3MP9A

Structure of streptococcal protein g b1 domain at ph 3.0
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
HHHAMDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title Structural origins of pH-dependent chemical shifts in the B1 domain of protein G.
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Protein binding
total genus 13
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3mp9A00
2ON8A 5BMHA 1UWXA 4HJGE 3V3XA 1IBXA 3MP9A 2PTLA 1QKZA 2K0PA 4KGSA 2KDMA 4OZCA 2GI9A 2PW9A 2EELA 1Q10A 1GB4A 1GB1A 2IGDA 1MVKA 2JXTA 1PGXA 1YMHE 4MACA 2ZW0A 5HG2A 2OEDA 1KH0A 4KGTA 2LHEA 1ZXHA 5BMGA 1FCLA 1HEZE 2N7JA 3FILA 1PGAA 5JXVA 2ONQA 2NMQA 4OZBA 5HHDG 1MHXA 1HZ5A 1IGCA 1IBXB 2N9KA 1IGDA 2QMTA 1FD6A 1P7EA 1MI0A 2GB1A 2LUMA 1PGBA 2JSVX 2IGGA 4GLSC 1K50A 2J53A 2LGIA 1MHHE 1HZ6A 1P7FA 2I2YA 2JWUA 4IKGA 4D2KA 2N9LA 1FCCC 2LHDA 1C9FA 3FILB 1K51A 2KQ4X 2ZW1A 2IGHA 5HFYA 4KGRA 5BMIA 2QSDA 1F2RC 1JMLA 1F2RI 2KN4A 4HKZE 1K53A 2RPVA 2RMMA 2J52A 2KACA 2JU6X 3UI3A 4OZAA 1XCTL 5HI1A 1EM7A 1MPEA 2I38A 4WH4A 1D4BA 3GB1A 2JZPA 2PLPA 4IOIE 1YNTE 1K52A 1XF5L 2KWDA 1XCQL
chains in the Genus database with same CATH superfamily
2WXMA 2WDTB 2LI5A 3MP9A 3HVDA 2GI9A 3P42A 4RGTA 3EFCA 1JW9D 2L00B 3DWMA 1YN3A 1GB1A 2MLBA 2WHIA 3AH7A 3T8MA 1TT5B 1J7BA 4O1NA 1E7UA 1YX5B 2LHEA 4W9JA 2KK8A 1FFVA 2DYBA 4ZHPA 2N7JA 4WURA 4HKQA 2NTSA 1FMAD 1PGAA 2MJEA 1N63A 2M17A 3CMMB 1XD3B 3V05A 4PS8A 5HHDG 2D10A 2G45B 4E3CA 1NBFC 2ZJDA 4RF0A 1UBQA 5LXHA 4A90A 2KTFA 4HPPA 1FD6A 3R66C 1P7EA 2GB1A 2DWQA 3K9PB 2J7QB 4GLSC 1I42A 1L2NA 3PREA 3RNEC 3ZTCA 4G0NB 4W9IA 2KO3A 1KM7A 3P1MA 4BKGA 2VZKD 2C5LC 2RPQA 5IAAC 2FCSA 1TKGA 3L10B 3H7PB 2SEBD 2LJIA 5GXGB 1V9JA 3BIID 4HKZE 4IDIA 1I4GA 1V81A 1DOIA 1XLQA 1FXTB 4K3BA 3U8ZA 2KWCA 5IN7A 3L0WB 3TMPB 1PYWD 2BT6A 3U7ZA 1GJZA 1K52A 4HROA 3PGEA 4B95A 3ABVB 4ZRJA 1ZXIA 1SIJA 3DWGC 3PLUA 2W54A 2JT4B 1FO4A 2K22A 3ZJVA 4JQWC 4E74A 3NS1A 1YQBA 3GZNI 2ZPNA 3Q8FA 1ET9A 1WX9A 3DHHC 3MHZA 1QOFA 1QQRA 4ZHOA 3PTFC 3K9OB 1WR1A 2N1VA 1KLVA 3PHXB 4ZYSA 2DYMA 4N6EB 4JX1C 2V3NA 2V4IB 3SDLC 1CZPA 4ANXA 4W9LA 2DAFA 1F77A 1SB3C 3MC0B 2X8XX 4BKSD 1IGCA 3AM9A 4GN1A 1JRPA 3KUZA 1WE7A 1J19A 2BQQA 1D5MC 2LUMA 3FKYA 4PT5A 2G3QB 1FM0D 4OVUA 4YXDB 1FNVA 1TBEA 1V1PB 1WF9A 4TKNA 2WDQB 4P1BC 3H7PA 4GDKA 4US8A 3PVLA 3ZNGC 2JWUA 5AZHA 3KW5B 2TSSA 1J8CA 1C77A 4BZAA 3TEWA 3APFA 3N1ZC 1OQYA 1RM6C 4HLEA 4XYCA 4ARCA 3NHEB 3TJPA 1N5XA 2LVPA 2BYVE 2K39A 3TBLD 1XQQA 1WMHA 3RI7C 3HM6X 4HVBA 2INCC 2JU6X 3EA6A 3A9KB 4EZLA 2KNBA 3PSEB 4W9EA 1DOYA 1EO6A 3QIJA 3OAWA 4WJNA 4TMAB 3DQVA 4LNNA 4XX5A 4TQ1A 2IPKD 2KJRA 1F52A 1IUEA 4OZCA 1JQ4A 2GBMA 4GGQA 4F1SA 1WI0A 1SGHA 2NPTA 4YTPB 2KTRB 3BINA 2C7MB 4GSWA 5EE9A 2K6DB 1PGXA 3PZDA 2M8SA 2MCNB 1J0GA 2KC1A 3N3KB 5CHVC 2INNE 3PZ8A 1T0YA 1ZXHA 4BBNF 3UINB 1NI2A 2GBKA 1TS3A 1RYJA 3R7QA 4US9A 2ONQA 1C1YB 5DPRA 1WY8A 4DXFA 1BUIC 2WP9B 4EFOA 3BYTB 3PRMB 4DHJD 3WANA 1R4MI 1V1PA 1XO3A 1Y8RC 3P4RB 1PUTA 2IDYA 3AEDB 3RFZB 3IAM1 4KIKA 4FJZA 1OQQA 3WIMA 2GRIA 1WM2A 2L32A 2ZVNA 1BT0A 1AW7A 2RDBC 4IWPA 3QCAA 4WWNA 1K8RB 4MJSA 2CU3A 1P7FA 5CHWA 2GBJA 3Q8CA 4KKIA 3VH3B 2IO0B 3SHQA 2EMSA 2DYOA 3QQ8B 3A9JB 1B9RA 2C60A 3AEBB 4C7YA 5EE3A 2KVRA 3AI5A 2QSDA 2LGDA 3RCZA 5EE0A 1M94A 4RF1A 4W9KA 3AU4A 4EE2A 2DZIA 1WJNA 4OZAA 4K1RB 3QWZB 1UD7A 4HEA1 1FNUA 5DCNA 2VH2A 2CHWA 4AOFA 3R2TA 1JROA 1OQRA 2H89B 1V49A 3PS6A 4HJGE 3DBHB 3ZJTA 3DBLI 3WA0A 1IPGA 2NS5A 1QKZA 4CYEA 3EHVA 3Q3OC 5H8YE 5D94A 3JVZX 2K1FA 2V1YA 1JWAD 4CO7A 5T8IA 1WIAA 2ZCBA 3RNFC 1WXMA 3P4PB 1RRBA 1P1AA 1WZ0A 3ZO5B 3ZIMA 1FCLA 3OLMD 4FJVB 2HTHA 1WX8A 3AEFB 1AYFA 3NG0A 1S1QB 4M02A 2Q5WD 3VFKA 1SE2A 5JHAA 1H8CA 2G9HD 4I6PA 5J17A 2IYDB 3RNBC 2FE8A 1GOZA 1JCKB 3NUHB 4KDLB 3VR9B 3GP7A 1EF1A 4N58A 4WJOA 3U30A 4FN2A 1IGDA 3W1SA 5JZEB 4MT5A 3P2BA 4IG7B 3E9SA 1GAQB 2HE7A 4EOYA 2K8CA 4HDOA 4WAAA 3V60A 2WXOA 3HM3A 4NJCA 3SFDB 2O2VA 1XLOA 3OWEB 4ITKA 1T0SC 3IVFA 1WX7A 1GC7A 3KVFB 1N5WA 2MWSB 2K8HA 4FA6A 2KFJA 3ONSA 1P0RA 1WRDB 2RGFA 4JGHB 2JZPA 3QHTA 2RD0A 4AS1A 4LNFA 4M0WA 1I35A 3L54A 3L16A 2PKOA 2VRRB 4WWOA 1Y56A 3Q3MC 4MH0E 3MC9A 2A5UA 2PTLA 3AV8A 3U4EG 1Q1OA 4C56C 2KDMA 4J3OD 4XDDA 5D7GA 2MEKA 3U2SC 1V6EA 4ZRPA 2EELA 1E90A 1VJKA 4REZA 3T9LA 1V1OA 5D2MB 3WAOA 2DX5B 2GBRA 3ZDMC 3KUCB 1WXQA 4BFRA 2D3BA 3NY5A 4WQOB 3VUXA 1WXVA 2AQ2B 2LXAA 5AZGA 2AQ1B 4C4VA 1C79A 4K3CA 2DLBA 4ZYNA 5BYQA 1L5PA 1WR6E 4AWJA 1FIQA 2V4LA 4ZDVA 2N7EA 4I6LB 2V3PA 3VRBB 3W1SC 3VAWA 4MH8A 1SE4A 2DZKA 3BY4B 3H7SA 5C23A 4DHZE 4GOCA 4BBNC 2FIDA 4KX6B 3Q3FA 1L4ZB 4LNKA 3BK1A 1E8YA 1YX6B 4M8NA 3U7DA 4MGKE 3DBSA 2MP2A 5MPOA 3PRPB 1GG3A 2BB5A 4C00A 2QC8A 3NJTA 2O6VD 1STEA 1C78A 3CSFA 4FHJA 2YVCA 1ESFA 2NBWB 1L7YA 1EWCA 3PZ7A 3RPFC 2NVUI 5L83A 1QT9A 2LGYA 3QK0A 4I6NB 4RM8A 2PMVA 3L13A 2UYZB 1ACCA 4MSQB 3FC4A 1XCQL 2D2QA 3AN1A 2LFIA 2AX5A 4XWTA 2BYFA 1MG4A 2OOBB 1T0QC 4GMVA 1CK1A 2INDC 2N9PC 1C76A 3IG3A 1FFUA 5IOIA 3Q2AC 1WXAA 3RD2A 4LCDE 3KH0A 5G55A 4IWQA 3W2DA 3ZXRA 5L95C 1NENB 4MACA 4LTUA 1KOTA 2EMTA 1UZXB 3VR8B 2LGXA 2KX3A 1TS4A 1L6UA 1VZ6A 2X38A 2Z0DB 3L17A 5FR3A 4LJPB 2JYTA 4JIOU 1E9MA 1TKYA 1B1ZA 5GMVA 1SE3A 1LM8B 1LGRA 1I4QA 1U4AA 3KLSX 4GU2A 1R7SA 4A3PA 2BW2A 1ET6A 2W82A 1ENFA 4RGOS 1ROEA 5CX3A 4BAXA 4GB9A 4LK0M 4MGIE 2K5PA 4PK1A 4IWOA 1L6VA 2BB6A 4IM2A 2N9EB 3OJ4B 4XZ4A 4C7ZA 4RFBA 4MSMB 2FAZA 4BVUC 2SAKA 4PS7A 4IM3A 4X57B 2K9XA 2WXHA 2PVOD 3I5JC 4NPNA 3C0RB 4ZRKA 2UU7A 2PPHA 1L0XB 3UI3A 2WXLA 1UH6A 4K81A 2XEWA 3Q8BA 4TUUA 3VVWB 2JYEA 3W5UB 2KMAA 5DPTA 3BK2A 2LVOA 3BYYB 3Q3JA 3I63C 2HTME 1J7CA 1XF5L 2ZVOA 2BS2B 3Q14C 1I4XA 1FPYA 4ICUA 2W3SA 1EF5A 2MSED 1PFDA 2H88B 2RDGA 4GIVA 4EZKA 5BMHA 2RDHA 4GDKB 4WIPA 2CS4A 5IA7A 2WWZA 1P98A 1L0VB 4A55A 2KD0A 3ZQ4A 5LLIA 3VRAB 2MHJA 1Q10A 3TEZA 5FKAC 1VR9A 3AXCA 1ZOYB 3T3NA 2WU5B 5H92C 1WMHB 5C1ZA 4MGYE 2KDIA 4GDLB 1YN4A 3HIZA 2J0MA 2MJ3A 2EKEC 1XXGA 2ZCCA 1TYGB 2HJ8A 3H9DA 2KOXA 3AE7B 4OHJA 1YD8U 1JWBD 2WX0A 3M3JA 4G11A 2LD9A 2L3ZA 2IZVB 3WCQA 2KJHB 1RWSA 2N9KA 2WDVB 2NPTB 2BGFA 2LWPA 3CF6E 1WXSA 2KQSA 3JW0X 4MDKE 2WXPA 3ZLZA 2QHOA 1UWMA 2KXJA 1D6EC 2INPE 3APCA 4ASWC 2BF8B 4AQ7A 3R3MA 4EEWA 1AARA 1MFWA 3CWIA 3I9V1 4K7WA 2K6QA 2KHWB 3U52E 3ZDTA 3CSTA 1F2RI 2UWQA 2RMMA 2WXJA 1FNWA 4BOZB 3PPAA 2I1JA 1E7PB 2R2OA 2J0JA 2KLGA 4L1BA 4KIKB 1WRIA 4HPLB 1LQBA 2WYQA 4AUQC 1S3SG 3IFWB 4MJSB 1UWXA 3RNAC 3ZKJC 3TEXA 1ZDVA 2ZPYA 1N62A 3ZVVA 4ZOHC 4B9KA 4R3DA 5G5GA 2LUEA 3UIPB 3B2GA 4GDLA 3WAMA 3B2FA 4EUTA 3AULA 3UF8A 2WXNA 2KAJA 4KGTA 3KQ4A 4IM0A 1QF6A 1UELA 3OG5A 3FILA 2LZ6A 4HXDA 2WXRA 4MGZE 4NQKE 4F7ZA 1BXTA 3NVVA 2VH1A 1FRDA 2ICIA 3SFEB 4QAYA 3URYA 1SIFA 2KLCA 1X1MA 1FEHA 5AZFA 1PGBA 5DPSA 3AEAB 3T3OA 2KDEB 2ZZPB 4UDUC 1D3ZA 2I2YA 2E6XA 4KV2A 3RUIB 2DNFA 4BKSA 4RH6A 4XDCA 1KJTA 3RZWC 3ETRA 1E7VA 4P7IA 1KTKA 4DDID 2Y3AA 1P3QU 1LFDA 4YWGG 5BMIA 1V5TA 3ENEA 2LRWA 4WWPA 2JVCA 5TSSA 3VQIA 3E56A 2V3SA 2Z0EB 3VXWA 2PIAA 2QIEB 4ZRIA 3M95A 4WH4A 2I38A 1CJEA 3PV1A 5G5HA 4S0RA 3LJ3A 2WQYB 2BPSA 3KWLA 3W5VB 3SD5A 3B9JA 1Q0WB 3GS2A 3ZRCA 4FLHA 2FNJB 2L1AA 2O2VB 2KZRA 3AEEB 2AEHA 3A4RA 1E8WA 1LO5D 1SE9A 4GXBA 1CMXB 2G4SA 2NTTA 2WS3B 4JWUC 3QARA 2R2QA 2BBCA 2NCNA 1HE8A 1KH0A 1MG8A 1E8XA 2Y5BB 5FR6A 4A9AA 3TUOA 2G4DB 4DWFA 3ECIA 2YEPF 3IHPC 4M0WB 3H1UA 4L23A 4HWIB 1WJ6A 1JWUD 4BKTA 1G6JA 4IC7B 3A1QA 3X0WA 5D3DA 1FXIA 2PEAA 3KUDB 2WLBA 3EGRA 3P4QB 4P6VF 2QMTA 3KWVA 5DPWA 2WU2B 3ZNHB 5LNK1 1VDVA 2FCMA 2LASA 1QOAA 1WE6A 5KHOA 1NVID 4YTNB 3QC8B 4ANWA 3W9CB 4M8MA 1R4NI 4C4VB 2KVZA 2YEPB 4KGRA 3VHTC 3TL5A 3J9CA 3RNCC 1TTNA 1KF6B 4Q2JA 2Z59B 1QOBA 3MJWA 3AE6B 4NAWA 3GB1A 3DBRB 1OEYA 2IY1B 3DVGY 2KWUB 3RN9C 3BWUD 3NVYA 3SR6A 3NOBA 2M0AA 1TY2A 3HUIA 3Q69A 2KT7A 2CR5A 2MP2B 1WGGA 2WGSA 3QA8A 4KDIC 1RFAA 3DCGA 5E6OA 3HRDD 4HJKA 1CQVA 1WSPA 3FAHA 1F9JA 3N1YC 2PVGC 4LDTB 1HTQA 2FUG1 1JALA 2JXXA 1YQ3B 3ML8A 3NZSA 1TS5A 5I4DA 1V8CA 1T5XD 4HPMB 3IAS1 4YL8A 4OZBA 2ZEQA 2DZMA 2L83A 1WGYA 2M56B 2KN5A 5EDSA 4F8CB 2JSVX 1LXDA 4A8XC 2AL6A 1T3QA 1PQSA 3N30A 2NBVB 4DQOC 2D3AA 4YTMB 3VH4B 2RSUA 3DVNV 2BVCA 5JH5C 2MQJA 4B0EA 2LHDA 1C9FA 3LB8C 5LXIB 4WWMA 5KHQA 3JSVA 3A33B 4II2B 2KQ4X 4M00A 1TGZB 4CQNA 3BVMA 2DHZA 1EU3A 1JMLA 5IO9A 1DGJA 4HCNB 3LXFA 2BYTA 1UGJA 2EKIA 1QLBB 1GC6A 2KFKA 1NEKB 1VD2A 2D3GA 3TSSA 3AE8B 3D32A 1V97A 1J7AA 1WZ3A 4YSZB 3V3XA 3DPDA 4TSSA 1AN8A 3B0AA 4LNOA 1IBXA 1WGDA 2E3TA 2Z8LA 2M1MA 1SXTA 3RYTA 1TZ1A 1GB4A 4S17A 4AJWA 1T6BX 3LDZE 1HXYD 4WQMA 1D5ZC 3WALA 4KSLC 1QILA 3DOWA 4P1CC 1TZOA 2D5GA 4L2YA 2WXIA 2MBQA 3B1LX 3BVZA 3R2IA 2NMQA 2KJ6A 1OFFA 4M01A 5E6NA 2IBIB 1RFKA 3MHSD 2D11A 2BKRB 1V2YA 3KYCD 1F0ZA 3EC8A 1EU4A 3I3TB 3GZNB 5HKHA 1ZPSA 3AE4B 1K50A 1E5WA 3VDZA 1HTOA 3HHMA 1MHHE 3TCAA 1HZ6A 2HJ1A 4XGAB 3O13A 2V9HA 3UIOB 4LNIA 4RMAA 1EWYC 3TIXA 4USAA 2OJRA 3AE3B 2L05A 3ALBA 2K25A 2XK5B 2CHXA 2J52A 2L76A 1VZ8A 1E6EB 1MPEA 2D07B 5CTRC 3DDCB 3UGBB 4ARIA 4OVZA 2BS3B 1C4CA 1Z2MA 1XLPA 3RT3B 4A20A 2O6VA 1QOGA 1ZGUB 2ON8A 3MJ5A 4EKUA 4XWWA 2G1EA 5BYRA 1V86A 1N6ZA 1MJDA 3C19A 2Y5CA 1C4PA 3PT2B 2REXA 5AUKA 4FBJB 3NVZA 2IGDA 2DAJA 1YMHE 1P9DU 2D3CA 5AUIA 1UUPA 4MELA 2N4FA 2WXKA 2KANA 1V80A 1BMLC 1WYGA 2KWVB 4WJPA 2AL3A 3JYUA 3ZYYX 5JXVA 2VZKB 3L08A 2CKHB 1XT9B 2QJLA 4DHZB 3I57A 1VLBA 3DHGC 1E0ZA 3N1XC 3HK0A 1ZP0B 3V61A 1MI0A 2LEKA 1NYRA 5FK9C 4RGMA 3RMKC 3EFUA 4H2AA 3VUWA 3AU5A 2ACZB 4II3B 3ZNID 4IW0A 2WX1A 4IKGA 1Q5WB 2XK5A 3ZGZA 1YOVB 4ZRQA 5C3JB 3FILB 4YSXB 1VRAB 2C7HA 4G50A 1C3TA 1TY0A 1R4MB 1SEBD 2JPHA 2JX5A 2Y5PA 2MBHA 1FXAA 3WAPA 3KYDD 2JZZA 3PLVA 2KKCA 3DHIC 1YNTE 2N0SB 4KSKC 2KMMA 4PS3A 2PE9A 2B3AA 4NQLB 3M63B 3SU8X 1E10A 1GUAB 1GNUA 1A5RA 4KGSA 3AECB 2WDRB 1I4HA 3R7RA 1I4PA 2XN9C 1WM3A 1YJIA 3ZRFA 4YT0B 5TR5A 1KFYB 2L7RA 5HG2A 4K7SA 2OEDA 1KLUD 1UGMA 4ANUA 2BKFA 1HEZE 3AB5A 5BO4B 2C7NB 2PJHA 2DENB 4HK2A 3N20C 2DZJA 4XC2A 2FUHB 3DBLB 1ISNA 4DDGD 2QCZA 1TJEA 2KC2A 2M0XA 2I1KA 4FHKA 2KDBA 2CJNA 1WGHA 2PE6B 4OVVA 4KVGB 1TS2A 2LGSA 3PO0A 5C2TB 1ZUD2 3Q8EA 2KDFB 1K51A 4JWSC 2ZW1A 3QAQA 3V6CB 3AEGB 3L4PA 1E8ZA 4URKA 1F2RC 1T0RC 4NAMA 2MBOA 3A1QB 2YLMA 2RPVA 1R4NB 2JY6A 4HRSA 4NJ6A 1OTRB 1PDXA 5HI1A 1ZE3D 2XBBC 1GPXA 2MW5A 3RULA 3V6EB 3BZDB 4IOIE 3PHWB 3AE2B 3AMZA 1AWDA 1HA5A 5D3IB 1SBBB 3Q3NC 2N9XA 1VCBA 3IBEA 4E71A 4JE3B 4LLGM 2WXGA 1WWTA 2IJ0A 4DHJB 1C4AA 3NS8A 1KLGD 1H4RA 2IO3B 2BTEA 4XE0A 2GMIC 3M62B 1KRHA 1WFYA 2ZW0A 2WXQA 2FCQA 3ZW3A 3NZ3A 1F1HA 3NZUA 2N7DA 1YQ4B 4IUMB 2HDEA 4MEMA 2J0KA 1RAXA 2LXCA 4DXAB 4NAWB 1YJ1A 4BOSC 4MM3B 2MRPA 1WJUA 1WJ4A 5J18A 3A9KA 1TKEA 1ZKHA 5IP4D 4FULA 3HVZA 2MBBB 1ZDXA 4JLCA 2A4ZA 4NJ7A 4KKJA 1XEEA 2LJ5A 4LJOB 5J2RA 1WH3A 4ACFA 1NDDA 2ZNVB 2C9WB 3DVNU 4WJQA 1XLNA 3ZXVA 3P4SB 2NR2A 2KTRA 4C80A 3C8YA 1UBIA 4NZLB 4W9DA 2KYWA 5HFYA 1L0YB 3ZNZB 2QILA 2W55A 4TQ0A 2KN4A 2N1WA 2HD5B 2RR9A 3S2AA 1DOXA 3Q6BA 1DYQA 4W9CA 3NRZA 3TEYA 3VTVA 1EM7A 2M19A 4HCPB 3VTUA 3CIRB 3R8BA 1OEYJ 2PLPA 2WXFA 2JUOA 2BWES 4KZCA 5IKCM 2KWDA 4AP4C 4KZ0A 4PYUA 3AE5B 2JWZA 3EUB2 2R61A 1SJHD 2K0PA 2NBUA 3W1YA 3GOEA 2PW9A 4PYZA 2M4NA 4W9GA 2JZ3B 4A3OA 2JXTA 3JSVB 1QZEA 2DBYA 3IT6B 4RGNA 4DK5A 1N61A 1TIFA 2KQ7A 4MM3A 1JWSD 4N59A 2KFKB 1YJJA 3A9JA 1ZW7A 3H6NA 2MA9B 2CU1A 3ML9A 1SSNA 4J6IA 3GE3C 3ZTDA 2B76B 1L4DB 1YN5A 1IBXB 3NVWA 4RNAA 5D6JB 2BYEA 1IYFA 4P16A 4B6WA 2BWFA 4CHKA 4N9F4 2WNMA 4LDTD 5JHBA 4B0MA 3AE1B 4W9FA 1N60A 2LVQA 5E6JA 2L0FA 3APDA 2W3RA 3QX1A 1SJED 2CJOA 1JRUA 1FCCC 2GLSA 3EECA 1VZ7A 2IGHA 3ZUNA 1Z5SB 4G3XB 2W9NA 1K53A 1M4VA 4AJYB 3UQAA 2MH7A 5EE1A 2J4XA 4NNJB 3QJZA 1XCTL 4RCOA 2JF5A 1D4BA 4DXGA 4FXCA 3DBHI 1D5XC 2AWTA 1I4RA 2FBWB 3UQBA 3N9YC 2FCNA 3V62A 5AEKB 3O65B 3MTNB 1OGWA 4ICVA 1UNSA 3MC8A 1WGRA 1WGKA 4DBGA 1RLFA 4YSYB 1MVKA 2V0GA 3PRZA 2OJWA 4HDQA 3VUYA 1SF0A 1JWMD 1NI3A 2J42A 2LMCA 4FJYA 1UF0A 4WAFA 5BMGA 1A70A 3N32A 4JPSA 2K8BA 2IY0B 1V5OA 2FIFA 4FADA 2KMCA 2L0TA 2L52A 3GE8C 1I7HA 2K3UA 2O6VB 2JQRB 1MHXA 1HZ5A 2JRHA 2IO1B 2QEJC 2GOWA 1EUVB 2JRIB 1IP9A 2ZNVC 2MX2A 2IO2B 3H8HA 3DBRI 4ANVA 2IGGA 5CHFA 2ASQA 3X23A 2J53A 2LGIA 3Q8AA 3SEBA 2BS4B 3VTWA 5G2NA 5BYSA 3ZJUA 1FRRA 3BVGA 1YIWA 3DVGX 4D2KA 3IXSA 4W9HA 2N9LA 3AE9B 3RNGC 3B08A 3IT4B 3OJ3A 4JL9A 1WYWB 4A6QA 2MBEA 4EZJA 1HQRD 3LYYA 4RM9A 2KX0A 5E6PA 2QDFA 3RZFA 2MJDA 2GBNA 2OHFA 4OW0A 2CHZA 3A4SC 2KACA 2L8JA 2LRUA 4NY0A 4K7UA 4TV3A 2XNAC 2AYOB 2AQ3B 1NYQA 3P63A 3MFGA
chains in the Genus database with same CATH topology
2PKOA 3GS2A 1Y56A 2L1AA 2WXMA 1E10A 3MP9A 3AEEB 2PTLA 3AV8A 4KGSA 3U4EG 3AECB 3HVDA 4C56C 2KDMA 4J3OD 2GI9A 2WDRB 4XDDA 5D7GA 2MEKA 1I4HA 3P42A 3U2SC 1LO5D 4RGTA 4ZRPA 1I4PA 2EELA 2XN9C 1JW9D 3DWMA 1YN3A 1GB1A 2NTTA 1YJIA 2WS3B 1VJKA 3AH7A 4JWUC 4REZA 4YT0B 1KFYB 1V1OA 2BBCA 1J7BA 4O1NA 5HG2A 2OEDA 1KLUD 1KH0A 1WXQA 2LHEA 4A9AA 1FFVA 4ZHPA 3TUOA 1HEZE 2N7JA 3AB5A 2AQ2B 4WURA 2AQ1B 4HKQA 2NTSA 1C79A 1FMAD 1PGAA 2YEPF 2DLBA 2MJEA 1N63A 4L23A 5BYQA 3V05A 1L5PA 1JWUD 1FIQA 5HHDG 5D3DA 1FXIA 1TJEA 2WLBA 4RF0A 3VRBB 2V3PA 3EGRA 3P4QB 4P6VF 4MH8A 4A90A 1SE4A 2QMTA 1FD6A 3KWVA 2GB1A 1P7EA 2CJNA 2DWQA 2WU2B 4GLSC 5LNK1 1VDVA 4KX6B 1L4ZB 1TS2A 1QOAA 3BK1A 3PO0A 3P1MA 1NVID 4YTNB 5MPOA 5C2TB 2VZKD 1ZUD2 3W9CB 2BB5A 3Q8EA 1K51A 1C78A 1STEA 4JWSC 1TKGA 2YEPB 2ZW1A 3AEGB 3L4PA 4KGRA 1ESFA 1EWCA 2SEBD 3PZ7A 3RPFC 1F2RC 4NAMA 2LJIA 5GXGB 3J9CA 3BIID 4HKZE 2RPVA 4IDIA 1KF6B 1I4GA 4Q2JA 4HRSA 1DOIA 1XLQA 1QOBA 1PDXA 1QT9A 1ZE3D 5HI1A 1GPXA 3AE6B 3GB1A 1PYWD 3BZDB 2BT6A 2PMVA 4IOIE 3U7ZA 1K52A 3BWUD 1ACCA 4HROA 3NVYA 3AE2B 3FC4A 3AMZA 1XCQL 3ABVB 1AWDA 3SR6A 1HA5A 3AN1A 1ZXIA 2LFIA 1SIJA 2M0AA 2AX5A 4XWTA 3DWGC 5D3IB 1SBBB 1TY2A 3HUIA 2W54A 3Q69A 1CK1A 1FO4A 4JE3B 2K22A 3ZJVA 4LLGM 1C76A 1WWTA 1FFUA 2IJ0A 2WXGA 1C4AA 1KLGD 3NS1A 2BTEA 3W2DA 3HRDD 1NENB 4XE0A 4MACA 1CQVA 1WSPA 3Q8FA 3FAHA 4LTUA 1ET9A 1KRHA 2PVGC 3MHZA 1QOFA 1QQRA 2ZW0A 2WXQA 4ZHOA 3NZ3A 2FUG1 3VR8B 1JALA 1YQ4B 2DYMA 4ZYSA 4N6EB 4JX1C 2HDEA 1YQ3B 2V3NA 1TS4A 2V4IB 1L6UA 1VZ6A 4NAWB 2X38A 1TS5A 5I4DA 1V8CA 5FR3A 1CZPA 1T5XD 3IAS1 2JYTA 1F77A 4MM3B 4OZBA 1E9MA 1TKYA 1B1ZA 1SB3C 1SE3A 3MC0B 2L83A 1IGCA 1I4QA 1TKEA 3KLSX 3AM9A 1JRPA 2M56B 3HVZA 1R7SA 2BW2A 1ET6A 2W82A 1ZDXA 1D5MC 2LUMA 1ENFA 4PT5A 2JSVX 1ROEA 4RGOS 4A8XC 1FM0D 1T3QA 4YXDB 4DQOC 1FNVA 4KKJA 4LK0M 4YTMB 1V1PB 1XEEA 2WDQB 2K5PA 1L6VA 2BB6A 4US8A 1XLNA 2JWUA 3P4SB 4C7ZA 4RFBA 2TSSA 4B0EA 4C80A 3C8YA 1C77A 2LHDA 2SAKA 1C9FA 3LB8C 3TEWA 4WWMA 1RM6C 4NZLB 2K9XA 2WXHA 2KQ4X 2PVOD 4ARCA 5HFYA 4CQNA 3BVMA 1L0YB 1N5XA 1EU3A 1JMLA 2QILA 2W55A 4TQ0A 2KN4A 1DGJA 1L0XB 2JU6X 3LXFA 1DOXA 3EA6A 3UI3A 2BYTA 2WXLA 1UGJA 1DYQA 2EKIA 3NRZA 3Q8BA 3TEYA 1EM7A 2JYEA 2M19A 1QLBB 3W5UB 3CIRB 1DOYA 3BK2A 3BYYB 1NEKB 3R8BA 2HTME 1J7CA 2PLPA 2WXFA 3TSSA 3AE8B 1XF5L 2BS2B 1V97A 2KWDA 1I4XA 1J7AA 4TMAB 4YSZB 2W3SA 3AE5B 1PFDA 2H88B 2RDGA 5BMHA 3EUB2 2R61A 3V3XA 4TSSA 1AN8A 4TQ1A 2IPKD 1IBXA 2RDHA 4GDKB 4WIPA 1SJHD 2K0PA 1IUEA 4OZCA 1JQ4A 2PW9A 2E3TA 1L0VB 2Z8LA 4YTPB 4A55A 1SXTA 3ZQ4A 3VRAB 5EE9A 1Q10A 3TEZA 5FKAC 1GB4A 1VR9A 2JXTA 1PGXA 2DBYA 1ZOYB 3T3NA 1T6BX 3IT6B 1HXYD 4RGNA 4WQMA 2WU5B 5H92C 1D5ZC 1N61A 2INNE 3PZ8A 1QILA 1ZXHA 1JWSD 4GDLB 1YN4A 1TZOA 4N59A 2D5GA 4L2YA 2MJ3A 2WXIA 1XXGA 1TS3A 1TYGB 1RYJA 4US9A 1YJJA 3AE7B 3BVZA 4OHJA 3R2IA 2ONQA 2NMQA 1OFFA 1JWBD 4DXFA 1SSNA 3WCQA 2B76B 1BUIC 2WP9B 1L4DB 1YN5A 3BYTB 1IBXB 1RWSA 2N9KA 1RFKA 3NVWA 1V1PA 1XO3A 4RNAA 3P4RB 2WDVB 4P16A 1PUTA 2IDYA 3AEDB 3RFZB 3IAM1 1F0ZA 2WNMA 1EU4A 1OQQA 2GRIA 2L32A 1ZPSA 3AE4B 2WXPA 1K50A 1AW7A 4B0MA 3AE1B 1MHHE 1N60A 2CU3A 1HZ6A 1P7FA 5E6JA 3Q8CA 1UWMA 3O13A 2W3RA 1D6EC 2INPE 1SJED 2CJOA 4KKIA 1EWYC 1FCCC 4AQ7A 4USAA 2DYOA 3CWIA 1B9RA 1VZ7A 3I9V1 2IGHA 3AE3B 3AEBB 4C7YA 5EE3A 3U52E 2QSDA 1F2RI 5EE0A 1K53A 4RF1A 4EE2A 2RMMA 2WXJA 1FNWA 1M4VA 2J52A 2MH7A 5EE1A 1VZ8A 4OZAA 2J4XA 1E6EB 1XCTL 4RCOA 1E7PB 4HEA1 1MPEA 1D4BA 1FNUA 4FXCA 4DXGA 4ARIA 4L1BA 4OVZA 2BS3B 1WRIA 1D5XC 1I4RA 3R2TA 2FBWB 1C4CA 3N9YC 1JROA 1OQRA 1XLPA 2H89B 1QOGA 2ON8A 1UWXA 3MJ5A 4HJGE 4XWWA 3ZJTA 3TEXA 1ZDVA 1N62A 2G1EA 4ZOHC 5BYRA 1QKZA 1UNSA 4R3DA 2Y5CA 5G5GA 1C4PA 1WGKA 3B2GA 4YSYB 5AUKA 3NVZA 2IGDA 1MVKA 5H8YE 2V0GA 1YMHE 1JWAD 1SF0A 5T8IA 1JWMD 3B2FA 1NI3A 5AUIA 2J42A 2LMCA 1UUPA 3P4PB 2WXKA 2WXNA 2KAJA 1BMLC 4KGTA 4WAFA 1WYGA 3KQ4A 1QF6A 5BMGA 1FCLA 1A70A 3AEFB 3FILA 1AYFA 4JPSA 2Q5WD 3ZYYX 1SE2A 5JXVA 2VZKB 2G9HD 2L52A 2WXRA 1I7HA 2FE8A 1BXTA 2K3UA 1GOZA 2JQRB 3NVVA 1JCKB 1FRDA 3NUHB 3VR9B 2ICIA 3SFEB 1MHXA 2QJLA 1HZ5A 3GP7A 4N58A 3URYA 1IGDA 3I57A 2QEJC 3W1SA 1VLBA 4MT5A 1E0ZA 1ZP0B 1MI0A 1FEHA 1GAQB 2LEKA 3E9SA 1NYRA 1PGBA 3H8HA 4RGMA 5FK9C 2IGGA 4H2AA 2J53A 2LGIA 3AEAB 3Q8AA 2WXOA 3T3OA 3SEBA 4NJCA 2BS4B 3SFDB 2ACZB 4UDUC 1XLOA 5BYSA 3OWEB 3ZJUA 4ITKA 1FRRA 2I2YA 2E6XA 3BVGA 4IKGA 3ZGZA 4D2KA 3IXSA 4RH6A 2N9LA 3AE9B 4XDCA 4ZRQA 3IT4B 5C3JB 4A6QA 3ETRA 3FILB 4YSXB 1N5WA 1KTKA 1HQRD 1VRAB 3LYYA 2Y3AA 4YWGG 5BMIA 2MJDA 1TY0A 2OHFA 1SEBD 5TSSA 4OW0A 3VQIA 2JX5A 2KACA 3E56A 2Y5PA 2PIAA 2QIEB 1FXAA 4WH4A 2I38A 1CJEA 5G5HA 2XNAC 2JZPA 4AS1A 1YNTE 2WQYB 2N0SB 3KWLA 4M0WA 3W5VB 2AQ3B 1NYQA 3P63A 2KMMA 3MFGA 3B9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ON8 A;  5BMH A;  1UWX A;  4HJG E;  3V3X A;  1IBX A;  3MP9 A;  2PTL A;  1QKZ A;  2K0P A;  4KGS A;  2KDM A;  4OZC A;  2GI9 A;  2PW9 A;  2EEL A;  1Q10 A;  1GB4 A;  1GB1 A;  2IGD A;  1MVK A;  2JXT A;  1PGX A;  1YMH E;  4MAC A;  2ZW0 A;  5HG2 A;  2OED A;  1KH0 A;  4KGT A;  2LHE A;  1ZXH A;  5BMG A;  1FCL A;  1HEZ E;  2N7J A;  3FIL A;  1PGA A;  5JXV A;  2ONQ A;  2NMQ A;  4OZB A;  5HHD G;  1MHX A;  1HZ5 A;  1IGC A;  1IBX B;  2N9K A;  1IGD A;  2QMT A;  1FD6 A;  1P7E A;  1MI0 A;  2GB1 A;  2LUM A;  1PGB A;  2JSV X;  2IGG A;  4GLS C;  1K50 A;  2J53 A;  2LGI A;  1MHH E;  1HZ6 A;  1P7F A;  2I2Y A;  2JWU A;  4IKG A;  4D2K A;  2N9L A;  1FCC C;  2LHD A;  1C9F A;  3FIL B;  1K51 A;  2KQ4 X;  2ZW1 A;  2IGH A;  5HFY A;  4KGR A;  5BMI A;  2QSD A;  1F2R C;  1JML A;  1F2R I;  2KN4 A;  4HKZ E;  1K53 A;  2RPV A;  2RMM A;  2J52 A;  2KAC A;  2JU6 X;  3UI3 A;  4OZA A;  1XCT L;  5HI1 A;  1EM7 A;  1MPE A;  2I38 A;  4WH4 A;  1D4B A;  3GB1 A;  2JZP A;  2PLP A;  4IOI E;  1YNT E;  1K52 A;  1XF5 L;  2KWD A;  1XCQ L; 
#chains in the Genus database with same CATH topology
 2WXM A;  2WDT B;  2LI5 A;  3MP9 A;  3HVD A;  2GI9 A;  3P42 A;  4RGT A;  3EFC A;  1JW9 D;  2L00 B;  3DWM A;  1YN3 A;  1GB1 A;  2MLB A;  2WHI A;  3AH7 A;  3T8M A;  1TT5 B;  1J7B A;  4O1N A;  1E7U A;  1YX5 B;  2LHE A;  4W9J A;  2KK8 A;  1FFV A;  2DYB A;  4ZHP A;  2N7J A;  4WUR A;  4HKQ A;  2NTS A;  1FMA D;  1PGA A;  2MJE A;  1N63 A;  2M17 A;  3CMM B;  1XD3 B;  3V05 A;  4PS8 A;  5HHD G;  2D10 A;  2G45 B;  4E3C A;  1NBF C;  2ZJD A;  4RF0 A;  1UBQ A;  5LXH A;  4A90 A;  2KTF A;  4HPP A;  1FD6 A;  3R66 C;  1P7E A;  2GB1 A;  2DWQ A;  3K9P B;  2J7Q B;  4GLS C;  1I42 A;  1L2N A;  3PRE A;  3RNE C;  3ZTC A;  4G0N B;  4W9I A;  2KO3 A;  1KM7 A;  3P1M A;  4BKG A;  2VZK D;  2C5L C;  2RPQ A;  5IAA C;  2FCS A;  1TKG A;  3L10 B;  3H7P B;  2SEB D;  2LJI A;  5GXG B;  1V9J A;  3BII D;  4HKZ E;  4IDI A;  1I4G A;  1V81 A;  1DOI A;  1XLQ A;  1FXT B;  4K3B A;  3U8Z A;  2KWC A;  5IN7 A;  3L0W B;  3TMP B;  1PYW D;  2BT6 A;  3U7Z A;  1GJZ A;  1K52 A;  4HRO A;  3PGE A;  4B95 A;  3ABV B;  4ZRJ A;  1ZXI A;  1SIJ A;  3DWG C;  3PLU A;  2W54 A;  2JT4 B;  1FO4 A;  2K22 A;  3ZJV A;  4JQW C;  4E74 A;  3NS1 A;  1YQB A;  3GZN I;  2ZPN A;  3Q8F A;  1ET9 A;  1WX9 A;  3DHH C;  3MHZ A;  1QOF A;  1QQR A;  4ZHO A;  3PTF C;  3K9O B;  1WR1 A;  2N1V A;  1KLV A;  3PHX B;  4ZYS A;  2DYM A;  4N6E B;  4JX1 C;  2V3N A;  2V4I B;  3SDL C;  1CZP A;  4ANX A;  4W9L A;  2DAF A;  1F77 A;  1SB3 C;  3MC0 B;  2X8X X;  4BKS D;  1IGC A;  3AM9 A;  4GN1 A;  1JRP A;  3KUZ A;  1WE7 A;  1J19 A;  2BQQ A;  1D5M C;  2LUM A;  3FKY A;  4PT5 A;  2G3Q B;  1FM0 D;  4OVU A;  4YXD B;  1FNV A;  1TBE A;  1V1P B;  1WF9 A;  4TKN A;  2WDQ B;  4P1B C;  3H7P A;  4GDK A;  4US8 A;  3PVL A;  3ZNG C;  2JWU A;  5AZH A;  3KW5 B;  2TSS A;  1J8C A;  1C77 A;  4BZA A;  3TEW A;  3APF A;  3N1Z C;  1OQY A;  1RM6 C;  4HLE A;  4XYC A;  4ARC A;  3NHE B;  3TJP A;  1N5X A;  2LVP A;  2BYV E;  2K39 A;  3TBL D;  1XQQ A;  1WMH A;  3RI7 C;  3HM6 X;  4HVB A;  2INC C;  2JU6 X;  3EA6 A;  3A9K B;  4EZL A;  2KNB A;  3PSE B;  4W9E A;  1DOY A;  1EO6 A;  3QIJ A;  3OAW A;  4WJN A;  4TMA B;  3DQV A;  4LNN A;  4XX5 A;  4TQ1 A;  2IPK D;  2KJR A;  1F52 A;  1IUE A;  4OZC A;  1JQ4 A;  2GBM A;  4GGQ A;  4F1S A;  1WI0 A;  1SGH A;  2NPT A;  4YTP B;  2KTR B;  3BIN A;  2C7M B;  4GSW A;  5EE9 A;  2K6D B;  1PGX A;  3PZD A;  2M8S A;  2MCN B;  1J0G A;  2KC1 A;  3N3K B;  5CHV C;  2INN E;  3PZ8 A;  1T0Y A;  1ZXH A;  4BBN F;  3UIN B;  1NI2 A;  2GBK A;  1TS3 A;  1RYJ A;  3R7Q A;  4US9 A;  2ONQ A;  1C1Y B;  5DPR A;  1WY8 A;  4DXF A;  1BUI C;  2WP9 B;  4EFO A;  3BYT B;  3PRM B;  4DHJ D;  3WAN A;  1R4M I;  1V1P A;  1XO3 A;  1Y8R C;  3P4R B;  1PUT A;  2IDY A;  3AED B;  3RFZ B;  3IAM 1;  4KIK A;  4FJZ A;  1OQQ A;  3WIM A;  2GRI A;  1WM2 A;  2L32 A;  2ZVN A;  1BT0 A;  1AW7 A;  2RDB C;  4IWP A;  3QCA A;  4WWN A;  1K8R B;  4MJS A;  2CU3 A;  1P7F A;  5CHW A;  2GBJ A;  3Q8C A;  4KKI A;  3VH3 B;  2IO0 B;  3SHQ A;  2EMS A;  2DYO A;  3QQ8 B;  3A9J B;  1B9R A;  2C60 A;  3AEB B;  4C7Y A;  5EE3 A;  2KVR A;  3AI5 A;  2QSD A;  2LGD A;  3RCZ A;  5EE0 A;  1M94 A;  4RF1 A;  4W9K A;  3AU4 A;  4EE2 A;  2DZI A;  1WJN A;  4OZA A;  4K1R B;  3QWZ B;  1UD7 A;  4HEA 1;  1FNU A;  5DCN A;  2VH2 A;  2CHW A;  4AOF A;  3R2T A;  1JRO A;  1OQR A;  2H89 B;  1V49 A;  3PS6 A;  4HJG E;  3DBH B;  3ZJT A;  3DBL I;  3WA0 A;  1IPG A;  2NS5 A;  1QKZ A;  4CYE A;  3EHV A;  3Q3O C;  5H8Y E;  5D94 A;  3JVZ X;  2K1F A;  2V1Y A;  1JWA D;  4CO7 A;  5T8I A;  1WIA A;  2ZCB A;  3RNF C;  1WXM A;  3P4P B;  1RRB A;  1P1A A;  1WZ0 A;  3ZO5 B;  3ZIM A;  1FCL A;  3OLM D;  4FJV B;  2HTH A;  1WX8 A;  3AEF B;  1AYF A;  3NG0 A;  1S1Q B;  4M02 A;  2Q5W D;  3VFK A;  1SE2 A;  5JHA A;  1H8C A;  2G9H D;  4I6P A;  5J17 A;  2IYD B;  3RNB C;  2FE8 A;  1GOZ A;  1JCK B;  3NUH B;  4KDL B;  3VR9 B;  3GP7 A;  1EF1 A;  4N58 A;  4WJO A;  3U30 A;  4FN2 A;  1IGD A;  3W1S A;  5JZE B;  4MT5 A;  3P2B A;  4IG7 B;  3E9S A;  1GAQ B;  2HE7 A;  4EOY A;  2K8C A;  4HDO A;  4WAA A;  3V60 A;  2WXO A;  3HM3 A;  4NJC A;  3SFD B;  2O2V A;  1XLO A;  3OWE B;  4ITK A;  1T0S C;  3IVF A;  1WX7 A;  1GC7 A;  3KVF B;  1N5W A;  2MWS B;  2K8H A;  4FA6 A;  2KFJ A;  3ONS A;  1P0R A;  1WRD B;  2RGF A;  4JGH B;  2JZP A;  3QHT A;  2RD0 A;  4AS1 A;  4LNF A;  4M0W A;  1I35 A;  3L54 A;  3L16 A;  2PKO A;  2VRR B;  4WWO A;  1Y56 A;  3Q3M C;  4MH0 E;  3MC9 A;  2A5U A;  2PTL A;  3AV8 A;  3U4E G;  1Q1O A;  4C56 C;  2KDM A;  4J3O D;  4XDD A;  5D7G A;  2MEK A;  3U2S C;  1V6E A;  4ZRP A;  2EEL A;  1E90 A;  1VJK A;  4REZ A;  3T9L A;  1V1O A;  5D2M B;  3WAO A;  2DX5 B;  2GBR A;  3ZDM C;  3KUC B;  1WXQ A;  4BFR A;  2D3B A;  3NY5 A;  4WQO B;  3VUX A;  1WXV A;  2AQ2 B;  2LXA A;  5AZG A;  2AQ1 B;  4C4V A;  1C79 A;  4K3C A;  2DLB A;  4ZYN A;  5BYQ A;  1L5P A;  1WR6 E;  4AWJ A;  1FIQ A;  2V4L A;  4ZDV A;  2N7E A;  4I6L B;  2V3P A;  3VRB B;  3W1S C;  3VAW A;  4MH8 A;  1SE4 A;  2DZK A;  3BY4 B;  3H7S A;  5C23 A;  4DHZ E;  4GOC A;  4BBN C;  2FID A;  4KX6 B;  3Q3F A;  1L4Z B;  4LNK A;  3BK1 A;  1E8Y A;  1YX6 B;  4M8N A;  3U7D A;  4MGK E;  3DBS A;  2MP2 A;  5MPO A;  3PRP B;  1GG3 A;  2BB5 A;  4C00 A;  2QC8 A;  3NJT A;  2O6V D;  1STE A;  1C78 A;  3CSF A;  4FHJ A;  2YVC A;  1ESF A;  2NBW B;  1L7Y A;  1EWC A;  3PZ7 A;  3RPF C;  2NVU I;  5L83 A;  1QT9 A;  2LGY A;  3QK0 A;  4I6N B;  4RM8 A;  2PMV A;  3L13 A;  2UYZ B;  1ACC A;  4MSQ B;  3FC4 A;  1XCQ L;  2D2Q A;  3AN1 A;  2LFI A;  2AX5 A;  4XWT A;  2BYF A;  1MG4 A;  2OOB B;  1T0Q C;  4GMV A;  1CK1 A;  2IND C;  2N9P C;  1C76 A;  3IG3 A;  1FFU A;  5IOI A;  3Q2A C;  1WXA A;  3RD2 A;  4LCD E;  3KH0 A;  5G55 A;  4IWQ A;  3W2D A;  3ZXR A;  5L95 C;  1NEN B;  4MAC A;  4LTU A;  1KOT A;  2EMT A;  1UZX B;  3VR8 B;  2LGX A;  2KX3 A;  1TS4 A;  1L6U A;  1VZ6 A;  2X38 A;  2Z0D B;  3L17 A;  5FR3 A;  4LJP B;  2JYT A;  4JIO U;  1E9M A;  1TKY A;  1B1Z A;  5GMV A;  1SE3 A;  1LM8 B;  1LGR A;  1I4Q A;  1U4A A;  3KLS X;  4GU2 A;  1R7S A;  4A3P A;  2BW2 A;  1ET6 A;  2W82 A;  1ENF A;  4RGO S;  1ROE A;  5CX3 A;  4BAX A;  4GB9 A;  4LK0 M;  4MGI E;  2K5P A;  4PK1 A;  4IWO A;  1L6V A;  2BB6 A;  4IM2 A;  2N9E B;  3OJ4 B;  4XZ4 A;  4C7Z A;  4RFB A;  4MSM B;  2FAZ A;  4BVU C;  2SAK A;  4PS7 A;  4IM3 A;  4X57 B;  2K9X A;  2WXH A;  2PVO D;  3I5J C;  4NPN A;  3C0R B;  4ZRK A;  2UU7 A;  2PPH A;  1L0X B;  3UI3 A;  2WXL A;  1UH6 A;  4K81 A;  2XEW A;  3Q8B A;  4TUU A;  3VVW B;  2JYE A;  3W5U B;  2KMA A;  5DPT A;  3BK2 A;  2LVO A;  3BYY B;  3Q3J A;  3I63 C;  2HTM E;  1J7C A;  1XF5 L;  2ZVO A;  2BS2 B;  3Q14 C;  1I4X A;  1FPY A;  4ICU A;  2W3S A;  1EF5 A;  2MSE D;  1PFD A;  2H88 B;  2RDG A;  4GIV A;  4EZK A;  5BMH A;  2RDH A;  4GDK B;  4WIP A;  2CS4 A;  5IA7 A;  2WWZ A;  1P98 A;  1L0V B;  4A55 A;  2KD0 A;  3ZQ4 A;  5LLI A;  3VRA B;  2MHJ A;  1Q10 A;  3TEZ A;  5FKA C;  1VR9 A;  3AXC A;  1ZOY B;  3T3N A;  2WU5 B;  5H92 C;  1WMH B;  5C1Z A;  4MGY E;  2KDI A;  4GDL B;  1YN4 A;  3HIZ A;  2J0M A;  2MJ3 A;  2EKE C;  1XXG A;  2ZCC A;  1TYG B;  2HJ8 A;  3H9D A;  2KOX A;  3AE7 B;  4OHJ A;  1YD8 U;  1JWB D;  2WX0 A;  3M3J A;  4G11 A;  2LD9 A;  2L3Z A;  2IZV B;  3WCQ A;  2KJH B;  1RWS A;  2N9K A;  2WDV B;  2NPT B;  2BGF A;  2LWP A;  3CF6 E;  1WXS A;  2KQS A;  3JW0 X;  4MDK E;  2WXP A;  3ZLZ A;  2QHO A;  1UWM A;  2KXJ A;  1D6E C;  2INP E;  3APC A;  4ASW C;  2BF8 B;  4AQ7 A;  3R3M A;  4EEW A;  1AAR A;  1MFW A;  3CWI A;  3I9V 1;  4K7W A;  2K6Q A;  2KHW B;  3U52 E;  3ZDT A;  3CST A;  1F2R I;  2UWQ A;  2RMM A;  2WXJ A;  1FNW A;  4BOZ B;  3PPA A;  2I1J A;  1E7P B;  2R2O A;  2J0J A;  2KLG A;  4L1B A;  4KIK B;  1WRI A;  4HPL B;  1LQB A;  2WYQ A;  4AUQ C;  1S3S G;  3IFW B;  4MJS B;  1UWX A;  3RNA C;  3ZKJ C;  3TEX A;  1ZDV A;  2ZPY A;  1N62 A;  3ZVV A;  4ZOH C;  4B9K A;  4R3D A;  5G5G A;  2LUE A;  3UIP B;  3B2G A;  4GDL A;  3WAM A;  3B2F A;  4EUT A;  3AUL A;  3UF8 A;  2WXN A;  2KAJ A;  4KGT A;  3KQ4 A;  4IM0 A;  1QF6 A;  1UEL A;  3OG5 A;  3FIL A;  2LZ6 A;  4HXD A;  2WXR A;  4MGZ E;  4NQK E;  4F7Z A;  1BXT A;  3NVV A;  2VH1 A;  1FRD A;  2ICI A;  3SFE B;  4QAY A;  3URY A;  1SIF A;  2KLC A;  1X1M A;  1FEH A;  5AZF A;  1PGB A;  5DPS A;  3AEA B;  3T3O A;  2KDE B;  2ZZP B;  4UDU C;  1D3Z A;  2I2Y A;  2E6X A;  4KV2 A;  3RUI B;  2DNF A;  4BKS A;  4RH6 A;  4XDC A;  1KJT A;  3RZW C;  3ETR A;  1E7V A;  4P7I A;  1KTK A;  4DDI D;  2Y3A A;  1P3Q U;  1LFD A;  4YWG G;  5BMI A;  1V5T A;  3ENE A;  2LRW A;  4WWP A;  2JVC A;  5TSS A;  3VQI A;  3E56 A;  2V3S A;  2Z0E B;  3VXW A;  2PIA A;  2QIE B;  4ZRI A;  3M95 A;  4WH4 A;  2I38 A;  1CJE A;  3PV1 A;  5G5H A;  4S0R A;  3LJ3 A;  2WQY B;  2BPS A;  3KWL A;  3W5V B;  3SD5 A;  3B9J A;  1Q0W B;  3GS2 A;  3ZRC A;  4FLH A;  2FNJ B;  2L1A A;  2O2V B;  2KZR A;  3AEE B;  2AEH A;  3A4R A;  1E8W A;  1LO5 D;  1SE9 A;  4GXB A;  1CMX B;  2G4S A;  2NTT A;  2WS3 B;  4JWU C;  3QAR A;  2R2Q A;  2BBC A;  2NCN A;  1HE8 A;  1KH0 A;  1MG8 A;  1E8X A;  2Y5B B;  5FR6 A;  4A9A A;  3TUO A;  2G4D B;  4DWF A;  3ECI A;  2YEP F;  3IHP C;  4M0W B;  3H1U A;  4L23 A;  4HWI B;  1WJ6 A;  1JWU D;  4BKT A;  1G6J A;  4IC7 B;  3A1Q A;  3X0W A;  5D3D A;  1FXI A;  2PEA A;  3KUD B;  2WLB A;  3EGR A;  3P4Q B;  4P6V F;  2QMT A;  3KWV A;  5DPW A;  2WU2 B;  3ZNH B;  5LNK 1;  1VDV A;  2FCM A;  2LAS A;  1QOA A;  1WE6 A;  5KHO A;  1NVI D;  4YTN B;  3QC8 B;  4ANW A;  3W9C B;  4M8M A;  1R4N I;  4C4V B;  2KVZ A;  2YEP B;  4KGR A;  3VHT C;  3TL5 A;  3J9C A;  3RNC C;  1TTN A;  1KF6 B;  4Q2J A;  2Z59 B;  1QOB A;  3MJW A;  3AE6 B;  4NAW A;  3GB1 A;  3DBR B;  1OEY A;  2IY1 B;  3DVG Y;  2KWU B;  3RN9 C;  3BWU D;  3NVY A;  3SR6 A;  3NOB A;  2M0A A;  1TY2 A;  3HUI A;  3Q69 A;  2KT7 A;  2CR5 A;  2MP2 B;  1WGG A;  2WGS A;  3QA8 A;  4KDI C;  1RFA A;  3DCG A;  5E6O A;  3HRD D;  4HJK A;  1CQV A;  1WSP A;  3FAH A;  1F9J A;  3N1Y C;  2PVG C;  4LDT B;  1HTQ A;  2FUG 1;  1JAL A;  2JXX A;  1YQ3 B;  3ML8 A;  3NZS A;  1TS5 A;  5I4D A;  1V8C A;  1T5X D;  4HPM B;  3IAS 1;  4YL8 A;  4OZB A;  2ZEQ A;  2DZM A;  2L83 A;  1WGY A;  2M56 B;  2KN5 A;  5EDS A;  4F8C B;  2JSV X;  1LXD A;  4A8X C;  2AL6 A;  1T3Q A;  1PQS A;  3N30 A;  2NBV B;  4DQO C;  2D3A A;  4YTM B;  3VH4 B;  2RSU A;  3DVN V;  2BVC A;  5JH5 C;  2MQJ A;  4B0E A;  2LHD A;  1C9F A;  3LB8 C;  5LXI B;  4WWM A;  5KHQ A;  3JSV A;  3A33 B;  4II2 B;  2KQ4 X;  4M00 A;  1TGZ B;  4CQN A;  3BVM A;  2DHZ A;  1EU3 A;  1JML A;  5IO9 A;  1DGJ A;  4HCN B;  3LXF A;  2BYT A;  1UGJ A;  2EKI A;  1QLB B;  1GC6 A;  2KFK A;  1NEK B;  1VD2 A;  2D3G A;  3TSS A;  3AE8 B;  3D32 A;  1V97 A;  1J7A A;  1WZ3 A;  4YSZ B;  3V3X A;  3DPD A;  4TSS A;  1AN8 A;  3B0A A;  4LNO A;  1IBX A;  1WGD A;  2E3T A;  2Z8L A;  2M1M A;  1SXT A;  3RYT A;  1TZ1 A;  1GB4 A;  4S17 A;  4AJW A;  1T6B X;  3LDZ E;  1HXY D;  4WQM A;  1D5Z C;  3WAL A;  4KSL C;  1QIL A;  3DOW A;  4P1C C;  1TZO A;  2D5G A;  4L2Y A;  2WXI A;  2MBQ A;  3B1L X;  3BVZ A;  3R2I A;  2NMQ A;  2KJ6 A;  1OFF A;  4M01 A;  5E6N A;  2IBI B;  1RFK A;  3MHS D;  2D11 A;  2BKR B;  1V2Y A;  3KYC D;  1F0Z A;  3EC8 A;  1EU4 A;  3I3T B;  3GZN B;  5HKH A;  1ZPS A;  3AE4 B;  1K50 A;  1E5W A;  3VDZ A;  1HTO A;  3HHM A;  1MHH E;  3TCA A;  1HZ6 A;  2HJ1 A;  4XGA B;  3O13 A;  2V9H A;  3UIO B;  4LNI A;  4RMA A;  1EWY C;  3TIX A;  4USA A;  2OJR A;  3AE3 B;  2L05 A;  3ALB A;  2K25 A;  2XK5 B;  2CHX A;  2J52 A;  2L76 A;  1VZ8 A;  1E6E B;  1MPE A;  2D07 B;  5CTR C;  3DDC B;  3UGB B;  4ARI A;  4OVZ A;  2BS3 B;  1C4C A;  1Z2M A;  1XLP A;  3RT3 B;  4A20 A;  2O6V A;  1QOG A;  1ZGU B;  2ON8 A;  3MJ5 A;  4EKU A;  4XWW A;  2G1E A;  5BYR A;  1V86 A;  1N6Z A;  1MJD A;  3C19 A;  2Y5C A;  1C4P A;  3PT2 B;  2REX A;  5AUK A;  4FBJ B;  3NVZ A;  2IGD A;  2DAJ A;  1YMH E;  1P9D U;  2D3C A;  5AUI A;  1UUP A;  4MEL A;  2N4F A;  2WXK A;  2KAN A;  1V80 A;  1BML C;  1WYG A;  2KWV B;  4WJP A;  2AL3 A;  3JYU A;  3ZYY X;  5JXV A;  2VZK B;  3L08 A;  2CKH B;  1XT9 B;  2QJL A;  4DHZ B;  3I57 A;  1VLB A;  3DHG C;  1E0Z A;  3N1X C;  3HK0 A;  1ZP0 B;  3V61 A;  1MI0 A;  2LEK A;  1NYR A;  5FK9 C;  4RGM A;  3RMK C;  3EFU A;  4H2A A;  3VUW A;  3AU5 A;  2ACZ B;  4II3 B;  3ZNI D;  4IW0 A;  2WX1 A;  4IKG A;  1Q5W B;  2XK5 A;  3ZGZ A;  1YOV B;  4ZRQ A;  5C3J B;  3FIL B;  4YSX B;  1VRA B;  2C7H A;  4G50 A;  1C3T A;  1TY0 A;  1R4M B;  1SEB D;  2JPH A;  2JX5 A;  2Y5P A;  2MBH A;  1FXA A;  3WAP A;  3KYD D;  2JZZ A;  3PLV A;  2KKC A;  3DHI C;  1YNT E;  2N0S B;  4KSK C;  2KMM A;  4PS3 A;  2PE9 A;  2B3A A;  4NQL B;  3M63 B;  3SU8 X;  1E10 A;  1GUA B;  1GNU A;  1A5R A;  4KGS A;  3AEC B;  2WDR B;  1I4H A;  3R7R A;  1I4P A;  2XN9 C;  1WM3 A;  1YJI A;  3ZRF A;  4YT0 B;  5TR5 A;  1KFY B;  2L7R A;  5HG2 A;  4K7S A;  2OED A;  1KLU D;  1UGM A;  4ANU A;  2BKF A;  1HEZ E;  3AB5 A;  5BO4 B;  2C7N B;  2PJH A;  2DEN B;  4HK2 A;  3N20 C;  2DZJ A;  4XC2 A;  2FUH B;  3DBL B;  1ISN A;  4DDG D;  2QCZ A;  1TJE A;  2KC2 A;  2M0X A;  2I1K A;  4FHK A;  2KDB A;  2CJN A;  1WGH A;  2PE6 B;  4OVV A;  4KVG B;  1TS2 A;  2LGS A;  3PO0 A;  5C2T B;  1ZUD 2;  3Q8E A;  2KDF B;  1K51 A;  4JWS C;  2ZW1 A;  3QAQ A;  3V6C B;  3AEG B;  3L4P A;  1E8Z A;  4URK A;  1F2R C;  1T0R C;  4NAM A;  2MBO A;  3A1Q B;  2YLM A;  2RPV A;  1R4N B;  2JY6 A;  4HRS A;  4NJ6 A;  1OTR B;  1PDX A;  5HI1 A;  1ZE3 D;  2XBB C;  1GPX A;  2MW5 A;  3RUL A;  3V6E B;  3BZD B;  4IOI E;  3PHW B;  3AE2 B;  3AMZ A;  1AWD A;  1HA5 A;  5D3I B;  1SBB B;  3Q3N C;  2N9X A;  1VCB A;  3IBE A;  4E71 A;  4JE3 B;  4LLG M;  2WXG A;  1WWT A;  2IJ0 A;  4DHJ B;  1C4A A;  3NS8 A;  1KLG D;  1H4R A;  2IO3 B;  2BTE A;  4XE0 A;  2GMI C;  3M62 B;  1KRH A;  1WFY A;  2ZW0 A;  2WXQ A;  2FCQ A;  3ZW3 A;  3NZ3 A;  1F1H A;  3NZU A;  2N7D A;  1YQ4 B;  4IUM B;  2HDE A;  4MEM A;  2J0K A;  1RAX A;  2LXC A;  4DXA B;  4NAW B;  1YJ1 A;  4BOS C;  4MM3 B;  2MRP A;  1WJU A;  1WJ4 A;  5J18 A;  3A9K A;  1TKE A;  1ZKH A;  5IP4 D;  4FUL A;  3HVZ A;  2MBB B;  1ZDX A;  4JLC A;  2A4Z A;  4NJ7 A;  4KKJ A;  1XEE A;  2LJ5 A;  4LJO B;  5J2R A;  1WH3 A;  4ACF A;  1NDD A;  2ZNV B;  2C9W B;  3DVN U;  4WJQ A;  1XLN A;  3ZXV A;  3P4S B;  2NR2 A;  2KTR A;  4C80 A;  3C8Y A;  1UBI A;  4NZL B;  4W9D A;  2KYW A;  5HFY A;  1L0Y B;  3ZNZ B;  2QIL A;  2W55 A;  4TQ0 A;  2KN4 A;  2N1W A;  2HD5 B;  2RR9 A;  3S2A A;  1DOX A;  3Q6B A;  1DYQ A;  4W9C A;  3NRZ A;  3TEY A;  3VTV A;  1EM7 A;  2M19 A;  4HCP B;  3VTU A;  3CIR B;  3R8B A;  1OEY J;  2PLP A;  2WXF A;  2JUO A;  2BWE S;  4KZC A;  5IKC M;  2KWD A;  4AP4 C;  4KZ0 A;  4PYU A;  3AE5 B;  2JWZ A;  3EUB 2;  2R61 A;  1SJH D;  2K0P A;  2NBU A;  3W1Y A;  3GOE A;  2PW9 A;  4PYZ A;  2M4N A;  4W9G A;  2JZ3 B;  4A3O A;  2JXT A;  3JSV B;  1QZE A;  2DBY A;  3IT6 B;  4RGN A;  4DK5 A;  1N61 A;  1TIF A;  2KQ7 A;  4MM3 A;  1JWS D;  4N59 A;  2KFK B;  1YJJ A;  3A9J A;  1ZW7 A;  3H6N A;  2MA9 B;  2CU1 A;  3ML9 A;  1SSN A;  4J6I A;  3GE3 C;  3ZTD A;  2B76 B;  1L4D B;  1YN5 A;  1IBX B;  3NVW A;  4RNA A;  5D6J B;  2BYE A;  1IYF A;  4P16 A;  4B6W A;  2BWF A;  4CHK A;  4N9F 4;  2WNM A;  4LDT D;  5JHB A;  4B0M A;  3AE1 B;  4W9F A;  1N60 A;  2LVQ A;  5E6J A;  2L0F A;  3APD A;  2W3R A;  3QX1 A;  1SJE D;  2CJO A;  1JRU A;  1FCC C;  2GLS A;  3EEC A;  1VZ7 A;  2IGH A;  3ZUN A;  1Z5S B;  4G3X B;  2W9N A;  1K53 A;  1M4V A;  4AJY B;  3UQA A;  2MH7 A;  5EE1 A;  2J4X A;  4NNJ B;  3QJZ A;  1XCT L;  4RCO A;  2JF5 A;  1D4B A;  4DXG A;  4FXC A;  3DBH I;  1D5X C;  2AWT A;  1I4R A;  2FBW B;  3UQB A;  3N9Y C;  2FCN A;  3V62 A;  5AEK B;  3O65 B;  3MTN B;  1OGW A;  4ICV A;  1UNS A;  3MC8 A;  1WGR A;  1WGK A;  4DBG A;  1RLF A;  4YSY B;  1MVK A;  2V0G A;  3PRZ A;  2OJW A;  4HDQ A;  3VUY A;  1SF0 A;  1JWM D;  1NI3 A;  2J42 A;  2LMC A;  4FJY A;  1UF0 A;  4WAF A;  5BMG A;  1A70 A;  3N32 A;  4JPS A;  2K8B A;  2IY0 B;  1V5O A;  2FIF A;  4FAD A;  2KMC A;  2L0T A;  2L52 A;  3GE8 C;  1I7H A;  2K3U A;  2O6V B;  2JQR B;  1MHX A;  1HZ5 A;  2JRH A;  2IO1 B;  2QEJ C;  2GOW A;  1EUV B;  2JRI B;  1IP9 A;  2ZNV C;  2MX2 A;  2IO2 B;  3H8H A;  3DBR I;  4ANV A;  2IGG A;  5CHF A;  2ASQ A;  3X23 A;  2J53 A;  2LGI A;  3Q8A A;  3SEB A;  2BS4 B;  3VTW A;  5G2N A;  5BYS A;  3ZJU A;  1FRR A;  3BVG A;  1YIW A;  3DVG X;  4D2K A;  3IXS A;  4W9H A;  2N9L A;  3AE9 B;  3RNG C;  3B08 A;  3IT4 B;  3OJ3 A;  4JL9 A;  1WYW B;  4A6Q A;  2MBE A;  4EZJ A;  1HQR D;  3LYY A;  4RM9 A;  2KX0 A;  5E6P A;  2QDF A;  3RZF A;  2MJD A;  2GBN A;  2OHF A;  4OW0 A;  2CHZ A;  3A4S C;  2KAC A;  2L8J A;  2LRU A;  4NY0 A;  4K7U A;  4TV3 A;  2XNA C;  2AYO B;  2AQ3 B;  1NYQ A;  3P63 A;  3MFG A; 
#chains in the Genus database with same CATH homology
 2PKO A;  3GS2 A;  1Y56 A;  2L1A A;  2WXM A;  1E10 A;  3MP9 A;  3AEE B;  2PTL A;  3AV8 A;  4KGS A;  3U4E G;  3AEC B;  3HVD A;  4C56 C;  2KDM A;  4J3O D;  2GI9 A;  2WDR B;  4XDD A;  5D7G A;  2MEK A;  1I4H A;  3P42 A;  3U2S C;  1LO5 D;  4RGT A;  4ZRP A;  1I4P A;  2EEL A;  2XN9 C;  1JW9 D;  3DWM A;  1YN3 A;  1GB1 A;  2NTT A;  1YJI A;  2WS3 B;  1VJK A;  3AH7 A;  4JWU C;  4REZ A;  4YT0 B;  1KFY B;  1V1O A;  2BBC A;  1J7B A;  4O1N A;  5HG2 A;  2OED A;  1KLU D;  1KH0 A;  1WXQ A;  2LHE A;  4A9A A;  1FFV A;  4ZHP A;  3TUO A;  1HEZ E;  2N7J A;  3AB5 A;  2AQ2 B;  4WUR A;  2AQ1 B;  4HKQ A;  2NTS A;  1C79 A;  1FMA D;  1PGA A;  2YEP F;  2DLB A;  2MJE A;  1N63 A;  4L23 A;  5BYQ A;  3V05 A;  1L5P A;  1JWU D;  1FIQ A;  5HHD G;  5D3D A;  1FXI A;  1TJE A;  2WLB A;  4RF0 A;  3VRB B;  2V3P A;  3EGR A;  3P4Q B;  4P6V F;  4MH8 A;  4A90 A;  1SE4 A;  2QMT A;  1FD6 A;  3KWV A;  2GB1 A;  1P7E A;  2CJN A;  2DWQ A;  2WU2 B;  4GLS C;  5LNK 1;  1VDV A;  4KX6 B;  1L4Z B;  1TS2 A;  1QOA A;  3BK1 A;  3PO0 A;  3P1M A;  1NVI D;  4YTN B;  5MPO A;  5C2T B;  2VZK D;  1ZUD 2;  3W9C B;  2BB5 A;  3Q8E A;  1K51 A;  1C78 A;  1STE A;  4JWS C;  1TKG A;  2YEP B;  2ZW1 A;  3AEG B;  3L4P A;  4KGR A;  1ESF A;  1EWC A;  2SEB D;  3PZ7 A;  3RPF C;  1F2R C;  4NAM A;  2LJI A;  5GXG B;  3J9C A;  3BII D;  4HKZ E;  2RPV A;  4IDI A;  1KF6 B;  1I4G A;  4Q2J A;  4HRS A;  1DOI A;  1XLQ A;  1QOB A;  1PDX A;  1QT9 A;  1ZE3 D;  5HI1 A;  1GPX A;  3AE6 B;  3GB1 A;  1PYW D;  3BZD B;  2BT6 A;  2PMV A;  4IOI E;  3U7Z A;  1K52 A;  3BWU D;  1ACC A;  4HRO A;  3NVY A;  3AE2 B;  3FC4 A;  3AMZ A;  1XCQ L;  3ABV B;  1AWD A;  3SR6 A;  1HA5 A;  3AN1 A;  1ZXI A;  2LFI A;  1SIJ A;  2M0A A;  2AX5 A;  4XWT A;  3DWG C;  5D3I B;  1SBB B;  1TY2 A;  3HUI A;  2W54 A;  3Q69 A;  1CK1 A;  1FO4 A;  4JE3 B;  2K22 A;  3ZJV A;  4LLG M;  1C76 A;  1WWT A;  1FFU A;  2IJ0 A;  2WXG A;  1C4A A;  1KLG D;  3NS1 A;  2BTE A;  3W2D A;  3HRD D;  1NEN B;  4XE0 A;  4MAC A;  1CQV A;  1WSP A;  3Q8F A;  3FAH A;  4LTU A;  1ET9 A;  1KRH A;  2PVG C;  3MHZ A;  1QOF A;  1QQR A;  2ZW0 A;  2WXQ A;  4ZHO A;  3NZ3 A;  2FUG 1;  3VR8 B;  1JAL A;  1YQ4 B;  2DYM A;  4ZYS A;  4N6E B;  4JX1 C;  2HDE A;  1YQ3 B;  2V3N A;  1TS4 A;  2V4I B;  1L6U A;  1VZ6 A;  4NAW B;  2X38 A;  1TS5 A;  5I4D A;  1V8C A;  5FR3 A;  1CZP A;  1T5X D;  3IAS 1;  2JYT A;  1F77 A;  4MM3 B;  4OZB A;  1E9M A;  1TKY A;  1B1Z A;  1SB3 C;  1SE3 A;  3MC0 B;  2L83 A;  1IGC A;  1I4Q A;  1TKE A;  3KLS X;  3AM9 A;  1JRP A;  2M56 B;  3HVZ A;  1R7S A;  2BW2 A;  1ET6 A;  2W82 A;  1ZDX A;  1D5M C;  2LUM A;  1ENF A;  4PT5 A;  2JSV X;  1ROE A;  4RGO S;  4A8X C;  1FM0 D;  1T3Q A;  4YXD B;  4DQO C;  1FNV A;  4KKJ A;  4LK0 M;  4YTM B;  1V1P B;  1XEE A;  2WDQ B;  2K5P A;  1L6V A;  2BB6 A;  4US8 A;  1XLN A;  2JWU A;  3P4S B;  4C7Z A;  4RFB A;  2TSS A;  4B0E A;  4C80 A;  3C8Y A;  1C77 A;  2LHD A;  2SAK A;  1C9F A;  3LB8 C;  3TEW A;  4WWM A;  1RM6 C;  4NZL B;  2K9X A;  2WXH A;  2KQ4 X;  2PVO D;  4ARC A;  5HFY A;  4CQN A;  3BVM A;  1L0Y B;  1N5X A;  1EU3 A;  1JML A;  2QIL A;  2W55 A;  4TQ0 A;  2KN4 A;  1DGJ A;  1L0X B;  2JU6 X;  3LXF A;  1DOX A;  3EA6 A;  3UI3 A;  2BYT A;  2WXL A;  1UGJ A;  1DYQ A;  2EKI A;  3NRZ A;  3Q8B A;  3TEY A;  1EM7 A;  2JYE A;  2M19 A;  1QLB B;  3W5U B;  3CIR B;  1DOY A;  3BK2 A;  3BYY B;  1NEK B;  3R8B A;  2HTM E;  1J7C A;  2PLP A;  2WXF A;  3TSS A;  3AE8 B;  1XF5 L;  2BS2 B;  1V97 A;  2KWD A;  1I4X A;  1J7A A;  4TMA B;  4YSZ B;  2W3S A;  3AE5 B;  1PFD A;  2H88 B;  2RDG A;  5BMH A;  3EUB 2;  2R61 A;  3V3X A;  4TSS A;  1AN8 A;  4TQ1 A;  2IPK D;  1IBX A;  2RDH A;  4GDK B;  4WIP A;  1SJH D;  2K0P A;  1IUE A;  4OZC A;  1JQ4 A;  2PW9 A;  2E3T A;  1L0V B;  2Z8L A;  4YTP B;  4A55 A;  1SXT A;  3ZQ4 A;  3VRA B;  5EE9 A;  1Q10 A;  3TEZ A;  5FKA C;  1GB4 A;  1VR9 A;  2JXT A;  1PGX A;  2DBY A;  1ZOY B;  3T3N A;  1T6B X;  3IT6 B;  1HXY D;  4RGN A;  4WQM A;  2WU5 B;  5H92 C;  1D5Z C;  1N61 A;  2INN E;  3PZ8 A;  1QIL A;  1ZXH A;  1JWS D;  4GDL B;  1YN4 A;  1TZO A;  4N59 A;  2D5G A;  4L2Y A;  2MJ3 A;  2WXI A;  1XXG A;  1TS3 A;  1TYG B;  1RYJ A;  4US9 A;  1YJJ A;  3AE7 B;  3BVZ A;  4OHJ A;  3R2I A;  2ONQ A;  2NMQ A;  1OFF A;  1JWB D;  4DXF A;  1SSN A;  3WCQ A;  2B76 B;  1BUI C;  2WP9 B;  1L4D B;  1YN5 A;  3BYT B;  1IBX B;  1RWS A;  2N9K A;  1RFK A;  3NVW A;  1V1P A;  1XO3 A;  4RNA A;  3P4R B;  2WDV B;  4P16 A;  1PUT A;  2IDY A;  3AED B;  3RFZ B;  3IAM 1;  1F0Z A;  2WNM A;  1EU4 A;  1OQQ A;  2GRI A;  2L32 A;  1ZPS A;  3AE4 B;  2WXP A;  1K50 A;  1AW7 A;  4B0M A;  3AE1 B;  1MHH E;  1N60 A;  2CU3 A;  1HZ6 A;  1P7F A;  5E6J A;  3Q8C A;  1UWM A;  3O13 A;  2W3R A;  1D6E C;  2INP E;  1SJE D;  2CJO A;  4KKI A;  1EWY C;  1FCC C;  4AQ7 A;  4USA A;  2DYO A;  3CWI A;  1B9R A;  1VZ7 A;  3I9V 1;  2IGH A;  3AE3 B;  3AEB B;  4C7Y A;  5EE3 A;  3U52 E;  2QSD A;  1F2R I;  5EE0 A;  1K53 A;  4RF1 A;  4EE2 A;  2RMM A;  2WXJ A;  1FNW A;  1M4V A;  2J52 A;  2MH7 A;  5EE1 A;  1VZ8 A;  4OZA A;  2J4X A;  1E6E B;  1XCT L;  4RCO A;  1E7P B;  4HEA 1;  1MPE A;  1D4B A;  1FNU A;  4FXC A;  4DXG A;  4ARI A;  4L1B A;  4OVZ A;  2BS3 B;  1WRI A;  1D5X C;  1I4R A;  3R2T A;  2FBW B;  1C4C A;  3N9Y C;  1JRO A;  1OQR A;  1XLP A;  2H89 B;  1QOG A;  2ON8 A;  1UWX A;  3MJ5 A;  4HJG E;  4XWW A;  3ZJT A;  3TEX A;  1ZDV A;  1N62 A;  2G1E A;  4ZOH C;  5BYR A;  1QKZ A;  1UNS A;  4R3D A;  2Y5C A;  5G5G A;  1C4P A;  1WGK A;  3B2G A;  4YSY B;  5AUK A;  3NVZ A;  2IGD A;  1MVK A;  5H8Y E;  2V0G A;  1YMH E;  1JWA D;  1SF0 A;  5T8I A;  1JWM D;  3B2F A;  1NI3 A;  5AUI A;  2J42 A;  2LMC A;  1UUP A;  3P4P B;  2WXK A;  2WXN A;  2KAJ A;  1BML C;  4KGT A;  4WAF A;  1WYG A;  3KQ4 A;  1QF6 A;  5BMG A;  1FCL A;  1A70 A;  3AEF B;  3FIL A;  1AYF A;  4JPS A;  2Q5W D;  3ZYY X;  1SE2 A;  5JXV A;  2VZK B;  2G9H D;  2L52 A;  2WXR A;  1I7H A;  2FE8 A;  1BXT A;  2K3U A;  1GOZ A;  2JQR B;  3NVV A;  1JCK B;  1FRD A;  3NUH B;  3VR9 B;  2ICI A;  3SFE B;  1MHX A;  2QJL A;  1HZ5 A;  3GP7 A;  4N58 A;  3URY A;  1IGD A;  3I57 A;  2QEJ C;  3W1S A;  1VLB A;  4MT5 A;  1E0Z A;  1ZP0 B;  1MI0 A;  1FEH A;  1GAQ B;  2LEK A;  3E9S A;  1NYR A;  1PGB A;  3H8H A;  4RGM A;  5FK9 C;  2IGG A;  4H2A A;  2J53 A;  2LGI A;  3AEA B;  3Q8A A;  2WXO A;  3T3O A;  3SEB A;  4NJC A;  2BS4 B;  3SFD B;  2ACZ B;  4UDU C;  1XLO A;  5BYS A;  3OWE B;  3ZJU A;  4ITK A;  1FRR A;  2I2Y A;  2E6X A;  3BVG A;  4IKG A;  3ZGZ A;  4D2K A;  3IXS A;  4RH6 A;  2N9L A;  3AE9 B;  4XDC A;  4ZRQ A;  3IT4 B;  5C3J B;  4A6Q A;  3ETR A;  3FIL B;  4YSX B;  1N5W A;  1KTK A;  1HQR D;  1VRA B;  3LYY A;  2Y3A A;  4YWG G;  5BMI A;  2MJD A;  1TY0 A;  2OHF A;  1SEB D;  5TSS A;  4OW0 A;  3VQI A;  2JX5 A;  2KAC A;  3E56 A;  2Y5P A;  2PIA A;  2QIE B;  1FXA A;  4WH4 A;  2I38 A;  1CJE A;  5G5H A;  2XNA C;  2JZP A;  4AS1 A;  1YNT E;  2WQY B;  2N0S B;  3KWL A;  4M0W A;  3W5V B;  2AQ3 B;  1NYQ A;  3P63 A;  2KMM A;  3MFG A;  3B9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...