 2FHOB 3M8SA 4WPAA 2M70A 1G7CB 4C6AA 1QVFR 3DU5A 1XM2A 1VDHA 2CKWA 2DH9A 2CG8A 2E29A 3BZQA 2XWYA 2B6AA 4MYUA 2E9ZA 3GONA 2NT7A 4CO1A 2G59A 2G6ZA 4CLWA 2D9PA 3PKMA 1UW9A 5D0HA 4OZ3A 4WK3A 5B7WA 1C84A 1B0TA 3FQKA 4GE5A 2W2QP 5KFFA 3DMJA 4OYXA 1OQ6A 2CMCA 4NLRA 3KDNA 4FF3A 4G1PA 3MM5B 3M2UA 2GX8A 4GKKJ 1RT7A 1RWKB 2HMIA 4GRZA 3ZM1A 4DQIA 2VEVA 1T48A 4DX5A 3MTJA 4YB5A 2KU7A 3ETMA 3GFZA 2CVEA 1OY9A 1FX2A 3TI0A 2WZ1A 3VHQA 3GV7B 2WONB 2LU2A 4R8UA 3ZNUA 2VBZA 1GEHA 3O4SA 3H98A 1NZ7A 1U0HB 3UE2A 2FJNA 1RISA 3CJTA 1HQUB 5E2QA 4DSFA 4S0MA 4JMJA 1FESA 2VKRA 2OKQA 1S0NA 4RR5A 4JV2A 2NSBA 4HRFA 4A8QA 1GFWB 4CP5A 2XLIA 3IRWP 5D0RA 1VHRA 1R0CB 4MIAA 4DN9A 5CXTA 2CWXA 3QCJA 1T3NA 3CDWA 4F4WA 5K24A 4AUKA 1JLFB 2KFZA 1VMBA 3JAMY 2GCAA 3WQPA 1MN7A 3C8YA 3N9UC 2OI2A 3QCMA 2JJ4D 5FD1A 4OX6A 3MOWA 3SV3A 1RUSA 2UZAA 3W65A 3DRSA 4FYVB 4ALZA 4LFCJ 1JLNA 1S6UA 2HS3A 4Y28C 5KAKA 2OMOA 1N4LA 3M32B 1RZMA 5KFCA 2PBNA 4BPCA 4ZHRB 1N36F 4DV1J 2QA4S 2DCLA 3AY0A 2MZJA 3DRRB 4JB8B 2RDDA 2MEWA 2NYIA 3BDPA 2AZ1A 3H25A 4YFUA 4DV0F 3BBCA 2K1RA 2JLFA 5GVQA 1ZBTA 1U1NA 4Y00A 2YWEA 2XTJP 4I6AA 5IV3A 1W78A 2JL9A 1U8SA 4MFBB 1MNEA 1HIYA 2AYGA 1E0DA 3SV4A 3LGNA 4ZN1A 3KFWX 1RT1A 1CS4A 2YQ3A 5KT7A 5EDWA 4KGVB 2ROPA 1UP1A 5C24A 3D9CA 4WP8A 1N33F 3KMSA 4FF4A 3EJMA 4IO1A 4JMKA 3PYZA 2V69A 4X4VA 1B64A 2W4PA 5B0GA 3TARA 1KTVA 3ET6B 1HD0A 2HGLA 3CCZA 1W25A 2J5AA 1ULRA 2M5YA 4KGMA 5BYQA 2ZD1A 5KA1A 4LVNP 4O4RA 2BVZA 1JF7A 3BQ1A 3LP2B 3MCMA 4DL6A 4ZP9A 2ZOMA 4DZDA 2QT7A 3NRBA 1TFYA 2LYVA 4RNFA 3UPFA 1TUWA 2RE1A 3UR0A 4B04A 2I2YA 2NZ6A 2QE5A 2YNGB 2P4DA 3FCVA 2PMZD 3F9AA 2LXIA 3V4IA 1ITPA 1XMBA 4UTGA 1TKXA 1WC3A 1TAQA 1VQSA 3OLRA 4JI7J 4DI6A 1M5KC 2AM1A 5BXIA 4OZLA 1GX6A 2EVZA 4DPYA 3PVXA 2VG5A 1RT5A 2ZKUA 3BGUA 4QWDA 3QMQA 3KK3B 3EUNA 3QT5A 4F3QA 5BUGA 5CCLA 1WDDA 4HLBA 2VG6B 5DGAA 1OHDA 1VI7A 2I6IA 3BGOP 1RXOB 2RKIA 4DWIA 2DNLA 5K5MA 3GYGA 2AQ4A 4AT1B 4YDXA 5ETQA 1N48A 4C97A 3GIRA 1S6QA 3FNNA 1R8CA 3TUZC 1ZPVA 3MUMP 2Q47A 4PZVA 3MM8B 4DR6F 5DDOC 2H4WB 3CCES 1VJQA 2LA4A 4Q44A 4UOFA 3AOCA 3J7Z5 3TAPA 4BLGA 3QWUA 3ZTSA 2CQ0A 4RX6A 1X9MA 3MM9A 3IBFB 3W2WA 3I4HX 2ZC3A 2R42A 2F4VF 1T9VA 4WJBA 2FVRA 3EX7B 4DGPA 4LF7F 1PSDA 4I7FA 3FKBA 1NJXA 1JB0C 4ZJLA 2XBPA 3BKFA 1NJZA 2GQ2A 5I4MA 4RBUA 3EPGA 3KUHA 2MZRA 1K1SA 1JNZB 2CNLB 5DQIA 3BYRA 3CEDA 2B7BB 2DB1A 4H4KA 1S49A 1OSCA 2HHTA 5KFDA 2R8IA 2JFDA 2F9DA 1UL3A 2EXUA 1FXLA 2CNIA 3I4PA 1RCOB 3MCNA 3S1TA 1UJ6A 4O23A 4Y2KA 3HVTB 2L3MA 4C8OA 2I38A 3AD7C 3V0HA 2XCAA 2YXLA 2R7XA 4KIAA 5I3QA 1G1GA 1U1OA 2IDEA 4O0IA 1U6ZA 3LOUA 3Q8UA 1UZHA 1S9EB 2GCFA 1Q81T 3IO1A 1O5JA 2P6SA 2WJPA 3T5KA 2HHPA 4N76A 2VICA 1G7GA 4M8LA 5JUMA 2JOQA 4Y14A 1HBNA 1JLQA 3TUJC 5JXSA 1ZA2B 5D3GA 5C5JA 3UDEA 4URSA 2RRAA 2HHUA 4ICLA 4ECVA 4ES3A 3OFHA 1K9MT 3BH6B 2EFVA 2VPXB 2Z57B 4FS1A 3FBFA 2QGFB 1U0SA 1TL3B 5HMZA 3BLTA 2HWTA 1R27B 3VVTA 1C1BB 3CWJA 1IBLF 2WK4A 3WBZA 5HLFB 2CJKA 2CM2A 4MIBA 5AE2A 4K4ZA 4UY85 2VFRA 3HKWA 4ZIVA 1HQEB 1WSVA 2BACA 1HD1A 1VQ9S 3EICA 4KGXB 3QBCA 2DHHA 1PYOB 2ASLA 2AMCB 3KDOA 4ZJQA 2PI4A 4LF9F 4RH9A 4JI0F 2XPCA 1XN9A 2MXYA 1HW8A 2FQQB 3FBBA 1GH8A 5D4OA 3L7PA 4X4PA 1I1GA 1XIQA 3HP6A 1T9WA 4QIFA 3H20A 1TK8A 3DOMB 4W90B 3PJXA 2R8JA 3MFIA 1WORA 3IS9B 3HHNB 1I57A 3PZPA 3VALA 2OPQA 4PUOA 3AOAA 3HVRA 3VGVA 4ILRA 2XEXA 3OXGA 4A8MP 1J5EF 2VONA 3Q8VA 2AKWB 1KEKA 2VG7B 2W2PP 4N77A 3V5RA 1BQNB 3BPSP 3OXFA 1S10A 5EHPA 1UPPA 2MSSA 5ETNA 2F70A 1LW2A 1HI0P 1FO1A 1WC6A 2CQCA 4ZVFA 2AYMA 1RWXB 3QT6A 1XR6A 3C16B 3RBDA 1TR0A 1LWEA 4IFYA 1JJHA 5KG2A 1TL5A 2WBMA 2YH1A 3VV2B 2FJBB 2IM2A 1K0TA 3QRQA 4RU2A 1F9EB 1CVJA 4JV5F 4QYZK 2LFVA 1RHRB 4NMLA 2CQ4A 4KY3A 3MTKA 4A8OA 1JLBA 3W62A 3DOLA 2Y1IA 2I1RA 1PA1A 1HBMA 2BANA 2BE2B 1RHQB 2CDQA 2CNOB 1FTRA 4CO2A 2JEGA 5D78A 4K4SA 3KTQA 3FBEA 1FDBA 3UWTA 3O1LA 1JKHA 4KKOB 1UETA 4OZ2A 2C2MB 2LEAA 4ECTA 3UD3P 4F04B 1NHVA 1QE1A 5F0UA 2HNZA 3BR9A 1JLGB 4MT1A 1S0MA 1XTZA 4P2XA 4USKA 5EN1A 1RTIB 3KHGA 1X5OA 1WOPA 4NWBA 4RUCA 1J5OA 3KLHB 4DR3F 5GADI 5K9VA 2V8VA 3K8WA 3OQ2A 3LPYA 3HI9A 3FEXB 4FKXA 5KFVA 4F50A 2E66A 3DXBA 2BW2A 2C2DA 3EWGA 2PD1A 4DR2J 4RNHA 4ICZA 4RW4B 4I8NA 2OELA 4C0OC 1OEVA 1RXDA 4A4JA 2CG4A 2VZ9A 1RT2B 1Y9OA 2C2ZB 3DKDA 3WHIA 3WC2A 2DK2A 1HWJA 1YFOA 1W7WA 1SJ4P 2VEWA 2XMUA 2HK2A 4RUAA 1S1UA 3R27A 2I4EA 3M2VB 1OSDA 4RI5A 1RAFB 1GXUA 3SQGB 2MPUA 3K5PA 3RZAA 3U02A 2LQBA 3NGSA 5MMZB 1KVIA 4LREA 2GC8A 3KK1A 4USTA 2ZH5A 4K2JA 5ETRA 1KRPA 1FWPA 1U09A 4UAGA 3DLHA 2EBGA 3MD1A 3JTPA 2RJZA 1X4BA 2Y1JA 2HFSA 1MROB 3DM2A 1G4CA 2J16B 3PYFA 4B9MA 2Y1LB 1SKSA 4A48A 2B4VA 4QPTA 4YAAA 2XY5A 3BGLA 1T0TV 4B3TF 1NZAA 3QQCD 1B4SA 2GJTA 2NREA 9RUBA 4NX8A 3NKYA 1ZETA 4DV7J 3DHXA 3TJAA 4GFVA 5A8WB 5HSPA 1QVGR 4CQ1A 2C2KB 2LQ5A 1U4BA 2VA2A 2WRMA 5HBMA 3IM9A 3QCFA 2R8HA 4ILLA 3FUYA 3EE3A 4B3SJ 4IR1A 4ZJOA 5B08A 5HANA 2KT2A 1XMOF 1X60A 1ECVA 2OEJA 3FEZA 3N4WA 3PTWA 5T7LA 3EZOA 1RP5A 2ZE2A 5CYMB 2YKAA 5FDLB 2LKZA 4CM0A 5L1LA 1RWMB 3U1LA 4C2MA 3NRSA 1U1PA 1R6VA 2I75A 1OHCA 2YTCA 4ZDNA 4LFBJ 1VK8A 2XZTB 2HNPA 4FXDA 1REGX 1LFPA 1MU2A 5HVGA 3M6UA 3GFYA 4DL7A 3ZTRA 3H5YA 5HQLA 4YY3J 1TVRA 1OEOX 2ASYA 4CLYA 1U1MA 4FF1A 1WG1A 2OMLA 5E33A 1N88A 1S9GB 2E9RX 1N0VC 2SXLA 3K17A 1FNMA 5F9LA 2W9AA 1NDCA 5IBMA 1WI6A 3K5MA 1NKEA 4N7TA 4KH1B 2VODA 2ZHBA 2KRBA 4HTIA 1RLDA 2B4UA 2ZDOA 4PYAA 3G2XA 1SI9A 5FIIA 3MM5A 2IMGA 3NNAA 5DM6Q 3PX6A 5C2CA 4CYUB 2RQ4A 1U2CA 4GVLA 1JXVA 3VGSA 2DIVA 4CLKA 1SQEA 2QEPA 1UVMA 1LYVA 2ZUAA 2I4GA 5D0EA 1OESA 2WW4A 2WONA 2KJVA 4K0KF 2VF3A 1AB8A 4JI8J 3AJDA 4N5SA 1U0HA 4M63A 3CCLS 3HK2A 4WZQA 1HQUA 3ZV2A 3C46A 3SIPB 2KRRA 3V0IA 1EEHA 1ZS6A 4EMDA 3RGOA 4CH0S 4RWXA 4YQWA 4QPXA 4CVMA 2CNKB 2HFVA 1WKLA 2M4MA 2WVEA 4N56A 1YWFA 2M3DA 4IQXA 1IQTA 1FJCA 2X3DA 2KT5A 2NUUG 2QN6B 2Y68A 2J6TA 4OHEA 4FNHA 4I64A 1JLFA 5E5NA 3FRZA 1Q6PA 4JYAJ 2W9BB 1VOMA 2RRBA 2MTLA 3QFWA 5CYJA 3I7ZA 2ZUGA 5AXMA 1WEZA 2GS8A 2HQDA 2GNKA 1JIHA 2IC3B 2XLKA 1R8PA 3I0SB 3IAS9 1Z1ZA 4KTQA 1GQEA 1NHUA 3KNGA 3M32A 4KE5A 1HBUB 4ZHRA 2V5HG 2FB0A 3QIPB 3NAIA 5ETTA 1WEXA 5CH7B 3DRRA 1S6OA 3V0JA 5KFUA 3H4BA 3MAAB 5DRKA 3QSYB 2IBOA 1HWKA 1FRLA 1H2VZ 4B9TA 3AWGA 4IR9A 4FF2A 1U26A 4H4OB 3KMQA 2DR9A 2KT3A 1VJWA 4P2MA 1OPZA 3US5A 1DQ9A 3HFZB 4K4VA 4MFBA 1K1QA 2ATCB 1CEZA 1RB0A 2C2OB 4R5PA 5CHCB 2JSXA 4YDDB 4J37A 1VBYA 4BC9A 4KH0B 5DG9A 2A18A 2HHQA 1SPBP 1NL9A 5HN0A 5KFXA 2VJUA 2Y8WA 1NH7A 4F26A 3IBWA 3T5JA 2VOPA 3F44A 3L3CA 4NLQA 3DGVA 3ET6A 2IRXA 2XYHB 3QZ7A 4R25A 1CSJA 2JH3A 1C0UB 2P9GA 4ZVRB 3K5OA 3DRXA 1H98A 2Q1LA 3LP2A 4ANEA 2ZH1A 1JLCB 2DNHA 1T03B 1O5ZA 4AQYF 1WKKA 1T94A 1P9QC 3A8IA 4RBVA 4Z7CA 3FMWA 2YNGA 3Q8RB 2DEJA 1YPTA 1HWIA 1N54B 4LF8J 1R3NA 1LEOA 3CD6S 4QYZJ 2XS2A 2OEMA 3RRKA 4FKYA 2I1YA 4ERDA 2BDPA 4EBCA 3WIUA 2PDAA 4KI9A 2G0CA 3I55S 1HA1A 3KK3A 3G82B 3QCLA 2Y8YA 1NK6A 2VG6A 2DNPA 4ETZA 5K9FA 3M8PB 2VHGA 5E41A 2UXCF 1UWAA 1TP7A 4IRCA 2G2ZA 2XNQA 1NSPA 1CULB 4DXLA 4ECZA 2AM2A 5KA8A 2CQ3A 4F3MA 1DTTB 2BJ8A 4QAPA 3RZ2A 5LM7E 1C2PA 5LMUJ 3MM8A 4NLGA 1YRTA 2RS2A 4DQQA 3ELHA 1IBCB 2HPUA 2OLWA 1OMSA 4RLEA 3QYYA 1N5QA 4U8YA 3TP2A 2AP6A 2LQ9A 3UR3C 5HMWA 5B0DA 5K25A 7FD1A 4MKBA 3PYDA 3RTVA 4DG1B 1BMQB 1KS2A 4AE5A 2ILYA 2OJ3A 1NNYA 3BJYA 5D77A 5GMKa 3CJ8A 4LF4J 2KJWA 1OS5A 2B56A 2R2SA 2B7CB 2LCWA 4DQRA 2F6VA 1FRMA 1SQFA 4UF4A 4OV1A 3PFOA 4IFVB 2WW8A 2M8DB 1RPMA 4U7UD 3O8WA 3ZM6A 4B3OB 3C14B 3CJKB 3N0VA 2K2PA 5E3AA 3EYZA 4C3MA 2BZLA 3AXMA 5BR8J 5GAHU 4XO0A 1UAWA 1E8CA 3HVTA 1NEEA 1OJ4A 2GFFA 4KHRA 3H4DA 2HHHJ 3GG0A 2E9TA 3ISND 3DNCA 1S9EA 4ED7A 1XNQJ 4HEA9 1PH0A 2HBQB 1KAVA 3CJQA 4U7UK 2RVJA 1NLKL 3D66A 4C8MA 3QCHA 1XJWB 2HNDB 3RJMB 4YR0A 3O4UA 1U25A 3CCUS 1FJ7A 2I0XA 3Q8PB 3OHBA 1ZM2A 3EGWB 3D3BJ 2WVFA 2MKYA 3RAMA 4JI5F 3MF5A 4Y65A 2UUCF 1EKRA 5A8RB 2DKOB 1T11A 4EU0A 4DZ6A 5MLCV 3DN9A 3W3SA 1VC6A 3IFEA 4RNOA 2WVCA 1OQ3A 2NSCA 3IR7B 4TY8B 1TL3A 2V4JB 2FHJD 3SCIE 3GTYX 2H5EA 1F0XA 1C1BA 3CULA 1NK5A 3S01A 1M5HA 2FLOA 1RWVB 1T49A 4L6V3 5HLFA 4QW8A 1REVB 3OTBA 5KA2A 3CJ0A 2DO4A 1AFJA 4PPDA 4EYHB 2JFHA 3B4MA 1HQEA 1JXLA 1HR0J 4ZP8A 4J5OA 3IAM9 2AGPA 1HNXJ 4BJOA 4DCJB 3HO1A 3BQ2A 2CQBA 1HI1A 4DSIA 4O3SA 2BV3A 4C98A 5LJ3Y 2CQGA 4MJKA 3K0JA 3V6DB 3LWLA 3MZIA 5E0OA 3N6NA 1OYDA 4L74A 4DL2A 2MQNA 3A3NB 1L3KA 3JYTB 1Q1MA 4X2BA 3DOMA 3IRXB 4KYRA 1VBKA 4NNDA 1V3SA 2IIHA 4TU7A 4M5KA 1VQ7S 2HGNA 4DLEA 3ONQA 3AQPA 2XG8A 1XWLA 3UNYA 1X4EA 4YB7A 1L8GA 5EX3A 2IMWP 3IMQJ 2RF2B 4RH5A 3OL9A 4WU2A 3K58A 4NLPA 1BQNA 2CPFA 4LF2A 4W92B 3LW5C 2V68A 3G96A 4DL5A 1D9AA 4WIQA 2FVQA 2BR0A 2Y67A 2H4KA 2B4PA 2GJIA 4PXDA 3C16A 1S7IA 4ECSA 2CJZA 2CQ2A 4HJQA 3H42A 3PW7A 2DHSA 4OX9J 1S57A 5KFMA 3DDNA 2CMBA 2RUSA 2XO6A 3W1YC 2Q6BA 4M94A 3M8WA 3M8YA 4LRDA 5LOQA 3VAGA 2C3OA 1QUPA 2F9JA 2HQGA 3D2WA 2G1DA 1Y7PA 3V0FA 4RI4A 2C28A 4CTAB 4Y3CA 3GV8B 5G4DA 8AT1B 5KG0A 3ZNJ1 3KLEB 3CIZA 4D3PA 5IM0B 4H1OA 2BKNA 3HFKA 2ATLA 1XBWA 1FFWB 1IKXB 1IR1A 4X66J 3O44A 3PYEA 2BE2A 1WELA 4CT9A 4X65J 4NLWA 4I69A 1LXJA 1QAYA 4KKOA 3CD5A 3MURP 3SMZA 2NZ4A 1B70B 2B5JB 1TTHB 1VFJA 1X5PA 2IJRA 1JLGA 3VZIA 2XMVA 2O1PA 5M2UA 3R5AA 3OTCA 4ZP7A 3LF0A 1RTIA 2V8DA 2UXDJ 5B0EA 2MQMA 2EWHA 3U1NA 1W7KA 4WTOB 4LSNB 3TR5A 3KLHA 2LQ8A 1TKDA 1QSYA 1IJEB 4I4BA 1OY6A 1SC1B 1IM6A 3GILA 4NLSA 1TL4A 1VRQC 1RAAB 1YN9A 3S6EA 3H5XA 2OEKA 4Q8EA 4V19X 4RW4A 4QWCA 5K22A 2DD8S 1CJKB 3Q0AA 2QYCA 4QR0A 4ZPVR 1OEUA 2O67A 5KG6A 1HL6A 2QBSA 1NPPA 2V6AA 1RT2A 4B9NA 2EC0A 1X31C 4Z7YA 2HW3A 2QDCA 2QL9B 3BO4A 4PXCA 4Q8FA 1S4EA 5F8HA 1S6PB 2C7SA 4ER8A 3M2VA 1UVLA 1WACA 3I5AA 2X51A 3OT9A 3SQGA 3MMBB 4D3GA 2FLNA 3S3FA 2DNMA 1KR4A 1LQ9A 4C11A 2BM1A 1RACB 3MEDB 1MROA 4DR7F 2J16A 4ZVOB 3B78A 3R2DJ 3MPVA 4CVKA 4IO9Q 1K44A 4PWDB 4NZ0A 4GRSA 2VFSA 3MPWA 1UEVA 5KADA 3KLGB 1J27A 2H51B 1WHVA 2A8BA 3DRYA 1QM9A 3AXKA 2AV5A 5A8WA 3DOKB 1HBOB 1L8KA 2M8HA 3QPIA 4M5DB 3TWZA 2CM3A 3HJFA 2ROEA 5C7PA 5L46A 3C15B 1DFDA 2ZJQQ 3UN2A 2VOOA 3T5LA 5KG7A 5KT4A 3SBMA 2W1BA 5D6GA 4LRFA 4XPCA 2C3UA 2HC1A 4KO0B 3TVZA 3MAHA 2B9WA 4PG4A 4F25A 3GCXP 4U96A 4U9RA 2LECA 1ZZFA 2IVYA 1GQYA 2VORA 4ZVQB 5CYMA 1HHQA 2QA2A 5KFPA 5FDLA 2JHEA 3QAEA 5ETVA 3T1YF 4C0HA 4EK2A 3A4TA 4CLFA 2J8AA 3RB6A 2VC1A 5AXKA 1SBRA 2PA8D 2UVVA 1ROFA 4WYLA 3W61A 4DQPA 3CJSA 5D0GA 4LF6J 4EO6A 2YY3A 1XR7A 3R2CJ 4LF5F 4BCAA 3CDUA 2DXFA 1S9GA 4NL5A 3RYLA 3FSYA 2KH9A 2OFGX 5F8MA 2E0TA 3GJSB 2YKOA 4ECXA 4L3NA 4RWWA 1KNZA
chains in the Genus database with same CATH topology
2VASA 1TUVA 2NZ6A 2BBEA 2ESBA 2QE5A 2YNGB 2P4DA 1UVKA 4Y2CA 4DPOA 2PMZD 1VRUA 4QCLA 3F9AA 2LXIA 2FDNA 2M52A 3V4IA 5K14B 2AF6A 5IXUA 4WE1B 3LP1A 2IFXA 1N56A 1XMBA 4ZLPA 3ZM2A 1TKXA 4OX9F 3MFHA 2AJQA 4ZK7M 4J9SA 1TAQA 1VQSA 4Y2MA 1DBDA 2GHVC 2EFNA 3M9MB 1YZ4A 3OLRA 3QCDA 1U6FA 1URNA 3THPA 1M5KC 2QLWA 4OZLA 1GX6A 3J7YU 1WRMA 4CT8A 2EVZA 3PVXA 2ZN7A 2VG5A 1RT5A 2ZKUA 2BABA 3BGUA 3BN7A 3QMQA 4QWDA 3KK3B 1IBMF 4C8KA 1EETB 3EUNA 1RTJB 4F3QA 5BUGA 3C6UA 1Q7LB 5CCLA 1WF1A 4HLBA 2VG6B 5DGAA 1OHDA 4EEYA 2WB4A 1VI7A 3GSDA 2I6IA 1K0VA 1UJ4A 5MAOA 2IAJB 2QDPA 1M90T 2JWNA 2QO3A 1H6KX 2F40A 2HIQA 2RKIA 4DWIA 2BQ3A 3EXCX 2DNLA 5K5MA 2J0XA 1FEEA 1NO8A 1U1QA 3MEGA 4NCBA 1G1XA 4O3OA 2BQUA 3RRGA 2X1FA 1F5BA 1R6HA 3NS5A 4E0DA 1JXEA 4G1QA 2V94A 4X66F 2ZH4A 2AQ4A 1D0EA 4YDXA 3J7ZT 4GC7A 2VFUA 1N48A 4C97A 2MQOA 3PHEA 2LA6A 2MDAA 4MK7A 1S6QA 4CH1A 1UJ5A 3FNNA 1R8CA 3TUZC 1ZPVA 1WAXA 3MUMP 1NK9A 2I5JB 2Q47A 3MM8B 5CYQA 2R8GA 5K23A 4DR6F 5DDOC 1YTNA 1S76D 1KAKA 4X65F 5LXYA 2CNHA 2QA1A 3EXYA 3NGKA 3CCES 5J2PA 4FP9A 4OHIA 3M2RA 2LA4A 2YNIB 3IA0A 3Q8QB 4Q44A 4NLUA 3PW4A 2XLJA 2RDIA 4D3HA 3I87A 2IRUA 3I5BA 4FZVA 2EBEA 5IBSA 3OFFA 3D0GE 3J7Z5 3QJLA 3TAPA 3QCKA 1S1VB 1Q86T 3QWUA 2L9WA 2CQ0A 3QWPA 4RX6A 4XDDA 1MMLA 2ZNZA 4IOAQ 3CD7A 4CO5A 4DFJA 5CZVA 3PW2A 2P5VA 1X9MA 3MM9A 3W2WA 2W9BA 3I4HX 4ZPAA 4ECQA 2ZC3A 3GR0A 2F4VF 5FLXY 1Q53A 4DBQA 3AWFA 4WJBA 2FVRA 5BYRA 3EX7B 4DGPA 1FXRA 2UXDF 4LF7F 3ETOA 3G6XA 4GKKF 2J9DE 4DR5F 1PSDA 4I7FA 1NJXA 4F02A 3KK2B 4ELTA 2FTRA 1JB0C 1OHEA 3N6MA 3I9V9 2KZMA 2AW0A 3ZZTA 2IC3A 2XBPA 3KLEA 2UVRA 3F41A 2W8LA 3T1HF 4OI3A 4NOHA 1NJZA 2GQ2A 5SUHA 5I4MA 3I0SA 1AUDA 4RBUA 3EMUA 3EPGA 2EW9A 4MTPA 2ZH2A 5BJRA 2OIHA 1TAUA 1XRIA 2MZRA 1K1SA 2QBPA 1JNZB 3SDEB 4K4TA 5DQIA 1HBUA 3CEDA 4UW2A 2B7BB 3OL6A 1SJ1A 2MQLA 3PEJA 2DB1A 1PC4A 2JFKA 4H4KA 4NA3A 2C42A 3DI6A 3EPIA 3ZZRA 3QIPA 1S49A 5KFJA 2XCPA 4EBDA 1OSCA 2HHTA 5KFDA 2DNKA 2R8IA 1SJRA 1UA0A 2W25A 4ZP6A 1YTWA 4NLGA 1FTCA 2JFDA 3NCRA 2F9DA 3KHHA 1UL3A 2YNHB 4IG3A 1FXLA 3HKZD 1S1TB 4NA1A 4PWUA 3I4PA 3H40A 2CNIA 2P6XA 2HCMA 1H2TZ 1KQFB 3BSNA 1KFDA 4QUMA 1IKWB 4TNOA 4OFZA 4P2SA 3QGPA 3S1TA 4NCGB 3KLIA 1UJ6A 4O23A 1FDNA 4NRTA 2F3JA 3IWNC 3U96A 4Y2KA 1KQKA 5J2MB 1ZCKA 3THTA 3K5NA 3I9ZA 2BIJA 2UP1A 3HVTB 2L3MA 4WXOA 5LL6d 4EO8A 3CCVS 4C8OA 2I38A 3M1VA 4H4OA 1FKOA 3T9NA 4IH7A 2Y2FA 3V0HA 2XCAA 1JK9B 4UOCA 1X9SA 4KIAA 5I3QA 4ED0A 2R7XA 1RK8A 1G1GA 4H4MA 3PNIA 1VQ8S 1SL0A 1RI7A 4D3QA 3FEYB 1N32F 2FJAB 1U1OA 5JJBA 2PGCA 2C3MA 4O0IA 3G86A 2IA0A 1U6ZA 1SUQA 2K3KA 2OSRA 3UDLA 3LOUA 1AXQA 2HS4A 2W4CA 2NXUA 2GCFA 1S9EB 1Q81T 1IM4A 2RT3A 3CCTA 3IO1A 3PRDA 3BB5A 4QJVA 3MMCB 3D1HA