3MOZA

Structure of the ptp-like phytase from selenomonas ruminantium in complex with myo-inositol (1,2,3,5,6)pentakisphosphate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
314
structure length
314
Chain Sequence
QTVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHAEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate binding in protein-tyrosine phosphatase-like inositol polyphosphatases.
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
molecule keywords Myo-inositol hexaphosphate phosphohydrolase
total genus 110
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mozA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3mozA02
2CJZA 4YR8B 2B3OA 2SHPA 2CM3A 4ZN5A 1X24A 4NNDA 2H4KA 4Y2EA 2CM2A 2GJTA 2I4HA 2QBSA 3I80A 1T4JA 5KA2A 1FPRA 2F6VA 3S3HA 1NNYA 1T48A 1XXVA 4GRYA 2CM7A 3ZMQA 4H34A 4WOHA 4B04A 2I3UA 1ZCKA 3O5XA 1NZ7A 4WU3A 2VEXA 3I7ZA 4HJQA 1G1FA 4RH5A 4GE2A 2H02A 4QAPA 1PTYA 4OHLA 4YAAA 1XRIA 1AAXA 1OHCA 3QCJA 1WRMA 2IMGA 1PXHA 1C87A 2NLKA 2CNFA 2QCJA 1NL9A 1BZCA 5KABA 2I4GA 2QDCA 4RI4A 2P6XA 4QBWA 3ZM3A 4GE6A 2QDPA 2B4SA 2BIJA 4ZRTA 5KA9A 3F99A 1YWFA 2PI7A 1Q1MA 2I42A 2VEUA 3D1OA 2C46A 4KYQA 1PA1A 3MMJA 2QEPA 2P4DA 3QCCA 2I6MA 2Q05A 4J51A 2Q47A 1BZHA 3V0DA 2G59A 4OHDA 3F41A 3PS5A 5K23A 1ZZWA 1PA9A 2CNEA 3B7OA 2OC3A 1A5YA 1I9TA 2PBNA 1GWZA 3EB1A 3V0FA 3N0AA 5BUGA 3D9CA 4NX8A 5KADA 4WU2A 1XXPA 2HVLA 1PH0A 5KAAA 3QCLA 1U26A 1U24A 2A3KA 1OHDA 5K22A 3ZMPA 4BPCA 3CWEA 1EEOA 1SUGA 5MMZB 3RZ2A 1EENA 3O4TA 3BLTA 3O4SA 2BGDA 2BZLA 3S3FA 3SR9A 1OEOX 2HC1A 3MOWA 2Y96A 5GTJA 1LARA 4RDDA 4PVGA 1YN9A 3AWFA 3ZM2A 2I6OA 2QDMA 2M3VA 4D3RA 1OEMX 4KYRA 1R6HA 3D42A 1YTNA 1YZ4A 2VEVA 2NT2A 5K9VA 1WAXA 4GFVA 4Z6BA 2Y2FA 5BZXA 4R0TA 3V0JA 4DGPA 2QBPA 1YTSA 2H4VA 4NWGA 2ZMMA 4OHEA 2PQ5A 1M3GA 4MBBA 2R0BA 4TVVA 2GWOA 2FJNA 2VEWA 5J8RA 2BGEA 2I6PA 3GXGA 1J4XA 3V0IA 5IBSA 3EZZA 2H03A 3QCHA 3SMEA 5IBMA 3QCFA 2QBRA 3RGOA 4QUNA 5KA3A 3D44A 2J16B 1G1GA 1KAKA 3QCNA 1Q6TA 1XM2A 2B49A 2RF6A 2DXPA 2OUDA 2NT7A 5BX1A 3AWEA 1NWLA 3QCMA 3ZV2A 1OEUA 1T49A 1YPTA 3O3LA 1ECVA 4HJPA 1I57A 4R0SA 2YDUA 3EAXA 1WCHA 2J16A 3V0GA 3CM3A 2MBCA 1JF7A 2I6JA 4RHGA 2F71A 1QZ0A 2B4UA 4H1OA 4OHHA 3S3KA 2G6ZA 4GWFA 5KA8A 3OLRA 4I8NA 3EU0A 2FH7A 4NYHA 3RGQA 5KA4A 5EHRA 5K25A 2BV5A 2JJDA 1PTUA 3D1HA 1FQ1A 2CNIA 1Q6MA 4QBEA 5KA1A 1OESA 3S4EA 3OMHA 3H2XA 4IKCA 2GP0A 1G7FA 4GRZA 3V0EA 1BZJA 1L8GA 4JMKA 1G4WR 2HCMA 3V0HA 2F6FA 3AWGA 1ONZA 4PYHA 4GFUA 1NWEA 4Y14A 2PA5A 2OOQA 1G7GA 5AWXA 1D5RA 1Q6JA 2ESBA 2AHSA 3QKQA 4RI5A 4KI9A 2J17A 2B4PA 5HDEA 1LYVA 4D3QA 1JLNA 1YGRA 2FJMA 4S0GA 3GXHA 2WGPA 2HXPA 1C88A 1OHEA 4ZI4A 5EHPA 4BJOA 1OETA 2I75A 2QCTA 4AZ1A 2F70A 1LQFA 1RPMA 1VHRA 1OEVA 2F6ZA 1RXDA 2NV5A 2CNGA 1PTVA 2I5XA 3F9AA 1C85A 1GFYA 5K24A 1C83A 2NTAA 5LXQB 1G1HA 5KA7A 2CMAA 2VEYA 1NO6A 4ERCA 3S4OA 2CMBA 1FPZA 4JBCA 1G4US 2HNPA 2A8BA 2B07A 4GS0A 2C7SA 5BZZA 4R30A 2ZN7A 4D3PA 3ZM1A 3NMEA 1YGUA 2CM8A 4OHIA 1YFOA 1PTTA 5KACA 1I9SA 5M43A 4GE5A 3I36A 2F6TA 1KAVA 3QCDA 1QXKA 4JMJA 2H4GA 3EMUA 1V3AA 2F6WA 2OZ5A 2F6YA 4DGXA 2CMCA 2HY3A 2CNHA 1Q6SA 5KA0A 2H04A 1ONYA 2HNQA 1Q6PA 3QCGA 3RO1A 2CFVA 1Q6NA 3LJ8A 4RKKA 1PYNA 3BM8A 4QUMA 2I6IA 5I6VA 2I3RA 2NZ6A 4NWFA 3QCIA 2I1YA 3F9BA 3ZM0A 1XBOA 4RH9A 4JNBA 3QCEA 3QCKA 2E0TA 3O4UA 3F81A 3M4UA 2PSZA 1C84A 1C86A 3MOZA 3QCBA 2PT0A 1YTWA 1U25A 3A5KA 5K9WA 3QKPA 1L8KA 1ZCLA 2HC2A 3BRHA 3U96A 1P15A 4ICZA 3D1QA 2F46A 4QAHA 4HRFA 3A5JA 2AZRA 2QBQA 1MKPA 2HB1A 3S3EA 4WTYA 2B4OA 3BLUA 2I4EA 1ZC0A
chains in the Genus database with same CATH superfamily
2KRRA 3CO0P 1T9TA 3DHWC 4TYAA 4CLKA 1TAUA 4ANCA 4IH7A 3HFZB 3DU6A 1RA6A 2B3TB 2BKNA 1T05B 2XNRA 3D54A 2HS0A 3AOCA 1SUQA 2G0JA 2NXJA 2QMWA 5AJ3F 1DTQA 3HO1A 2HFNA 1NZ8A 5DG7A 3DLKA 2Y0BB 2KM8B 3NGSA 2MMYA 1N0UA 1D0EA 1UWBA 4HHJA 5IQ6A 2KT5A 3RG6A 1T4JA 4QBUA 2WVFA 3NWGA 1L3TA 3DLLQ 1VHFA 5D4LA 2ZKUA 2LEAA 2RB7A 3CT9A 1W2IA 5AXNA 4X4PA 1RCOB 1HLWA 4HH1A 4ZVQB 2B51A 4Y2CA 4DSJA 1HMVA 2YNFB 2RT3A 3FSYA 4GRYA 4RW6B 4DR2F 2RHSB 3ENVA 3NCRA 1X9SA 1AA1B 4DBQA 3ZMQA 1RE1B 2MEWA 2B9EA 1MNEA 4WK3A 5IWAF 4DV3F 3VGTA 4O0NA 4IQMA 2AM1A 1KTQA 1RBAA 1WHYA 1QAIA 1FDAA 1KVKA 2K1RA 3VQTA 4ZHRA 2DGOA 4JI0F 1F9EB 1FK9A 1VK3A 5SUHA 3W7BA 5IC4B 4RBUA 2Q6BA 3KXDA 5KG0A 1U1RA 1X60A 4ALZA 2HRUA 5KA1A 2HNYA 4PQAA 3K57A 2AW0A 2DNPA 3OQ2A 2UUBJ 1NZ7A 5KFVA 2VEXA 5BR8F 1RBLA 1S1XA 4TY9A 4ZDNA 2GCBA 1P1TA 3PM9A 1RZMA 2SXLA 3GE9A 4JUZA 1HNXF 1VQ9S 2DKOB 2M52A 3IGVA 4RH5A 1O5JA 5F8HA 3M7VA 4B3OA 1PTYA 2ZVSA 3LP0B 3P45B 1BQMA 3ISNC 4RW8A 4ZLPA 1RLCL 3PZPA 2FJXA 4KFBB 2ZNYA 1NHUA 5THWA 2RU9A 4ZVUB 1KOOA 2OTLS 2XI2A 3SR9A 3NG8A 1YZ7A 1S76D 3FBFA 4F4YA 3U02A 3LAKA 2PGCA 1RWUA 3MCSA 5BJRA 3QRQA 1FWPA 1P9YA 1S6QB 8RUCA 2ZH8A 4EWTA 3NGRA 4E0DA 1Y7PA 2HWIA 2V0NA 3Q8VA 4MTPA 5KG7A 2I4GA 4QPTA 2FTRA 1TL7B 3HSJA 3BO4A 2H5IB 1BXNA 5IT9U 4YHHF 1NJZA 4OI0A 4L3KA 3H2UB 3QFHA 4WKRA 1X0PA 4OJ3A 4C98A 4DR1F 3PKMA 5M2PA 1SCJB 3DM2A 5LXRA 5EWEA 1HBOA 2V8VA 3AB2B 5GVQA 2GS8A 1U49A 5KA9A 3RRHA 2DO4A 4ZN1A 2HMIB 3IRXA 4ZLJA 4ED2A 4C8LA 4X66J 4LF2A 5KFEA 2OD6A 2MKSA 3CDWA 4KC5A 1IQZA 2KG1A 2F8HA 5I3PA 3VVUA 1VQ8S 2VEUA 2GQCA 3KG0A 2W2MP 4H4OA 3OL7A 2UUCF 4PQUA 2MZ1A 4ZIWA 1PA1A 4C6AA 4ELTA 1TAQA 2HVDA 1QUVA 3M32B 3H8YA 2VFRA 2P4DA 2IJFA 3NWRA 4J9SA 1UEKA 3HVTA 2JEIA 3UI3A 3QCCA 3E8OA 2C2NA 2R4FA 1O0PA 2HZAA 4IKAA 1VQ5S 1BZHA 2GCFA 3OHAA 2WSFC 4BLGA 1RHUB 2UVRA 3MCMA 4Y28C 1URRA 5HVHA 4QBEA 1RT3A 2RDJA 2JLFA 2IYIA 3CD5A 3L09A 2BYCA 3F41A 2XO7A 4OLOA 4B3OB 2HHSA 2AF6A 4OHDA 2EFPA 5K23A 1N5YA 1M5PC 1S1UB 3MM9A 2PI5A 2LXIA 2BACA 3LW5C 1FDDA 4ILRA 1CJTB 1B7YB 3PNIA 1SJ1A 2NR0A 3GYGA 2CPJA 1GWZA 5C2CA 2RUGA 1FEHA 3NRBA 4XO0A 3V0FA 2W25A 2YWFA 3QT6A 5D0EA 4QIVA 1VK8A 2NYHA 3ILOA 1OYEA 5KT4A 4IOCQ 1YK9A 4QR1A 2FY1A 4NX8A 1JLQB 3HKZD 3D6FB 4NLRA 4AQYJ 1YITS 1RAOA 1WD6A 4LSZB 1XXPA 2HVLA 1FDBA 2NPIA 3OR2B 4DR2J 5DM7Q 1JKHB 1OYDA 2A18A 2IRUA 2VDHA 4NLXA 3DLEA 3BM7A 3W1YC 3MAAB 1U26A 3ISND 3TZWA 4RW7B 1EKRA 1U24A 1YRUA 1OHDA 4BPCA 1NLKL 3FBBA 4Q8FA 3MR5A 1SUGA 3AD9C 2AJQA 4AXIA 2DR9A 3TAMB 2XC9A 4S0GA 5E33A 4CLLA 3T41A 3LF0A 4ZKAA 2YKMB 1LEOA 3BO2A 4NYPA 4LF5F 4FF3A 1I51B 1T95A 3MOJB 3KLIB 5GAHU 1VLYA 2G1HA 3HD2A 1OEOX 2AYEA 4X4NA 2Z4PA 1NPRA 1UFKA 3Q8YA 1N0VC 2OELA 2GJFA 3MUTP 5D4OA 1NK8A 1LARA 4OX9J 1F9HA 3BSCA 3HJVA 4L3NA 3T1YJ 1N34J 1Q82T 2I6OA 3ZM2A 1VQOS 1BGXT 1WCHA 3FMBA 2QDMA 1S57A 3NBPB 4IOBA 4LRFA 4TLQA 2QYGA 1TKDA 4JI2J 1S77D 4F2RA 2M3VA 2E1PA 1JLEA 2F5GA 2QG9B 5DQHA 2GO9A 1X4GA 2ZUAA 3DLEB 5ETNA 4UUWA 4DZDA 5L8RC 2E5LF 4JI7F 2F63A 3R7SB 4DZ6A 2A3JA 4ZMMA 2OLWA 1Q53A 3GJRB 1YHQS 1S97A 4ERDA 1UWAA 1C2PA 3QO9A 1YTNA 1YZ4A 2VEVA 2IRYA 2O5DA 1FDNA 2G13A 2CJAA 3VWSA 1GX5A 2KT2A 1QAXA 3Q83A 3W61A 2M7SA 1G3OA 1GH8A 4LSNA 1NSKL 2VONA 5K9VA 2E9RX 3MEKA 3GIIA 1S59A 1HWUA 2NZCA 4K4TA 5E3PA 2JJ4D 1WJ9A 2HLTA 5IZHA 2WZ1A 1QUPA 4XK8C 5EX0A 1VQ4S 3K0JA 2H4VA 1FVSA 3V0EA 2ZMMA 1NPKA 3ZTOA 4DV1J 2LECA 3DRYA 5GMEA 3MVNA 4IG0A 1EIYB 4H4OB 4DUYJ 4KPCA 5HI7A 2WTFA 3DOLA 3NBPA 2GA7A 3G6XA 1IBMJ 1I3OB 2FPHX 5J8RA 2BM0A 4DPXA 2GIRA 1NK7A 3IN5A 5D15A 1EJ7L 4EFAC 1GXTA 3RZAA 4F36A 1TFWA 4CNZA 5HJXA 3ISZA 1GXLA 1VQ6S 2CVEA 2MKCA 3MDFA 4WTOB 1TK5A 3BREA 4P74A 3N79A 3MUVP 5G4DA 4R0TA 3EYZA 5IBSA 1W26A 5LT5A 2AYBA 3SMEA 4NCAA 3QCFA 1U02A 2QBRA 5A0YA 2HHHF 2MGZB 3S7RA 5KG6A 4J9QA 2MQOA 1S6UA 1M90T 3JAMU 4OJ1A 1YRXA 1DZ5A 4B9LA 5CZXA 2G1DA 1T7PA 2GGPA 2NXNA 4X62J 4JYAJ 2CPIA 4I1TA 4IQXA 2AJ2A 1Y9OA 2GO8A 1XM2A 3D3CJ 4ZIVA 5C24B 3M4UA 3AH6A 3HT0A 1GEHA 4BC7A 2H5JB 4LRBA 1UPMB 3GJTB 4L76A 5E41A 4Z7CA 3VAKA 1N32J 5BX1A 5KFUA 2D74B 2YNIB 4N76A 5J2NB 3AWEA 1WEXA 3AOBA 2DNRA 4OHYA 1RKJA 2DPIA 3GLJA 2ILZA 4QJVA 4HJPA 4J9MA 1CS4B 2ACMA 3UN2A 3V0JA 4PKDB 4UT4A 1C0TB 5AXKA 2IDLA 2GIFA 4NCGB 4C0OC 2IM1A 4PWWA 3W64A 5KFOA 4R0SA 4MFBB 2BX6A 2YKMA 2D41A 3R97A 3LWLA 1QAJA 3H5UA 4X2BA 1W78A 5HROA 3KNAA 3FCWA 1RYRA 2KFZA 1X7VA 2XI3A 3CIMA 2X51A 5F8GA 1JF7A 3B8HA 2MBCA 1FX4A 4NA1A 2QC3A 1XRIA 1TKTB 4O4RA 4PZVA 4P71A 5B0EA 4C8YA 4RUBA 1SL0A 2BIJA 2RE1A 4N5SA 3OPKA 3DLHA 4MYUA 3VHQA 1JNRB 2YKQA 4OHHA 2G6ZA 2H4YB 1DLOB 1XMQF 4F26A 3T5KA 3M8QB 2WJPA 1FEEA 2YX7A 5KFQA 2W9AA 1K1SA 1GMWA 2E66A 3K5OA 2DH8A 4ES3A 2CQCA 2DR7A 2BOAA 3RGQA 1FRKA 4C8ZA 5EHRA 5IT4A 2E5GA 2BOPA 1DTTB 4L73A 1V3RA 1HQEA 5JVHQ 2UAGA 3KJVB 3FMWA 5EGYA 3BBBA 3J7AN 4FBUA 4U7CA 1WC0A 3HHDA 3RYLA 1O5ZA 1TMMA 2VPZB 1ZOTA 2J6UA 1VISA 3SQOP 2BA9A 1JQGA 5AE3A 2CNIA 4PG5A 4DJBA 3O44A 4LJMA 3AY0A 1HPZB 1SBRA 3N5FA 3ZO7A 4DV2J 4ED6A 1NJYA 1R0BG 2GJIA 3QWUA 4OFZA 3CCMS 1Q6MA 2XMKA 5D4NA 1AUSL 1EQMA 2K8GA 4KV8B 3MMCB 2UUCJ 1TKTA 2ROEA 2V8PA 4LR9A 2PMWA 1VQNS 3M1VB 1G7CB 3JSYA 3VR1A 3CCQS 1QM9A 3H2XA 1EEHA 1G7FA 4IKCA 5ETVA 2GVZB 1OY8A 1R0CB 3GB0A 4GRZA 3CIZA 3CCJS 3FDSA 3M8QA 3TX0A 1FGSA 4C8NA 2FHMA 1X4BA 1HI0P 2OEKA 4YN3B 2ZHBA 4URSA 1L8GA 1C4CA 4JMKA 5G0RA 1G4WR 3AXKA 4DCJB 2F6FA 5J2MB 4I4BA 3U1NA 4V19X 1G6BA 2UXCJ 2LDIA 4C3MA 4EBCA 5J1NA 4EBDA 1KLNA 4PYHA 1QTNB 4Y6IA 1S1XB 1QJHA 4ITSA 2J6TA 4R8UA 3VGVA 2IY5B 2PA5A 2CQ1A 1S1TA 1F2HA 2E5HA 2Z2YB 4J9KA 1D5RA 5AWXA 2M0GB 1WI6A 2KU7A 3KLEA 2HURA 2DYAA 5C7PA 1YRTA 4KV8A 5CYQA 5CXTA 3HKWA 1F9FA 2RU3A 4LVOP 2Y68A 2ZM6J 5DJBA 4RNFA 2AHSA 4RI5A 1AT1B 1RWXB 2K3KA 1SC4B 4USHA 1FWKA 5D8HB 1EX8A 2HFSA 2NYIA 2H51B 3C19A 2HHWA 2JWNA 3PYDA 3J80U 2OTJS 1ZPWX 3GIJA 3OV7A 2HBQB 4TNOA 3SV3A 4H4MB 4ICLA 4QYRA 4LFBF 4N41A 4PR6A 1WACA 3CWJA 3PEJA 4UZBA 3V5RA 5KG2A 3OTOJ 4D3QA 2DEJA 2FDNA 4F4KA 2J7WA 3GSIA 1ITPA 3KOAA 2FGCA 1YGRA 2FJMA 1NK5A 2XMUA 2D9PA 3IRWP 1MWZA 2EFQA 2GV1A 1Y10A 4ED8A 3DM2B 4U6PA 2UUOA 2WGPA 5KG1A 3VV2B 2VG7A 1HNIB 1LW2B 2Z2ZA 2UXBJ 2HVIA 1S1TB 1FVQA 2IBOA 4BBYA 3G8SA 3THPA 4UY85 3IS9A 3R5GA 4BJOA 1FJEB 1OETA 2Q66A 1HQUB 3CD7A 3BSNA 4NI2A 1TL1B 5F41A 1DRZA 2FJDB 2BJEA 2ACYA 4DX6A 1FX2A 5ITHA 1VQSA 1SH2A 3FUYA 5F0WA 3M30B 4FDFA 3G86A 2D1CA 2KKHA 4GO7X 4CWBA 3D5MA 1WC6A 2FQQB 2I9SA 1SJ3P 4ELVA 4DR6F 1GFYA 1RGVA 2LVWA 2IAJB 3MEDB 2MSSA 4RUHA 1FESA 2XB2D 1L3SA 2EG2A 2MB0B 2QFJA 1UVKA 5LXQB 1G1HA 4M5DA 3LQVA 2W8LA 3PX0A 2HAFA 2YTCA 3EVMA 3ILLA 4EI2A 2CMAA 2GNKA 2V67A 4FNHA 1CJUA 4Y34A 4X4RA 1S7HA 1H98A 2H48B 2CMBA 1HPZA 1RB0A 3Q8SB 3QLHB 3TO8A 4C11B 1IM6A 3CJ4A 1YJ7A 3RB6A 1NO8A 2A8BA 5GMKa 4GS0A 1NSPA 1ROFA 4ED4A 4PG8A 3R5JB 1RTDA 2E1CA 2QA1A 1NH7A 5ETTA 2LP4A 4OIXA 3DYAB 4UW2A 1EAYC 1KFDA 3C6TA 1JLAA 2WB1D 1SXLA 1TL3A 2ZVIA 1WOOA 4G1PA 5EDWA 1SQFA 4QW8A 4OHIA 2U1AA 3LP2A 1PTTA 4G1QA 2G2OA 4OYBA 2C2ZB 4I6AA 2U2FA 1GXUA 3BEGB 2M9KA 2G4BA 1RK8A 1H74A 3AQOA 3RBEA 1VRQC 2P6TA 3QGHA 2BQ3A 4WIQA 3QCDA 3PW7A 1M1KT 2DB1A 1JK9B 3TUJC 5LJ3Y 3PVXA 1S6OA 2DNNA 3BDEA 1E0DA 1X9WA 2Y1RI 2Z57B 2LLZA 3I0RB 3POTA 4J9UE 2OJ3A 4MAKA 4JV1A 3AB4B 2DY9A 2V63A 1TQLA 5F3TA 1RT2A 4USTA 2FJEB 4U95A 2KH9A 2CMCA 2FJAB 3T6JA 2JFFA 1UP1A 5A2QY 3BQ0A 3ENAA 1B99A 4PUOB 2VC0A 3C16A 1Q6SA 2KYXA 4GKKF 4X65F 3B4DA 3QATA 3CF5Q 3T1HF 1J5EF 4HTIA 3MTJA 1TKXA 4IR1A 4QUMA 4FYXB 2WB4A 4RW6A 4ZCIA 3GV7B 3PJXA 2IFXA 6FD1A 3SI8A 5K8NA 2CQ2A 2I3RA 4ZJLA 2CUYA 1U0SA 4UOHA 1D1UA 4QDIA 3I55S 2GW8A 2YNIA 1FJGF 2XHCA 4E2FB 3TARA 3ZZZA 3OL6A 4UF4A 1HBOB 1VRUB 2BXJA 3M05A 4JNBA 1JNZB 3D0IE 2C28A 2ZH4A 1RWKB 3FEXB 4TKTA 1P27B 2MXYA 1PILA 1NNDA 4TN2A 3DFEA 1QAYA 1PSDA 4OZ2A 1Q81T 3CJ5A 1FFSB 3O4UA 5LMNF 4M94A 4ECWA 4Z7YA 3PO5A 3FEZA 4NE9C 3VGUA 1LWFB 1MN7A 1TKZA 1N4LA 1I5OB 5HROB 2UXCF 1YTWA 5SZTA 4TU7A 5K9WA 7FD1A 3T3FA 4RBVA 1K47A 2XCPA 3DRRB 4LQ3A 1O51A 1L8KA 2EI5A 3PFEA 5K8PA 1CPZA 1S9FA 3LWMA 2OKQA 3BKUA 5B7WA 3GFHA 4JI4F 3EZUA 4WP8A 5IC6B 1NKCA 2UUBF 3MM6A 1P15A 4N7TA 3B4MA 3NY0A 2EBGA 3C8YA 3QQCD 2QEXS 2B6AB 3EDRB 2XPCA 4ICZA 2HQ3A 2X1FA 2VPXB 2D3OR 5E0OA 3V81B 2IRXA 1LXJA 1W25A 4J9VA 3KLGA 2F46A 3FCVA 2AYGA 3M2UB 2ILYA 1WEYA 3NMAA 2AWZA 2FYXA 4O3SA 1UZHA 4RBTA 5IWAJ 3M9MB 4J9RA 2DHGA 1MWQA 3R6GB 1C1BA 2ZBRA 2LQ5A 4KHRA 5HMYA 4DR5F 2GHPA 1NJXA 4Q0BB 3R5CA 4PYAA 3P3DA 1PBUA 1VDHA 4IG3A 3CMAS 4X4TA 1LWFA 1TKZB 4K2XA 3QRRA 3S3EA 3NAIA 3BLUA 1T8EA 4B3MF 5DO2A 1VMBA 1WG1A 2NXCA 3GFYA 3DXSX 4KGKA 4KAIA 1CJKB 5L39A 2I4EA 5KAKA 2XMMA 1FE0A 2B5JB 1GAOA 1RT4B 2I1RA 2VBWA 4NLWA 1CJVB 1QE1B 4GMKA 3TRGA 2VU5A 4YFUA 4R5PA 2Y67A 3V6DA 4LF6J 4YR8B 2M4MA 3KFWX 3UCUP 2SHPA 4DX5A 3A8KA 4DV1F 1X24A 4NNDA 1Q8IA 2H4KA 3I96A 4Y2EA 2CM2A 2I4HA 3CCTA 3HZEA 2FLLA 4X4SA 3L3CA 2Y66A 4TY8A 1NB2A 5KA2A 1GT8A 1FPRA 2Z2LA 5DG9A 2F6VA 2MQMA 4HLBA 2VB6A 3AODA 3QO9B 2H9ZA 2V5HG 3FK4A 3JSMB 4OHWA 1JLGA 1NNYA 1WDTA 1LNQA 4IFVA 1NDCA 1AROP 1FKPA 2CADA 2DITA 1UWBB 3BGLA 3SSSA 3NNCA 3TUZC 1XXVA 2LDYA 3IXQA 2CM7A 4RW4B 3SZ2A 2XSJA 2MYFA 4NLYA 4OI3A 4ZCLA 4C8MA 1LWCA 3OTCA 4DV6F 1YI2S 4H34A 4WOHA 1VJQA 1F6TA 2AKWB 3K7RA 4YB5A 2HEKA 3AD7C 4CO0A 5HSPA 2V2QA 4EEYA 4OX7A 1RAHB 5E3CA 3CCVS 2WCXA 4OYAA 3MM7A 4ZCMA 1PJ7A 1ZAXA 2IJNA 4JI3F 1ZCKA 4J9OA 2RDDA 4QZVB 2FJBB 1EP4B 4H4MA 4ICLB 5DQIA 3QT8A 1OO0B 3I7ZA 4LSLA 3MZIA 1Q8BA 2K1RB 3NRSA 2HQGA 4C4WA 1ZTTA 2P2CB 4HJQA 4P52A 5D0HA 3GONA 1SC6A 3EX7B 5LMUJ 4GE2A 2J0WA 5L1KA 2H02A 1WTFA 1EB0A 3OR1B 5ETSA 5A0YB 2Y1IA 2VFSA 2EC2A 2V6AA 4N8OA 4F0MA 1WKKA 2XULA 2C42A 1S48A 3M6WA 3CCSS 3JB9k 1N36F 1F60B 2XS5A 4AL5A 1QSYA 1YDLA 4QYZJ 2NZ4A 4MH8A 1PXHA 1B0VA 3EGNA 3A8IA 1ICEB 1C87A 1OSDA 5KFCA 2XS7A 3KDOA 3L7OA 1V5VA 3SCIE 3BKTA 3FFIA 2HRYA 3T9ZA 3KK1B 4GVBB 2YBVA 5I42B 4RI4A 4QF5A 2MKKA 1FCAA 1FNMA 1E6YB 2KXFA 1KTVA 4EUVA 1N88A 4QBWA 3M30A 1WDDA 3D68A 2JFGA 3ZM3A 4FS2A 2UXBF 4OI4A 3T5JA 3DN9A 1U1MA 4ZRTA 4JV5F 2XY7A 3MMAA 2EG1A 3OVBA 3L4BC 1T05A 3HULA 3F99A 2OPSB 4XIUA 1C1CA 3JQMA 5J2MA 1HW9A 1R8PA 3RU0A 1Y5NB 3SIPB 2CAJA 1ZA2B 4GC6A 3OTOF 3KLHB 4LFBJ 5K8OA 3VAFA 1NHVA 2V2KA 2VBZA 2B9WA 2AGOA 3CULA 3MMJA 2GMHA 3I4PA 4KY3A 4CP5A 4A8KA 2Z2MA 2P9CA 1KSPA 2Q05A 5B0DA 2CQ4A 1TU0B 2IDEA 3UVJA 3V0DA 4TU8A 2C2DA 1JLAB 9RUBA 1WNEA 3BSAA 3I31A 3PKYA 1HD0A 2RMLA 3DRXA 3JTOA 3R8YA 1CC8A 5EWGA 2UVVA 2J9EA 4OX9F 3FRYA 2MJUA 5J2QB 3W8PA 5GADU 1H2VZ 5MLCV 4X84A 2OC3A 2DHSA 3BV8A 2QLBB 1I9TA 3MMBA 1HBNB 2QA4G 2EWHA 2RQ4A 4RNMA 3N28A 3I0RA 4AXJA 1JXVA 3HHNB 3DDNA 3UD4P 4CT8A 4YHHJ 4B9MA 3PXGa 2FZGB 3NGKA 3H5YA 1T3NA 4QIWD 3MEGB 5HAOA 4ECQA 2V50A 4WU2A 3RJMB 4DG1A 3GIKA 2V4JB 3ZZRA 2IYGA 4DV5J 2I38A 3G6ES 2VTDA 1R7IA 1Y0HA 2CG4A 3HFVA 2Y8YA 5KAAA 1WTBA 2IM3A 4Q2LA 1UA0A 2VOOA 4OJGA 2K7JA 3BN7A 3M8YA 3VTIA 4A8XA 3VAGA 1YJNS 1D09B 4OJHA 1R0AA 3ZMPA 5KFAA 2W01A 3AA8A 2E1RA 2MZTA 1OY6A 2QMUB 3K8VA 3O5TB 1QLNA 4I2QB 2L3MA 4BDPA 2F40A 2XSFA 3RZ2A 1EENA 1FD2A 2BW7A 5E3AA 5DLGA 2YWKA 2BZLA 1DY3A 3PDNA 1AFJA 3OJSA 3H98A 4O3PA 1X9MA 3MOWA 2R2UA 2CWKA 4BWMA 2GIQA 3KMQA 5GTJA 1BHNA 4ZPAA 2KB2A 4DOZA 2AGPA 2VODA 1VIXA 4RDDA 4DN0A 5D78A 2E7WA 4LRAA 4C8KA 1HWJA 4AL6A 1JBVA 5DDQC 3ZTPA 4KQZA 1MMLA 3DDIA 2F8EX 2ZE2B 4P2FA 4Y0FA 3B82A 3PX6A 1URNA 1YVFA 5DG8A 4LT6A 3V2UC 4JV2A 3M8ZA 3UWTA 4DL6A 2HHTA 2HNDA 1F2GA 4KYRA 3MECA 3OTDA 3PX4A 4Y65A 3TANA 2GC6A 1R8CA 3CJTA 3KHGA 1RWMB 3IWLA 1FXDA 2AJFE 5EUHA 4U67Q 3AD8C 3PR4A 2NT2A 1F1BB 2RQMA 3QZ8A 1ZZFA 5ETQA 3KMSA 4DV5F 4Z6BA 4GFVA 1T9YA 3FBCA 4GRSA 4X4QA 1VJWA 2LQJA 1RAIB 6FDRA 4CIOA 2Y2FA 5BZXA 4OQJA 1X8DA 1KQKA 4C0BA 3W65A 3M8RA 1GTHA 3A12A 4NXMJ 3D6TB 2FHOB 1K9MT 2F9DA 3X3UA 4ENOA 1XQIA 4DGPA 3KKFA 2O01C 5AJ3J 3NXZA 3R2DJ 2YX4A 5IV3A 1DQAA 5JMNA 3Q8RB 2W9CA 2R7WA 4CLWA 1RT2B 2OSQA 2P8IA 4NL5A 2R0BA 2E5JA 4O44B 4KSEB 1SC3B 1FXRA 2KRBA 4DS5A 3T1HJ 2QT7A 4E8UA 4AT1B 2XLIA 1NK9A 3R2CJ 5BR8J 2VEWA 2ZUGA 1DQ9A 2OPQB 2UV8A 5HATA 4QWEA 4KH1B 2AZ1A 1UJ4A 4MIAA 3I82A 3KLVA 1RU1A 1OY9A 3CW2C 2RQCA 3P49B 3GXGA 1WF0A 2BKPA 5K8MA 1KONA 2JC0A 4NLTA 3Q23A 3HLUA 1X5OA 1Y11A 1R31A 3MM5A 3EZZA 1UVNA 1W7WA 1KS2A 4USKA 4ZPWR 2AIRB 4QQBA 2R8GA 4CLSA 4LVNP 3J81Y 1GMUA 4ECUA 2UUPA 1MMDA 3M2VA 1HNIA 1LW2A 2JFDA 4DF8A 2VV5A 2DHXA 1Y3JA 1EHWA 4K7QA 5L1JA 1XBWA 1S99A 3L9ZA 2W7PA 3W9JA 2ZH6A 3ZFVA 1WORA 3D28A 4K4XA 4FF4A 3E2EA 2GZOA 4OV6A 2XMAA 2CIMA 3GJSB 5HLFB 4F4WA 4NMLA 2XQCA 2YKPA 2DRAA 1G1GA 1Z1ZA 4M5MA 3FKBA 4M95A 5D6GA 3ULHA 3ZZUA 4Q43A 2RF6A 5KFPA 1OPIA 2P6SA 3ZZTA 4ES1A 2DXPA 5GAEI 2OUDA 2HBRB 4AD6A 2HBZB 2LA4A 2ROGA 3LAMA 4CNYA 4XPCA 4IRKA 1RHRB 1YBAA 1SH3A 2CQ0A 2RSQA 4ZPCA 5L1LA 1C4AA 4KYZA 4FP9A 1TR0A 2BANA 3H4DA 3QCMA 5LM7E 2AM2A 3ZV2A 1OEUA 5HQMA 4YR2A 2L9WA 4W4MA 5LL6d 1FERA 1JXEA 4WKYA 1I6JA 2R7VA 2EFGA 2CJBA 3B54A 2HVZA 2QTWA 1VLOA 1WC1A 3TVZA 4NLOA 2YDUA 3EAXA 1H7WA 2D9OA 1R8BA 2HWHA 3RR7A 5KG4A 4PWDA 1JJCB 3PTWA 3VAHA 1RAFB 4F50A 3PW0A 1RAEB 1S12A 1NKBA 3P6YC 2J16A 3OSPA 3OXFA 2J7UA 5E3RA 2PMZD 3ZXWA 5F9NA 2I6JA 4HACA 4M5GA 4Y2AA 2KHCA 4KPYA 4E98A 3P4UB 2B4UA 4U7UD 3DRPB 4NLQA 1H38A 3AFGA 2Z0GA 3K59A 1BMQB 1PYOB 2MKHA 5ETKA 1OSCA 2JZ5A 4EMDA 5I3UB 4GWFA 2HS4A 5KA8A 2NT7A 2IPOB 2ZOMA 1VFJA 3JQKA 4JI3J 2FH7A 1Q79A 1KHVA 1JLQA 1WKLA 2XM3A 1FE4A 5EHHA 4IDKA 2R9LA 3ZZYA 3DOLB 4B9SA 3B78A 1XR6A 3OFGA 2I2YA 3JXOA 2Y96A 1IKYA 1F3VA 3MEEA 3WIUA 3UAGA 2ZC3A 3DOMB 4MKYA 2BV5A 2HHVA 4YB6A 4HDGA 1MLAA 4ATNA 4PWDB 2AEMA 1WHWA 4P73A 4RL1A 4QWDA 3KLFB 5AE2A 1R43A 1HI8A 3MF5A 2KO1A 4KGMA 1UVLA 5KFYA 2ZD1A 4Q8EA 4LF4J 1FKPB 3WC0A 1RBOB 2VG5A 2JH3A 4F4XA 4B3SF 3OMHA 1NHKL 2NXUA 5D77A 5LOQA 3DI6B 3SBMA 5KG5A 2V69A 2ZH5A 4NASA 3MWBA 1RYSA 3SCKE 2WVDA 1LOUA 5IOLA 1KQFB 1XR7A 1XMBA 3W63A 2ZJQQ 1T03B 3OXLA 2GJ2A 3NL0A 4WF9Q 2CQPA 2Z8QA 4LR7A 4AYBD 1AW0A 4KT0C 4KH0B 2NSCA 3IG1B 3V0HA 5ETLA 1IJEB 3G8QA 7FDRA 4FBTA 1V5IB 2G9OA 5HMWA 2BJ1A 4AUKA 4ZJOA 5J2NA 2BEFA 2LCWA 2RF2B 2JFHA 2QJ3A 4GFUA 4CT9A 1NWEA 1A7GE 3GU0A 3Q86A 4NLPA 4ILMA 5IS2A 2AMCB 2E5IA 1A6LA 3H5SA 1RT3B 4P10A 3VQSA 3CJ0A 1FNXH 5GAGU 1Q6JA 3R6LB 2CJQA 5T41A 4BS2A 1U4BA 1IKVA 3GTYX 1NSQA 4RU9A 1VBZA 2HNZB 3ENQA 2NS1B 4XAKA 5CA5A 2HFOA 3VALA 5IV4A 3I32A 1B3TA 2ESBA 3FQLA 4KI9A 2JFKA 2J17A 4WZQA 3QIPA 4WFZA 5B09A 1SJQA 5JJBA 3FSIA 5ETRA 2ADBA 1PJ5A 2AX0A 5CYQB 4DV2F 4B3RF 2ASYA 4F2SA 1VQLS 1SIZA 2B9YA 2W4CA 4LF7F 2OIHA 1LYVA 3MM8B 4USWA 2EK6A 4C0HA 3FBEA 2BQRA 4CYUA 5AE1A 3KHLA 3JTNA 1YJUA 3LGMA 5DGAA 1U1KA 2PE8A 3RB4A 1RWOB 4IR9A 4DX7A 3Q2SC 2MKJA 5K5MA 4ED5A 4O3RA 1CQMA 2VQEF 4KBIA 1JLCA 1QSLA 4NLSA 2HXPA 1RABB 2R42A 2ZEJA 5IM0B 4PPZA 1C88A 1DTTA 1OHEA 3IAM9 1HKAA 3PFOA 1IJFB 1FI4A 1S0NA 2AYMA 2CQBA 3ELHA 2HGMA 3MD1A 2VJVA 1LXNA 2QCTA 1FWLA 1M0SA 2KJWA 1XNRF 4AZ1A 3AAWB 3ENWA 4S0MA 1EKSA 2CNNB 3PRVA 1RT4A 5KT6A 2AD9A 4Q2MA 1YLXA 2FUG9 2WW8A 1PC5A 3DRPA 2BJ3A 3AOAA 4PCQA 2CJ9A 2F6ZA 3VAJA 3AT1B 2NUUG 3PRBA 2F7VA 2CNGA 1REVB 3BR8A 3CJSA 3MMCA 2PO4A 2I5XA 2QRRA 2V8GA 1C85A 4HHHA 2Q1LA 1FRMA 3BS9A 2CVIA 3IR6B 2MZSA 1C83A 3FGVA 4CYUB 5T14A 2FLPA 2HK2A 4NWBA 2XYPB 1LW0B 1IBKF 1HYSB 4K4WA 1Y5IB 3VF0B 3C15A 4FZVA 3T5HA 2VOPA 4IUFA 1Z2ZA 1WOPA 2ZJRQ 4DV4J 5KFNA 1LFWA 1J5OB 1Q8KA 1U2FA 2RJZA 5DETA 2ZH9A 1IUJA 2H4WB 4J37A 5C2GA 4ZVFA 5KT2A 4DWIA 1FPZA 1G4US 3P96A 4K0KF 1YQHA 2F8MA 3NP5A 4I56A 4OMFG 2B07A 3E3XA 2KG0A 3WQPA 4JI0J 3C3LA 2O66A 2RIJA 1SI9A 4LBHA 2K7KA 2A6MA 3PIOQ 2LA6A 2RHQB 3G87A 2VG5B 4YP3A 2YNGA 2FD2A 2HBYB 3T9NA 4B08A 4ILLA 2VQFF 4D3PA 2EFVA 4DV3J 1MU2A 4A8WA 4X62F 1YGUA 2CM8A 1YFOA 3GG0A 4URQU 2QL9B 4L74A 1Q5VA 4PG4A 3K5NA 4GE5A 5MAOA 2XCAA 3UDLA 1NJWA 1RISA 3GYXB 5IQQA 3A8JA 2F3JA 1GQEA 1CEZA 2D69A 4A46A 3CVKA 1VC5A 3EMUA 3N5BA 1V3AA 4NCGA 2V34A 4K5SA 5M2UA 1K8AT 2VFUA 1P1LA 1OHCA 4YUDA 2OZ5A 3GFZA 3OD2A 1F5BA 3QT7A 3EWGA 1U1QA 2F6YA 4DGXA 5C42B 1SJRA 3H25A 2C2KB 1VC0A 2FJWA 3QWPA 1KLMA 3L95X 3O8WA 4RWWA 2H04A 1ONYA 2QLFB 4YS2A 4DL7A 1Q6PA 4YEAA 4DUYF 4JV0A 2R7TA 4P75A 4CH1A 2CFVA 4X65J 2J7KA 1U1LA 1PYNA 4USUA 1I94J 4PRFA 1PAUB 3FC9A 4A48A 4KHMA 1ZYQA 4DL4A 3U1MA 3R7BB 2CQIA 3M8PB 3TP2A 4RKUC 3RAQA 2NZ6A 4NWFA 5BYSA 1QSSA 4WJBA 2ZOGA 3HX9A 3NCPA 3RUBL 5KFLA 4F0KA 4DR6J 3F9BA 1ZM2A 4DS4A 3C14B 5KOXA 3UNYA 1NMEB 3J7YI 3OUYB 3KK3B 2NREA 3ZM0A 3GIRA 1IBLF 1CULA 2HNDB 4C2MA 3RAXA 2R7XA 1JB0C 3QCKA 1WWHA 1LK5A 2W2NP 2E9TA 1PYSB 1QDUB 1YKWA 3OVAA 1TELA 2CZ4A 2G0CA 5H9EJ 1JLCB 3CEDA 2DR5A 1VRTB 1T3OA 4YR3A 2PSZA 3HVWA 3KDNA 3QMQA 2PT0A 3K2YA 2GFFA 2DH9A 4LRCA 3LA0A 3U7JA 3M8WA 1HR0F 3LH2S 5F8JA 3T1YF 2CPFA 1YGYA 2HC2A 1HR0J 3BRHA 1HW8A 1B0TA 3ZZOA 3U96A 2C2OB 2LEPA 4PWUA 1S0OA 1R89A 5L9XA 2NUHA 4WYLA 2V4JA 3EE3A 3IM8A 4IFYB 1JIHA 2IA0A 5KT5A 1U2RA 3R1LA 4LIWA 5I3UA 1VBKA 3LPYA 2OUGA 2DNKA 3D1QA 5D4PA 3TQEA 4LF5J 3W2WB 4QAHA 4C48A 2EK1A 2EC0A 3QYYA 2ZZMA 4DQPA 3MM6B 3AA9A 1OIAA 3GMGA 3U1LA 2HRTA 1NJIT 2NTAA 4HRFA 1KC8T 2QO3A 2ZM6F 1TP7A 4DFKA 1UVMA 3I5CA 2KFYA 1DTQB 2RNEA 4JI8F 3CJKB 3EXCX 3HHLA 2HB1A 2BJDA 2OFGX 3IMQJ 2MSTA 2NPFA 2VL1A 5F0UA 4MJKA 1WELA 2VPWB 2R2TA 2KFNA 1HQEB 1C1BB 3JS9A 2A2DA 3BN4A 1G1XA 4Y2KA 1HL6A 2VQFJ 1HBMB 4I2PA 3L7PA 2ZKTA 3QIDA 3A13A 4K8RA 1FJCA 2VG7B 2R7OA 2X7IA 3OSNA 2YNGB 3I56S 1KD1T 2CJZA 5A5EA 1S9GB 3MHYA 2IMOA 5L46A 2GC5A 3H90A 5DM6Q 4FYWB 3CJQA 2FHKA 4H4KC 1XTZA 2CM3A 1J27A 4ZN5A 3RBDA 2OFHX 2A1BA 4MT1A 2N3LA 3I80A 3KK2A 3DHXA 2MDAA 4TU9A 4B3TJ 4LR8A 4LREA 5IT9Y 3KJQB 4LUBA 3RRGA 2XZWA 1E8CA 1PAEX 3ZL8A 1DBDA 1E6VA 5H1SV 3TAQA 4DUZF 1HWIA 3S3HA 2W1BA 1T48A 3UN3A 4HT5A 1ZA1B 3ONQA 3IA0A 2MTLA 4JI6J 2PA3A 3I9ZA 4A47A 5F9LA 1IXKA 4Q5VA 1A9NB 4IYQA 3TJ9A 4LF8J 3LP0A 4I64A 5A8RB 5J1PA 3M9NB 2AEJA 1SV5A 3D6MB 3VGSA 3CDAA 3OT9A 4OZ0A 2W24A 4G65A 2DVIA 4K0KJ 2MQPA 4L72B 3QSYB 3TJAA 1XNRJ 4FXVA 4EZ6A 2I3UA 1RI7A 2MLZA 1H2UX 2K06A 4M5IA 4C11A 3KLEB 3ITHA 4DEZA 3N9UC 2C2EA 2VBXA 2CQDA 3W62A 1HHSA 2KXNB 1ELOA 2BKOA 2XWXA 2JEFA 1XMQJ 2ERRA 2C3OA 3EPGA 4R25A 2YNFA 5JXSA 3IM9A 5A2QU 1G1FA 4Y00A 4HT7A 4DR1J 2AT1B 4LF9J 3OHBA 2DH7A 2LFVA 4QAPA 5KABA 4OHLA 4M5NA 2CFXA 2RH3A 4K4VA 4YAAA 5J2PB 1AAXA 3UD3P 4DPWA 4XTTA 2ZH7A 3W60A 3QCJA 1WRMA 2H65B 4USIA 4B3RJ 2CJXB 3GYNA 3HN7A 1U1PA 4YY3J 3NKYA 3MFHA 2NLKA 2HHUA 1N5YB 2CNFA 5F3ZA 2XMWA 5KFRA 2DISA 3MI7X 4RU2A 4IO9Q 2HSEB 3DLGA 4OI6A 4AL7A 3A4TA 2E9ZA 1FF2A 2O67A 1H3DA 3CCES 5J1EB 1VGYA 3RAMA 2ASJA 2QDCA 3K5LA 2FVRA 3IWNC 1YJWS 3CJ3A 5F8IA 4J91A 2UP1A 1REVA 3M4XA 4D3HA 4RW8B 4FF1A 5B0FA 4WWSA 5KFDA 2D7SA 4KO0A 3KK1A 2LXFA 2QDPA 1RSCA 4U8YA 3MAQA 1FO1A 2CNOB 5A8WB 5D3GB 2ALZA 4DQIA 4F8RA 2PEHA 4UZCA 3A3PB 2OPPA 4B9NA 4Q7AA 2M5YA 1XNQJ 2PI7A 2GAGC 2VPYB 1FA0A 1Q1MA 4LF7J 2XJAA 3NS6A 3RW7A 2CG8A 1RTHA 1FTCA 1RXOB 1XR5A 2OP5A 3P5BP 1N5VA 1U09A 5FIIA 4WFNQ 1APSA 2EXUA 3J81U 2WVEA 5A5FA 4Y2MA 2V94A 1SVDA 1V3ZA 2G2YA 4NZ0A 2RILA 1RTIB 1PYTA 4M5DB 4NZ6A 3Q8PB 3G4SS 2CQ3A 3MTKA 4O3NA 3Q22A 3JSMA 2FC8A 4PUOA 2YPZA 1HQUA 4P2MA 1B4SA 4F25A 2HNZA 3DDKA 2I6MA 3CD6S 1RT6B 1HHTP 2Q47A 4J51A 3W66A 2KVQE 4V1Ak 3EICA 3PYZA 2MKIA 3PHEA 3GWCA 4KHPJ 1KOHA 4X4VA 2W9BA 4D3GA 3X1LB 5K20B 1PA9A 2DTJA 2LMIA 2CNEA 4DR7J 2E1MC 5T7LA 2JNJA 5LSOA 2DJWA 2VDIA 2C22A 1VBXA 4JI1J 2DNLA 1G2EA 1KDNA 3CJ2A 4A8QA 4PG7A 4ZVTB 2GCAA 2VQEJ 1GMWD 1FD8A 4Z37A 3N0AA 2DIVA 4BUBA 5LSLA 4HACB 1AUDA 1HNZJ 1XEZA 3DLKB 3NOCA 5B0AA 2QZ8A 4AE5A 4DMZA 3PO4A 5F8NA 3D9CA 3CCLS 3UNGC 4RNHA 4K4SA 2ABYA 3M9OB 1IKWA 3UPFA 1TV6A 2KT3A 2ZC4A 2D3ZA 4O3OA 2CPYA 4Q0BA 2DHAA 1TMJA 1PC4A 2CQHA 2ZZTA 5A8RA 3VCDA 2H3EB 3ILJA 1GQQA 3QCLA 3A3OB 3HI9A 2NQPA 4WXWA 1FRJA 2WHOA 3C46A 2W2QP 3KUGA 4KRWA 3C6TB 3PJWA 3BGRB 4ID5A 3GQCA 1SL2A 1JBWA 3CWEA 3GR1A 1L3VA 5U47A 2JRSA 2JDJA 1KWMA 1UZDA 2RQKA 2X1BA 3LOUA 4RPFA 1YJTA 4LFAJ 3MD3A 3WDOA 2VTEA 5MMZB 1S1WB 2J76E 4KE5A 1Q0NA 3HP6A 3D2WA 1AFIA 2VKZG 3D66A 3TA0A 3BLTA 3O4TA 3O4SA 3MFIA 2RKIA 2VBYA 1T9WA 3F73A 3C15B 2C3UA 3ZTRA 1RQ0A 2UUTA 4ZVSB 4X4OA 2HC1A 1S49A 2BE2B 4EZ9A 4CLTA 1S1UA 3MM9B 2YWEA 3AHPA 3ZTSA 3HK2A 4DU7A 2R8JA 1YN9A 4PVGA 1YIJS 2CZ9A 1PO6A 4FNIA 3R27A 2OMOA 1IR1A 2AV5A 4NCBA 5B0CA 3WZ0A 1KNZA 4NX9A 3V6JA 1SKWA 2DGWA 1CJKA 3W2VB 2R2SA 2FVPA 4D3RA 3N4WA 3TEHB 4QIGA 1KQGB 3SMZA 5KFKA 1OEMX 4HR2A 2ZH2A 1WSRA 4ETXA 3HM9A 5A8KB 3TA2A 4OYOA 4A8YA 4WIIA 3D42A 2WK4A 3PEHA 1RA7A 2YX1A 4OYXA 1N36J 1YTYA 3PRDA 2H54B 3PW5A 3O1LA 1WAXA 3UVJB 1UJ6A 3M6VA 2YWHA 4ZVHA 5CD4H 2ZDOA 9ATCB 1EETA 3LP1A 2VF3A 4OV1A 3KG4A 2VUGA 2JVRA 3V81A 3V6KA 5FD1A 4OHEA 2NLWA 2ASDA 2PQ5A 1M3GA 4ZVPB 3T6BA 4MBBA 2J0XA 4DPUA 4UQGA 3PR5B 4TVVA 4DI6A 3VAIA 4RW4A 3H4BA 3HHLD 4ZITA 4OHXA 2GWOA 2XMJA 2HVHA 2AU0A 2FJNA 2HIQA 2E29A 3HSDA 2X1GA 1XWLA 4EYIB 2I6PA 2OMLA 4K59A 2XYGB 1RT5A 2CPHA 2KL8A 2Y1JA 1J4XA 2WAQD 2VASA 5A76A 3OL9A 4HVZA 3RW6A 2R7SA 2HNQA 3QCGA 5A8KA 3GR0A 4QR0A 2FZKB 1Y00A 3FCHA 3KJFB 3JSRA 2H03A 3MR2A 4DSFA 4A4JA 1JLEB 4ZS6A 3RGOA 4OL8A 4QUNA 5I42A 1VI7A 4Q45A 5DLFA 4F7VA 3MM5B 2GQQA 4G1IA 4RJVA 3D44A 5KA3A 3UD5A 5ADZA 3CDEA 1Q6TA 1TL4A 1N52B 1KN6A 4H54A 5HP1A 3SFUA 1Q4RA 2HHQA 1BWVA 1U6ZA 1WF2A 2PDAA 2YQ0A 3KTQA 2OPSA 4ZIYA 1TZ0A 3PYEA 3V4MA 4EBEA 3QGGA 1TFYA 5GADI 2WTZA 3PACA 4J9PA 1TL5A 4NXMF 1NWLA 1KRPA 4RW9B 1REGX 2YPYA 2ZZNA 1U48A 1YPTA 3MR6A 2LQ8A 4DR4J 4J7CA 3O3LA 5EN1A 4ID5B 2DNZA 3IS9B 4U8VA 2ZH1A 1MU2B 2MQNA 3CB4A 4J5OA 4RUCA 1VQ7S 5CABA 2YXLA 5IFMA 2PI4A 4M5LA 1I57A 3PW4A 2XY6A 3AJDA 4CZCA 4O23A 1X4DA 1YJRA 4YB7A 1SJFA 2J16B 3W5XA 3MUMP 4I68A 4J90A 2P9GA 1CQNA 3TEGA 3BQ1A 2R7UA 1SPBP 4N77A 3GZ7A 3N6MA 1VOMA 4NRTA 1Q86T 1R8HA 3IR5B 3PCOB 2VICA 3ZZPA 2YKNA 2DNHA 2Y1OA 4RHGA 5CYJA 1VQPS 1QZ0A 2E7XA 2F00A 2UZAA 4H1OA 3KUEA 4MKAA 3S3KA 3TYTA 2MKYA 1HBNA 3A1YG 5KFWA 1H0HB 1T94A 1CBKA 2DGSA 2I0XA 2P5VA 3AXMA 3IWXA 3MPUB 3VZIA 1UAGA 4CO2A 1LV5A 3OLRA 2W7OA 3NNAA 1AYEA 2A6OA 5FJ4A 2V2VA 4I8NA 5LSRA 5GAHI 2OSRA 3D0HE 1S9EB 2CPXA 3DCAA 4ZPVR 2ATLA 3U27A 2ASLA 5HANA 3MM7B 3PJ9A 3LTOA 1SB6A 4RX6A 1RTDB 4MIBA 3RBXA 4K5RA 3C14A 3KK3A 4DF4A 3TOQA 4OX6A 3OLBA 3QPIA 5ETMA 3D1HA 1FQ1A 4QCLA 2XMTA 2Q79A 3HHLC 3I87A 1UETA 3EZOA 2O3DA 1DQ8A 2PC6A 4OX8A 4OYIA 4ZPDA 2WVCA 3TR5A 1YJVA 8ATCB 1VQMS 2N4CA 3UCZP 1TK8A 1P3DA 1Y4ZB 3RGIA 2AJ0A 3FSXA 1UFWA 3LALA 4LQ9A 1XK8A 3O6QA 3IC1A 3P8BB 4LSNB 4A8FA 1FJGJ 1RWVB 2GHVC 3PG9A 4FVCA 4R8UB 2E1AA 3CO9A 2GP0A 1KBRA 2GC8A 2OEMA 4NRUA 4UOFA 3UE2A 5KFBA 1XIQA 3TUPA 4NXNF 2RRAA 3HDSA 4PABA 2XY5A 2F65A 2ZDPA 2UVWA 2RRNA 2BBEA 5CQGA 3G9CA 3QCZA 2L08A 1CC7A 2Y0SD 3LUYA 4EO8A 3GSDA 1TVRA 1X31C 2W2OP 2CJYB 4PXCA 2AP6A 2RRBA 5CZVA 2ZNZA 2YVSA 3JTPA 3ITHB 1R6YA 2IM0A 4USJC 2DPJA 1ULRA 3QSIA 4FF2A 3AWGA 4RWXA 1RCXB 2ZFHA 3LGHA 4AFFA 3WHIA 3AJ1A 1C0UB 4J9LA 1XMOF 4Y14A 1KEKA 5I4MA 1Q7LB 3ZNUA 3MECB 5HBMB 4UAGA 2ZBPA 2QLWA 2ZHOA 3B6BA 4OZNA 2W2PP 1SIWB 3HFKA 3TUIC 4RZRA 4DQSA 2HQIA 4CO1A 1FHTA 3RRKA 1V3SA 4QWBA 5H9EK 4QYZK 3OL8A 3OFHA 4DU8A 3DMJB 1VIOA 1JJ2R 1MMNA 3QKQA 1DFDA 3EGWB 1IKXA 2PA8D 3IP0A 1Q8LA 3WBZA 2LQ9A 4IFYA 5HVFA 3T5LA 1BWEA 5DGBA 2J9DA 1ZETA 2Q3PA 3NNHA 4N56A 2RAQA 1GTEA 1CJUB 2ZE2A 2V9KA 1GNKA 2B4PA 3ETMA 4DCOB 2DBBA 2YKAA 1RWWB 4ZVOB 4OHZA 5E5NA 1X4AA 4URGA 3KG1A 4R0JA 2IVFB 1IBMF 1B0PA 2E7VA 2HMIA 3W5ZA 3D0GE 2HIYA 4DV7F 1K0VA 2V8DA 4CH0S 5CHCB 4UY8T 2XLKA 1NCLA 3GXHA 4KO0B 2BRKA 4P72A 4NLGA 4LF1A 4WPAA 4PQUB 2HPUA 1S72S 5HBMA 4ZI4A 4KGVB 4WBFA 3UDEA 4YDDB 5EHPA 3TZYA 1SUQB 1FFWB 1G4CA 2UUAJ 1PKUA 2I75A 5KTQA 1HIYA 1X4FA 2R8IA 1JJ4A 1NPPA 2XLJA 2VKRA 1H6KX 3THVA 4OYPA 2EFOA 5A6WA 1LQFA 2BJ7A 2WRMA 4GKJF 4FYDA 5AT1B 3MEGA 1RPMA 3IBWA 4R0EA 2CDRB 5C25B 1N33F 1SH0A 1HHQA 2R8HA 1UW4A 1UFLA 4F3QA 5B0BA 1HFEL 4CCHA 1KVIA 1PTVA 2D3O1 1RT6A 2VFVA 2PD1A 2ZOFA 4RUAA 4U9RA 5LMUF 1HMVB 1VCTA 4EO6A 3J7YU 3VAMA 5K24A 1WC5A 1RKIA 1UVIA 2IVYA 1N5QA 4W98A 3QJJA 5F8LA 5KA7A 3LP2B 2KM8C 1FRHA 2FC9A 2JOQA 2B5JA 1RAGB 3BYRA 1BC6A 3S4OA 2VIHA 2UUAF 1N5SA 4OYWA 4XPEA 2WOMB 1Y3KA 3ZZ0A 3J7ZT 2MY8A 1VQKS 2COLA 4NZ7A 3KUHA 4M63A 1F3FA 1S6QA 2R7RA 2QN6B 3DXBA 5GAGI 3CJKA 4JI1F 4QPXA 4ECSA 4DFPA 1FXLA 3G2XA 2W4DA 4NXNJ 4DQRA 2C7SA 4C13A 4R30A 1TUWA 2AJ4A 4I0WA 2K2PA 3ZM5A 4KKOA 5H9FJ 4WP3A 2IM2A 2XHWA 2QGFB 3W2VA 3ZM1A 4NPOA 1IWGA 1ZPVA 4UOCA 4A8SA 3G8TA 3E51A 5KACA 3HPOA 2J0QD 1BQMB 2D3UA 5M43A 4ECYA 3M2RB 1XJWB 4IFVB 3DLGB 2BUNA 2WW4A 2HLUA 2OAUA 4I69A 1KAVA 2F6TA 1WC4A 2DR8A 4F3MA 3DLBA 3BGRA 4ANDA 3RR8A 1UVJA 4CRJA 5DZ7A 2OPQA 1L3KA 2G0IA 3ZM6A 3CMQA 1IM4A 4K50A 3E01B 1JKHA 3CCZA 2KJVA 2N7CA 2IA6A 3HZGA 1CVJA 3SCLE 1LFPA 3BGOP 1BUXA 2VG6A 3OFEA 1RWNB 2PN6A 4I6WA 3S01A 1BD6A 4DV7J 2HY3A 1X4CA 2CNLB 2HK3A 3EGVA 3NS5A 2CNHA 2F70A 3M32A 1DJ0A 4NA3A 1D9FA 5EWFA 2BW2A 3FJ2A 4EGLA 3W9IA 4NOHA 4FS1A 4RKKA 4ZP6A 1J2VA 1LWEB 1ZAVA 2V4QA 3IFEA 1M5VC 3S6EA 4PPDA 3ZNJ1 2HGNA 4B3MJ 2B7CB 4X4UA 3KLFA 1IKXB 2QV6A 3O2IA 2XMVA 4BC9A 3TQ1A 3IRXB 1JLFB 2I1YA 5M2RA 5FDLB 2I5JA 3SDEA 4MKVA 3CD0A 1HWKA 4TXSA 3DGPB 3NGDA 5E2QA 2NXEA 3J80Y 1VC6A 1RUSA 1JXLA 2HW3A 2B4SA 4RH9A 1KKHA 2GVDA 3UO0A 4MK7A 3GILA 2FVSA 2B8PA 4IDKB 2VFTA 2UUWA 4QU6A 1UCNA 2HAIA 2E0TA 1T9XA 1U8SA 4ED0A 2AX1A 3HCXA 2F4FA 3HVTB 3D3BJ 3IBCB 4UTGA 3TA1A 3PIPQ 4GVBA 2BQUA 1CULB 1SQGA 4G3IA 2KI2A 2DGUA 2XG8A 2W4PA 3MOZA 4ZPBA 1U25A 4USMA 1YBTA 5HO4A 1GFWB 4HI1A 4TYBA 1SL1A 3QKPA 4A8OA 1BY9A 2HNYB 1U47A 3POTB 1V6HA 4NLVA 4ES2A 1J5OA 4ECTA 3BBFA 2C3PA 4GKKJ 1F5AA 1CJTA 1U6BA 2M8HA 3FQKA 4ER8A 2LU1A 3FEYB 2CPDA 1W7KA 4DR7F 2IC3B 4WE1A 1T02A 1Q16B 4DXLA 3C16B 2G2ZA 2HQFA 3Q89A 1UJ5A 1NXIA 1CG2A 5RUBA 1FJ7A 1WG5A 5KT7A 2CYYA 3EVWA 1T11A 3A5JA 3CUNA 1JWWA 2QLXA 3GPAA 4OZLA 4QOTA 4TQRA 1MG7A 2B43A 2BE9B 3DRRA 4CO4A 5I3QA 2HG4A 3SYZA 1M1GA 1NH8A 3Q0AA 3PV8A 1Y5LB 1N5TA 1JLBB 2RF2A 1Z2LA 1BZJA 1U1OA 2B4OA 4WTYA 3LPEA 2HHPA 5CCLA 4DUZJ 4JI4J 3GFXA 3G6VA 1ZZNA 5E3QA 1J5EJ 4RO0A 4C9DA 3F56A 2QA2A 1L5UA 1EP4A 1RTHB 3CXCR 1HNXJ 3M2UA 2YWGA 3OW2R 1HNVB 5DS7A 2M88A 2CNKB 2LXUA 2E44A 5BYRA 1N8RT 1N32F 1KLMB 1YSJA 2MLXA 5KFXA 2IC3A 4WE1B 3OJUA 4DQQA 4IRDA 3H2VE 2B3OA 4DSLA 1OQ3A 1HBMA 1AXQA 1RJJA 1RTZA 3DOKB 2WONB 3A3NB 3G82B 3NS7B 4I2PB 4OLPA 2GJTA 2QBSA 3BYPA 4P2SA 2B0GA 1S7IA 3GIMA 3MCNA 2RUSA 4TQSA 4JYAF 2W9BB 3JAMY 3NCQA 1KFSA 2GMJA 3C66A 3DC2A 3FFIB 3JYTA 3VVTA 1NRKA 1FFGB 1NDLA 3WX4A 3MPWA 1HBUA 1NUEA 2VG6B 3SSQA 4ZN3A 5HJYA 5E7OB 2DNYA 3GCWP 4WFAQ 3R7NB 5C5JA 3N01A 1RHJB 3IBFB 2JX2A 3NOGA 3TZXA 3BGFA 4OZ1A 2XZDB 4B04A 2V4RA 2VD3A 4LRDA 2CWXA 3DLJA 3NAHA 4UUXA 1WF1A 1HNVA 2Q6CA 3W3SA 3MCOA 1TTHB 2MZJA 2J8SA 2FVCA 1M5OC 1HA1A 1HI1A 1UMJA 2DXFA 2AEFA 3O5XA 4WFXA 1S4EA 2OEJA 1TUGB 2WBRA 2N4DA 3G82A 4CLPA 4WU3A 2MZQA 2QIFA 2CPZA 1TKXB 4KFBA 4ID8A 5D0GA 5K9FA 4IG0B 1M5SA 2VZ9A 5DDPC 1U0HA 5BYQA 1RT1B 2AHOB 2OH2A 1NU4A 3JSBA 4R5PB 4QWCA 1NDPA 1DLOA 3SV4A 1HYSA 1IQTA 1JMTA 1XN9A 4NLDA 1RHQB 4C7QA 4I67A 4WYWA 1NK6A 4USVA 3S1TA 4CLZA 2Y1LB 3R9LA 2KXHA 3M1VA 1HNWJ 2BJ8A 2LKZA 3MM8A 4FKYA 3EDQB 1HBUB 2JLGA 4DV6J 1D8YA 1TL7A 3UR3C 2IMGA 3HJFA 1NDKA 2M8DB 2RD5C 2QL5B 2PMHA 2HQDA 2B8QA 2DRDA 1PG5B 2DR6A 3BPDA 4M8LA 3WIVA 4DFMA 3NGUA 1WSVA 1NL9A 2V68A 1JLGB 1H72C 4ZVGA 2DT9A 3TJ8A 3CJ8A 4ED7A 1N54B 4GKJJ 2DXDA 1P31A 3OTEA 5C42A 3QAUA 2C3YA 8AT1B 1R27B 2ZWOA 3KLIA 2CQGA 1M5KC 2P6XA 5JUMA 4KB7A 2YY3A 4YB1P 2A10A 1P8GA 4P9SA 5BXIA 3G96A 2EKNA 1MW7A 2QMXA 2ZH3A 4EU0A 4JV5J 4GE6A 4RW9A 1OWXA 5C24A 3HXMA 1QVGR 2MPUA 4CLUA 4G6VB 4QIFA 3R5BA 1OPZA 2Q43A 4FYVB 4NLUA 2FHJA 4BCAA 4DG1B 2JVOA 2GVZA 3ILIA 3CCRS 4FKXA 1YWFA 3OXGA 3D67A 5KFGA 3MGJA 2I42A 2F1FA 5B0GA 3MURP 5FLXY 3KK2B 4XDCA 4WFBQ 4M5HA 4KHPF 1VS3A 3D1OA 3M6XA 4JP8A 3UR0A 5IM0A 3GV5B 3OVSA 4DV0J 2C46A 4Z2XA 4DL5A 1ZS6A 1PBAA 3T1AA 4JI5J 3BR9A 3PS5A 1LW0A 1UKUA 2Z30B 1U6FA 4OHVA 2QEPA 1E6VB 3EXYA 3ADAC 1NZAA 3M6UA 1LKZA 5GMDA 1L3UA 1UEVA 3SQGA 2G59A 1UAWA 2DNGA 2EVZA 4KKOB 1N56A 1HD1A 4C97A 2C1EB 3KNGA 6AT1B 2RS8A 1OJ4A 2DNQA 2XBPA 2DK2A 5KT3A 1ZTWA 1T9VA 1N6QA 3BO3A 4DSIA 1RWPB 3BBCA 4PXDA 3FZ2A 2VJUA 1Q7YT 4KJIA 3OLAA 1ZZWA 2WSCC 2C2MB 1FKOB 1RT5B 2ADCA 2RVJA 3RBZA 3B7OA 1Q1KA 1R6VA 4ZCKA 3DNCA 2DGXA 1CJVA 1RU2A 1YZ6A 2PIIA 3PW2A 2KHDA 3BB5A 4F02A 1A5YA 2PBNA 4N47A 1XERA 4CH7A 2VHGA 3EB1A 3J7Z5 2Y9HA 2JC1A 3R3TA 5CYMB 4KIAA 3E01A 1HNZF 5CD4A 5BUGA 2YKNB 4I2QA 1X4HA 3UDVA 4I7FB 2YKOA 3HD1A 5T7LB 4LFAF 5KADA 1U8WA 4FVMA 1X4EA 4LFCJ 2LEBA 2MY7A 3CCUS 1NK4A 1UEUA 3MXHP 1PH0A 3TVKA 4DL3A 1YJ9S 3BH6B 1J6UA 5HP1B 2HZVA 5F8MA 3SQGB 4YY3F 4J9NA 3UN5A 3GJQB 4P7VA 2A3KA 2XYHB 1IKWB 3IGNA 2KDOA 4LIRA 4WCEQ 3KYLA 4IRCA 1EEOA 5K22A 3TAPA 4OYMA 3H59A 2I5JB 2J9DE 3CSKA 3SDEB 4PG6A 1RTJA 3H0PA 1TL1A 5HN0A 3HMJG 4YQWA 3DRSA 3TNVA 2PFFB 1ACMB 3EZ5A 2BMBA 5K14A 5HK4A 3IAS9 4NYOA 1FTRA 1VYAA 4FN5A 4BHQA 4EK2A 3M8SA 2EFNA 3M8PA 3CPWR 1LWXA 2BGDA 3S3FA 1TUVA 1FNOA 2ZITA 3QZ7A 5HVGA 1I94F 2EBEA 2MLYA 4OZ5A 1M1HA 2KZZA 1Z4UA 2H5EA 3CTRA 2JLEA 2AZ3A 3OUYA 4OZJA 2PEBA 3HHLB 4NYZA 1SKRA 1XNQF 5A8WA 2IAJA 5IT0A 4ELUA 3AWFA 2FIUA 2RDIA 1VR6A 4CO3A 3KJNB 2XNQA 5GAEU 2EKYA 1CLFA 3NEKA 3MPDA 3HHEA 2PFDA 4DLEA 2B56A 4OZ3A 3NGTA 2CPEA 5AXMA 4K4ZA 2W9CB 2Z56B 1PCAA 1H2TZ 3LANA 4FPIA 2QCJA 2ATCB 1F0XA 3QBCA 4ZOSA 4CQ1A 4CM2A 4ZHRB 4DFJA 2YNHB 1R6HA 4DR5J 2ZWPA 1HARA 3PYFA 3UDCA 3EPIA 5HLFA 1W2BR 4DLGA 4QR2A 1MROA 1SV5B 4F4ZA 2CDQA 2AJ1A 1IN0A 4Y2IA 4B02A 1KVJA 3G71S 4PXEA 3DYAA 2QFIA 3R5AA 1S9EA 1EZZB 1TL3B 1VBYA 5ETPA 4KGZB 2DCUB 3K17A 2XZTB 2QBPA 1YTSA 5KOWA 1GMVA 1GG4A 1T0TV 3MR3A 2GQ2A 4OI1A 4NWGA 2BANB 2YH1A 2BR0A 5D0RA 3CC7S 1K0TA 2DCLA 4DX8H 4B9VA 4W92B 1WC3A 1QY7A 1SC1B 5HQ8A 4ZK7M 3NMRA 2MQ8A 3AJ2A 5HMXA 1U45A 2VA2A 2Y8WA 3CJRA 3N6NA 2DD8S 2YQ3A 3KHRA 4LF6F 2BGEA 4PYDA 3ICLA 3H7HB 3J81j 2P9EA 3KHHA 1S10A 1IBKJ 3BZQA 4TLRA 5HL7Q 5LMNJ 1ZH5A 1S4FA 1UL3A 2JEGA 2M3DA 2JEJA 3V0IA 1B70B 2GGPB 4I6YA 4P6QA 1N6QB 1RAJA 1S0MA 1RHKB 3QCHA 4TVAB 5IBMA 3HVRA 2VA3A 2WONA 3D6HB 2GAHC 2GHWA 2UV8G 4LBPA 2CRLA 2I8EA 2JL9A 1WG4A 3QFWA 2DO0A 3EMTA 4CO5A 4F4AA 2IHR1 1HWLA 5J1EA 2CA9A 4H4KA 5KFJA 4DV0F 3GG1A 4ZLLA 1FRXA 1D3WA 4JI6F 1NK0A 5DZ6A 3GV8B 5J2PA 4P2XA 4LF9F 1KAKA 3QCNA 2KTQA 3CMES 2MQLA 2RS2A 2B49A 2R7QA 3R5DA 1N48A 4I7FA 4LFCF 2VOSA 2W8KA 2WOMA 3H2LA 5G0RB 3RTVA 3FVYA 2CJKA 1BE4A 1X5TA 2YQ1A 3TX8A 2N82B 1CS4A 4B3TF 3K5MA 3GP9A 3OTBA 4GC7A 3KLGB 1N34F 3EGZA 1WHVA 4DDFA 4RNNA 2HFVA 2IJRA 2XTJP 4ECZA 1SQEA 1BZCA 1T49A 4O3QA 1ECVA 5CCMA 2HHXA 3QLHA 3D7SB 3CNQP 2W7AA 1I1GA 1S6PA 3I4HX 3K8WA 2X1AA 2UU9F 4LBIA 2UVUA 1S0VA 3GCXP 4FPRA 5K14B 1VHIA 4WXOA 4O4GA 2HFUA 3DI6A 2FGOA 4GVLA 3TI0A 2BVZA 3V0GA 3CM3A 4MIWA 4DCPB 3V6HA 2BE7D 4G1QB 1QTMA 3MEEB 3R1HA 1PJ6A 2DGVA 3TW0A 5A6PA 2F71A 3M2VB 3THTA 4UQTA 2DRBA 4DR3J 2FJVA 5AXLA 3BDPA 3V6DB 4DUTA 3OBIA 5DQGA 1FK9B 2JSXA 3VZHA 3OR2A 1S1VB 3QNWB 1DURA 4K2JA 4ED3A 4AQYF 4KTQA 1NM2A 3EU0A 4ZPTR 3SEOA 1RDRA 4ECRA 2MQQA 4NYHA 1YX2A 4TY8B 2R8KA 1U1NA 5KA4A 1AB8A 2BRLA 4FXWA 3W9HA 2V9WA 1YBUA 3V4IB 5K25A 1EQ0A 4JOUA 4DSKA 5C25A 1ZM9A 5LJ5Y 2JHEA 1M5HA 2B4VA 4HYKA 1CSJA 3DGPA 4DR3F 3ZC4A 4FXDA 4YR0A 3OFFA 1PTUA 2JJDA 4HL9A 3BH7B 4JI8J 1QE1A 4PXBA 4O4GB 4ZLNA 3CGIA 1LWCB 3IG1A 1R8AA 4MYTA 1OS5A 1UA1A 4B9TA 1OESA 3S4EA 1FT8A 1KP6A 1DAXA 1RT7A 1Q95G 1UTAA 3A8EA 4WK1A 3QJLA 1VRUA 3MAHA 1D9DA 2UU9J 2A2CA 2CKWA 2OPPB 1D8ZA 2KN4A 5KFFA 1IBLJ 4HH0A 1IWAA 1S1VA 1JLFA 1IKYB 2BV3A 3SFGA 1KR4A 3W8GA 2L41A 1SKSA 2QSFA 1HNWF 1HQ2A 3DOMA 3QGIA 2FLNA 2XGPA 3WX8A 2OPRA 4LSLB 2MGZA 1MN9A 1IVZA 4CVKA 2BZ2A 4QU7A 4K4YA 1JX4A 1GK8A 1X0FA 1O6XA 2HCMA 2BM1A 4DL0C 1GX6A 3V4IA 4CM0A 5L38A 3QIPB 4LMZA 3PY8A 1P6TA 4ANEA 7AT1B 2ZJPQ 3DGVA 1NB7A 2L9DA 1ONZA 1YWXA 3M2RA 1FKOA 1RAAB 2IIHA 2L48A 4IG3B 4F67A 5KFHA 4RNOA 1PGZA 5D3GA 4QWAA 3NLCA 2OOQA 4X64J 1G7GA 2X3DA 2FHJD 1S5ZA 3K5PA 1IR2A 5KFIA 4DHVA 2RKIB 3FNNA 2DGTA 4MK9A 3RB0A 1IR0A 1MSWD 1WEZA 5CYMA 4C12A 3UQSA 3TZZA 2J6SA 2QYCA 5KA0A 1T03A 3I5AA 1C0UA 1JLBA 4L6V3 3BKFA 3DU5A 4ZVEA 5LXYA 4C8OA 5DRKA 1BLUA 5CH7B 1H7XA 2YWWA 2V8HA 3ZTQA 5B08A 2XO6A 3Q2TC 1BQNA 1RTIA 3BF4A 1XC9A 4F3OA 1EETB 3LP1B 1WHXA 4XDDA 4NMXA 1C0TA 1ZM3A 2EEYA 3QT5A 3C6UA 4X66F 2F4VJ 1LWEA 2ZD1B 2OPRB 2DXEA 5HDEA 2LU2A 3EUNA 2ZBCA 1AZSA 2WSEC 1OMSA 3KWMA 1JLNA 4P7TA 2APOA 1FRIA 2OGUA 1TV6B 3BGUA 3TVYA 3MPYA 1Q78A 2OI2A 3L7UA 4MMOA 2IBKA 2L9NA 5FDLA 1RTJB 2QLJB 4IO1A 1IKVB 2OD4A 4NI2B 5EX3A 4HTJA 5JVGQ 2HZCA 3HVAA 2FZCB 1X5PA 1RACB 1KQSR 4CDIA 2GMLA 4ZP8A 5KFZA 1V9OA 3G6YA 3Q8UA 2XSJB 3EM1A 4M1KA 2MHEA 1EARA 3RB3A 3H5XA 1B7FA 3LO3A 2YH0A 1U7LA 3QAEA 3QGPA 3D9BA 4DV4F 3I6PA 3MR7A 1NKEA 3JYTB 1O8BA 3P5TL 2FB0A 2NSBA 4DPTA 5L9NA 2ALYB 3MEDA 3MMAB 2B7BB 1VHRA 3S8SA 4IH6A 4RW7A 3JQJA 1OEVA 1RLDA 1RXDA 3KJVA 2NV5A 2HHHJ 2K3IA 3UW1A 5HMZA 2HGLA 1WI8A 3C6UB 1KHWA 3DOKA 3I5BA 4MK8A 4RR5A 2QA4S 1MWYA 3F9AA 2DHHA 2WVBA 4C3KA 2GX8A 3LGNA 1S79A 2Y3YA 1R3NA 2EW9A 2LYVA 2R3VA 3AQPA 2BABA 2YNHA 4KR0B 4MKBA 4KGXB 1B64A 3I0SA 2N7YA 2QX0A 3K89A 3N0VA 2VEYA 2A0FB 4DR4F 1NO6A 2AQ4A 1RADB 4MFBA 4ERCA 4CTAA 5L1IA 2J9CA 2XWYA 2OHDA 2DEIA 1S1WA 2C3MA 3D4JA 1ZBTA 3N6LA 4CI0B 2R2RA 3C2PA 2KVIA 3QJPA 4JBCA 3SXLA 4CLFA 2HNPA 3ET6B 1ZAWA 4BWJA 2J0SD 3PYGA 3BSOA 3BJYA 2ZHAA 4EYHB 4KYQA 4CVLA 1WKJA 3US5A 2BE2A 4PEOA 4OI2A 2OO4A 5BZZA 2F4VF 3EVOA 3Q24A 4YMEA 2ZN7A 1H73A 1K1QA 4JB8B 4U7UK 4QW9A 2B9XA 1R0AB 1ZC0A 4LF8F 1E6YA 4B3SJ 3NMEA 2BJ9A 3H40A 4UOGA 4IOAQ 4FYYB 3OR1A 3I9V9 4CLYA 4WFYA 2IVMA 2KYZA 4DPYA 2KZMA 1I9SA 3QCIA 1K73T 2NCKL 4F04B 1VRTA 3I36A 3DMJA 1WOSA 1DARA 2DGQA 3EJMA 4B17A 1PIEA 1U0HB 3F0NA 4NA2A 2AGQA 2IMWP 4B9UA 1QXKA 4JMJA 3BPSP 2H4GA 2V2ZA 5DDRC 4RLEA 2MZRA 4X64F 2F6WA 2HQCA 5KFSA 4DL2A 3HF5A 1QVFR 4JI2F 4WZMA 1P9QC 4CTAB 3Q8QB 4YOEA 1GQYA 2H1YA 4DPOA 3N2AA 2VORA 1VQYA 4ZP7A 2BDPA 2ZBQA 4O0IA 4ZVRB 2N3OA 3ET6A 3K58A 3RO1A 4HV4A 1SJ4P 4GO5X 1Q6NA 3LJ8A 3HSGA 3BM8A 3FRZA 5HQLA 1RP5A 3MAAA 2I6IA 4OYZA 4WP9A 5I6VA 2X3GA 1ZM4A 2VC1A 1UPPA 1BQNB 2CZVC 3CE8A 1LQ9A 1C1CB 2DNMA 1T9UA 4HEA9 3CC2S 1NAQA 5J2QA 3TAMA 4C3LA 3TWZA 1XBOA 1JJHA 3KLHA 1AZSB 4ECVA 1UW9A 2HVEA 3QCEA 5ETOA 4QIEA 3FZBA 1NSAA 2HS3A 1S6PB 4ZJQA 3BQ2A 2C2RA 2J8AA 1MROB 4JI5F 2EPIA 4PAAA 2O1PA 4U96A 4L75A 4M5KA 4YDXA 1K44A 3W2WA 2UXDJ 1X5SA 3F81A 2GVDB 3LK7A 2FLOA 3CDUA 4IH5A 1S9GA 5CAAA 4DN9A 1IBCB 1RT1A 2QSWA 3CDBA 3HSZA 1C84A 1C86A 2LQBA 2B6AA 3A5KA 2QL7B 3QCBA 2I6WA 1BQXA 2XGQA 2M2BA 4HKQA 1ZCLA 3PHTA 1SKUB 3IR7B 2MHNA 2DIUA 1OQ6A 2POKA 1Q5YA 4HHUA 1NBEB 4ZA1A 2DNOA 4V19J 2M70A 2HWTA 4NEZA 2MJNA 2HYIB 3MMBB 2XS2A 1U2CA 5IXUA 4HDHA 3SCJE 4ETZA 3DKDA 4NEYA 1FKAF 5KG3A 2UXDF 3WC2A 1RHMB 3ETOA 4ECXA 3J7A1 2XEXA 2X5OA 2F9JA 2ZBIA 4ZP9A 2HKEA 3W5YA 2ROPA 3UFCX 4LF4F 1N33J 1TVRB 1WUUA 3QRPA 2VH7A 4F0HA 4O44A 4K4UA 2AZRA 2Z58B 3H42A 4BUCA 2QBQA 2DY1A 1QD1A 3CCWA 3I0SB 2J5AA 3MPVA 5FLXU 1MKPA 1DHMA 1YG0A 2WBMA 1FRLA 5H9FK 4CVMA 3DRSB 4Q44A 2E5LJ 4JI7J 1TK0A 3HT3A 4M5JA 3SSRA 4Y3CA 4N8NA 3HHKA 5KFMA 4A8MP 2FVQA 4HI2A 3CC4S 5KFTA 4DSEA 2CXEA 2QE5A 3F44A 1XMOJ 2FY8A 3IO1A 4ED1A 1RT7B 3UCGA 1A0OB 2HFZA 4W90B 1F5CA 3T19A 5DDOC 1NEEA 1LK7A 1D9AA 3H20A
chains in the Genus database with same CATH topology
2KRRA 3DHWC 4TYAA 1TAUA 4IH7A 3DU6A 1RA6A 2B3TB 1T05B 2XNRA 3D54A 2HS0A 1SUQA 2QMWA 5AJ3F 3HO1A 1DTQA 2HFNA 5DG7A 3DLKA 2KM8B 2MMYA 1N0UA 1D0EA 1UWBA 4HHJA 5IQ6A 2KT5A 1T4JA 4QBUA 3NWGA 1L3TA 3DLLQ 1VHFA 5D4LA 2ZKUA 2LEAA 2RB7A 3CT9A 1W2IA 5AXNA 4X4PA 4HH1A 2B51A 4Y2CA 4DSJA 1HMVA 2YNFB 2RT3A 3FSYA 4GRYA 4RW6B 4DR2F 3ENVA 3NCRA 1X9SA 3ZMQA 4DBQA 1MNEA 4WK3A 5IWAF 4DV3F 4IQMA 1KTQA 1WHYA 1QAIA 1FDAA 2K1RA 3VQTA 4ZHRA 2DGOA 4JI0F 1VK3A 1FK9A 5SUHA 3W7BA 1SL0A 4RBUA 2Q6BA 5KG0A 1U1RA 5KA1A 4ALZA 2HRUA 2HNYA 4PQAA 3K57A 2AW0A 2DNPA 3OQ2A 1NZ7A 5KFVA 2VEXA 5BR8F 1S1XA 4TY9A 4ZDNA 1P1TA 3PM9A 2SXLA 1HNXF 3GE9A 4JUZA 1VQ9S 2M52A 3IGVA 4RH5A 1O5JA 5F8HA 4B3OA 1PTYA 2ZVSA 3LP0B 3PZPA 1BQMA 3ISNC 4RW8A 4ZLPA 4KFBB 2ZNYA 1NHUA 5THWA 2RU9A 2OTLS 1KOOA 2XI2A 3NG8A 1S76D 4F4YA 3U02A 3LAKA 2PGCA 1RWUA 3MCSA 5BJRA 2ZH8A 1S6QB 4EWTA 4E0DA 1Y7PA 2HWIA 2V0NA 4MTPA 5KG7A 2I4GA 4QPTA 2FTRA 3BO4A 4YHHF 1NJZA 4OI0A 3H2UB 4WKRA 1X0PA 4OJ3A 4C98A 4DR1F 3PKMA 5M2PA 3DM2A 5LXRA 5EWEA 1HBOA 2V8VA 3AB2B 5GVQA 5KA9A 3RRHA 2DO4A 2HMIB 3IRXA 4ED2A 4C8LA 5KFEA 2OD6A 2MKSA 3CDWA 4KC5A 1IQZA 2KG1A 2F8HA 5I3PA 1VQ8S 2VEUA 2GQCA 3KG0A 4H4OA 3OL7A 4PQUA 2MZ1A 1PA1A 4ELTA 1TAQA 1QUVA 3M32B 3H8YA 2VFRA 2P4DA 2IJFA 4J9SA 3HVTA 2JEIA 3QCCA 3UI3A 3E8OA 2R4FA 1VQ5S 1O0PA 4IKAA 1BZHA 2GCFA 3OHAA 2WSFC 2UVRA 4Y28C 1URRA 1RT3A 2RDJA 2JLFA 2IYIA 3CD5A 3L09A 2BYCA 3F41A 2XO7A 4OLOA 2HHSA 4OHDA 2AF6A 5K23A 2EFPA 1N5YA 1M5PC 1S1UB 3MM9A 2PI5A 2LXIA 2BACA 3LW5C 1FDDA 4ILRA 3PNIA 1SJ1A 2NR0A 2CPJA 1GWZA 2RUGA 1FEHA 3NRBA 4XO0A 3V0FA 2W25A 2YWFA 5KT4A 4IOCQ 4QIVA 1VK8A 2FY1A 4QR1A 4NX8A 1JLQB 3HKZD 4NLRA 1YITS 1WD6A 1XXPA 2HVLA 1FDBA 2NPIA 3OR2B 5DM7Q 1JKHB 2A18A 2IRUA 4NLXA 3DLEA 3BM7A 1U26A 3ISND 4RW7B 1U24A 1YRUA 1OHDA 4BPCA 4Q8FA 3MR5A 1SUGA 2AJQA 4AXIA 2DR9A 3TAMB 2XC9A 5E33A 4ZKAA 3LF0A 2YKMB 3BO2A 4LF5F 4NYPA 4FF3A 1T95A 3MOJB 3KLIB 5GAHU 1VLYA 1OEOX 2AYEA 4X4NA 2Z4PA 1N0VC 3MUTP 5D4OA 1NK8A 1LARA 3BSCA 4L3NA 3ZM2A 1Q82T 2I6OA 1VQOS 1BGXT 3FMBA 2QDMA 3NBPB 4IOBA 4TLQA 1TKDA 1S77D 2M3VA 4F2RA 1JLEA 5DQHA 5J2PA 2GO9A 1X4GA 3R1LA 3DLEB 4UUWA 5L8RC 2E5LF 4JI7F 2A3JA 4ZMMA 2OLWA 1Q53A 1YHQS 1S97A 4ERDA 1C2PA 3QO9A 1YTNA 1YZ4A 2VEVA 2IRYA 2O5DA 1FDNA 2G13A 2CJAA 3VWSA 1GX5A 2KT2A 1QAXA 1U49A 2M7SA 1G3OA 1GH8A 4LSNA 2VONA 5K9VA 3MEKA 3GIIA 1HWUA 4K4TA 5E3PA 2JJ4D 2HLTA 5IZHA 4XK8C 1QUPA 1VQ4S 5EX0A 3K0JA 2H4VA 1FVSA 2ZMMA 2LECA 3DRYA 4IG0A 4H4OB 5HI7A 2WTFA 3DOLA 3NBPA 2GA7A 3G6XA 2FPHX 5J8RA 2BM0A 2GIRA 1NK7A 3IN5A 4EFAC 1TFWA 1GXTA 3RZAA 4CNZA 1VQ6S 3ISZA 1GXLA 2CVEA 2MKCA 3MDFA 1TK5A 5IBSA 3BREA 3MUVP 3N79A 5G4DA 3EYZA 5LT5A 2AYBA 3SMEA 4NCAA 3QCFA