3MP9A

Structure of streptococcal protein g b1 domain at ph 3.0
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
HHHAMDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural origins of pH-dependent chemical shifts in the B1 domain of protein G.
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Protein binding
molecule keywords Immunoglobulin G-binding protein G
total genus 13
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3mp9A00
1UWXA 4OZAA 4IKGA 1YNTE 1HZ5A 2LGIA 4D2KA 1ZXHA 2K0PA 2N9LA 3MP9A 1GB1A 2NMQA 5BMIA 1IBXA 2KWDA 1FD6A 1FCLA 3UI3A 1IGDA 2IGHA 1MI0A 1MPEA 1F2RC 3GB1A 5BMGA 3FILB 1HZ6A 1XCQL 2PLPA 1XF5L 2N7JA 4HJGE 1C9FA 4KGTA 1MVKA 2KACA 1MHHE 2I2YA 2LHEA 1F2RI 1P7EA 2JWUA 2KQ4X 5HHDG 1K50A 1Q10A 2J53A 2ZW0A 1YMHE 1PGXA 1P7FA 2KDMA 1EM7A 2RPVA 1FCCC 3V3XA 5HG2A 2JZPA 1IBXB 1K52A 2OEDA 2IGDA 4GLSC 5BMHA 1KH0A 4KGRA 2QSDA 4MACA 4OZBA 2N9KA 1PGBA 2QMTA 2IGGA 2ZW1A 5HFYA 3FILA 5HI1A 1HEZE 2LHDA 2ON8A 2JXTA 2JSVX 2EELA 1XCTL 1D4BA 1PGAA 2ONQA 2LUMA 4OZCA 1K53A 1IGCA 2GB1A 4IOIE 1MHXA 1GB4A 4HKZE 2RMMA 2I38A 1K51A 5JXVA 2GI9A 2KN4A 2JU6X 2PTLA 2PW9A 2J52A 4KGSA 1JMLA 4WH4A 1QKZA
chains in the Genus database with same CATH superfamily
1Q5WB 2SAKA 3AH7A 2Z59B 4XZ4A 3MP9A 2N9LA 1HE8A 5L95C 3PHWB 4H2AA 2NTSA 5D6JB 2WXNA 2C5LC 2Y3AA 2BQQA 3A9KB 5EE3A 3WALA 4A20A 2UYZB 4HVBA 5G2NA 1WX8A 2LXCA 3ZTDA 2MWSB 3BZDB 3EECA 1XD3B 2OOBB 1FNVA 2K5PA 1T0SC 2CU1A 1F2RI 1AWDA 3Q3MC 4DWFA 1YN4A 2JPHA 3MC8A 2RDBC 3SHQA 2CHXA 3V3XA 2V0GA 4EZJA 4ARIA 3RZWC 3O13A 2INDC 4EKUA 3QCAA 2M4NA 3AV8A 4A90A 4E3CA 3RNFC 4HCNB 2Q5WD 1TT5B 4HDQA 3A33B 3RNBC 4G3XB 3AU5A 3QA8A 2DENB 1TS3A 1CMXB 3R66C 3NOBA 1TS5A 3MC0B 1XCTL 3SFDB 3KYCD 4HROA 2DLBA 2IO1B 1R4NI 3JSVA 4LNNA 3AE3B 4MGKE 4W9KA 2LEKA 4WH4A 3P42A 3VRAB 3EFUA 1FIQA 1XLQA 2MHJA 3AEDB 5GXGB 5G5GA 3B2FA 2GLSA 3DBRI 3AE9B 2FIDA 2IYDB 4C4VA 4KZCA 3ZVVA 2DBYA 3UQAA 4YSZB 3RMKC 4II2B 1WIAA 3T3OA 4HDOA 3RT3B 2R2QA 2J7QB 3OAWA 1FXAA 4AS1A 1YQ3B 1F1HA 1WXMA 4WJQA 3KWVA 1TS4A 1T6BX 2J4XA 4YXDB 1FO4A 2LUEA 2MX2A 2DZKA 1P7EA 1V86A 2G45B 2Y5BB 3FKYA 1WR6E 2J53A 4NNJB 4BOZB 4HJKA 5L83A 2BWES 4BKSA 1WY8A 4HKQA 5HG2A 1V81A 4A3OA 2WWZA 4MSMB 1J0GA 1GC6A 1K52A 2JZ3B 2L8JA 4GGQA 4L23A 3ZJTA 4EUTA 4FBJB 2WX0A 5H8YE 1V49A 2K22A 2C7HA 3AULA 3JSVB 1IPGA 4GDKB 3ONSA 2IGGA 3N30A 4ARCA 3U2SC 4KIKB 2A5UA 5AZHA 3IFWB 3Q3OC 2GB1A 3AI5A 2JQRB 3DVGX 2W54A 2ZEQA 4RF1A 3DDCB 2JU6X 4IW0A 1D5ZC 5BYRA 2QJLA 1A70A 4I6PA 3ZRCA 1D6EC 4RMAA 2MP2A 3P4RB 1KM7A 1UWMA 5EE9A 4FADA 2KC1A 1QKZA 1D5MC 2EMTA 2KDEB 1M94A 4ITKA 2MJEA 2M17A 2INCC 2LGIA 3WIMA 1WXVA 2N4FA 3AU4A 3AE1B 1Q1OA 2IY1B 1ZPSA 1FFVA 2K8BA 1QILA 3KUDB 1V6EA 2D2QA 1TGZB 4WJPA 3VXWA 3W2DA 3GB1A 2D5GA 3Q8FA 4PT5A 1V8CA 1XCQL 4JE3B 3ZXRA 4B0MA 2VH2A 3ZYYX 2WU2B 1LO5D 1C79A 2H88B 2KDIA 2WQYB 3W1SC 4KDIC 1SBBB 1L4ZB 1E9MA 4KV2A 3AEGB 2KFKA 1WJ6A 2BKFA 3DOWA 2O2VB 1EM7A 3APDA 2D3AA 3E56A 3CMMB 1L4DB 3RYTA 3AXCA 1K8RB 3NS1A 3E9SA 3R3MA 2FIFA 1WGGA 3OLMD 3TUOA 1E10A 2D3BA 2BPSA 3T3NA 1EO6A 1F77A 2KJRA 2ASQA 2YLMA 1WMHB 4KSKC 1FEHA 5IOIA 2JSVX 2RGFA 1SEBD 2LGDA 4ICUA 1V1OA 3B08A 4MDKE 1WGHA 1D4BA 1C4PA 1P1AA 3EFCA 4FLHA 3TMPB 2MH7A 2NPTB 1GB4A 1YOVB 2KNBA 1E5WA 4JGHB 3TCAA 3N32A 3UQBA 3AEFB 5TR5A 2VZKB 2J52A 4G50A 4M8NA 1N5XA 4C80A 4O1NA 1E8WA 3BY4B 3RNCC 4LNKA 2LXAA 3IHPC 3UGBB 3I63C 2B76B 1A5RA 4IWPA 3DVNV 2FBWB 4ZOHC 1IUEA 2WX1A 1LXDA 3NJTA 5MPOA 2GBKA 2QCZA 5CHWA 3LXFA 1E0ZA 2PEAA 4GN1A 1JRUA 3T9LA 3DBRB 2JRHA 1N62A 2KX3A 2WS3B 3OJ3A 4LCDE 2KAJA 2KWCA 4USAA 1SSNA 4ICVA 2LHEA 1P3QU 2ZNVB 4F7ZA 4DHJD 1F9JA 3DBLI 1SJED 3ALBA 1NI3A 3KUCB 4K7SA 4NPNA 2IBIB 1P98A 1P7FA 1S3SG 4RFBA 4C7ZA 3BK2A 1LM8B 4W9GA 2ZJDA 2IGDA 4US8A 4GLSC 4KIKA 5D2MB 2KFJA 1HQRD 2GBJA 2DAJA 4DK5A 4TQ0A 3L13A 2FE8A 4WAAA 3FILA 1WX7A 1NYQA 2C7MB 5KHOA 4EZKA 3H7PA 1Z2MA 1GPXA 2L76A 2JZZA 4GSWA 4IUMB 4IOIE 2M0XA 3PZ8A 1SE3A 3AECB 1WJNA 2KANA 2GBMA 2X8XX 4AJYB 1KJTA 2PVOD 3OWEB 4I6NB 1ET6A 1RFAA 3AN1A 5AZFA 2L7RA 2KD0A 1JCKB 2INNE 3U4EG 1YNTE 3B1LX 3HVDA 3Q8AA 4DHZB 5EE1A 4WJNA 1TYGB 1WSPA 5TSSA 1WJUA 3PLVA 1TZOA 2JYEA 2CKHB 1IBXA 3SEBA 2KWDA 3PSEB 5IN7A 4LJPB 3GZNI 2BBCA 2QEJC 4JQWC 4M0WA 1FNUA 4ANXA 1JWBD 1T0RC 4BZAA 4R3DA 2XK5B 5GMVA 3R8BA 3ZLZA 2XN9C 2V1YA 4PS8A 2BB5A 2I2YA 1WM3A 3LYYA 2IY0B 3URYA 1UD7A 1QOBA 5JH5C 1SB3C 1KLGD 2CHZA 2AEHA 4OHJA 5BMHA 2N1WA 2FUG1 3ML9A 1I4PA 2V3NA 2WDRB 3T8MA 2SEBD 4GB9A 4HXDA 2J0KA 4P1CC 2LGYA 1N61A 1C78A 2DZJA 4RCOA 4WJOA 2KWUB 4RF0A 1FXIA 2EELA 3PRPB 1EU3A 3N20C 2MQJA 2N1VA 1L7YA 3TEYA 1OEYJ 4DXAB 2O6VA 2MSED 4XX5A 4EOYA 3TEZA 3MHSD 1ESFA 5KHQA 2GBRA 3ML8A 4PYUA 3HIZA 3NZ3A 2ZZPB 2HJ8A 5D7GA 4AWJA 3PREA 1E8XA 1F0ZA 2M19A 4PS7A 1TY2A 3Q3FA 2MCNB 1QQRA 2LJIA 2DWQA 1EWCA 3SD5A 1ZGUB 2ZNVC 1WI0A 1WX9A 4P1BC 4G0NB 2IDYA 4WWPA 4M02A 2N7EA 5HKHA 2JVCA 3KWLA 1KF6B 2IO3B 1DOIA 4PYZA 2KO3A 4DDGD 1BUIC 1L2NA 1JWMD 2OJWA 3KYDD 3BINA 4C56C 1JROA 1XF5L 3NVWA 4W9IA 2LVPA 2BS2B 2LWPA 4BKSD 2R61A 1B1ZA 1PDXA 4B0EA 1UZXB 3V61A 3M3JA 2Z8LA 4ZRQA 1E8YA 4NAMA 4B9KA 1JWUD 4II3B 1X1MA 5E6OA 1WGYA 2AYOB 4FHKA 4RGOS 4RM9A 5J18A 3ZXVA 1V1PB 1I4XA 1JW9D 1NEKB 3QK0A 3NUHB 3P2BA 2G9HD 3N3KB 3CWIA 4OVZA 1WE6A 3VUYA 2NBWB 3AE5B 1GNUA 3MTNB 4QAYA 4TUUA 3W1YA 1N6ZA 1E6EB 2KKCA 1ZKHA 2MBHA 4M00A 4HK2A 3VVWB 2WHIA 1HA5A 3WANA 4A9AA 2ONQA 5LXHA 1AN8A 3L10B 2BF8B 1IGCA 2KYWA 5T8IA 4NQKE 2KVZA 4EZLA 3EUB2 4XDDA 1WMHA 2Z0EB 1ZXIA 2K8HA 5E6NA 3RN9C 4WQOB 3EA6A 3X23A 4HPMB 1VDVA 3ENEA 1TIFA 2KQ7A 1DGJA 3M95A 4LTUA 1OQQA 3MJWA 1WF9A 3PLUA 2QDFA 4MM3A 2FUHB 4JL9A 4ZHOA 1XXGA 2LFIA 2WXMA 2AWTA 1GG3A 3P63A 4BBNF 2AQ2B 3VRBB 1F2RC 1TY0A 3K9PB 2BS4B 5BMGA 3BK1A 3DVGY 3B2GA 3NG0A 4EEWA 5JZEB 2H89B 4WAFA 4RGTA 1FFUA 1AYFA 1RAXA 1L0XB 2HE7A 1ZDXA 2I1KA 2KACA 4MH0E 2CU3A 1QT9A 3PO0A 1WGRA 3LB8C 1WYGA 3DPDA 4BBNC 2RDGA 3AEBB 2I1JA 2WDQB 2W55A 3LJ3A 2WYQA 1NVID 2KDMA 3ZO5B 1HTQA 4TMAB 4MM3B 1C4CA 2BB6A 3GZNB 4WURA 2KN5A 3NY5A 2MJDA 1YJJA 4OZBA 1PGBA 3A9JA 3NZUA 5D3IB 1FNWA 1C77A 1NYRA 1WXAA 4JPSA 2BS3B 2PKOA 3WAMA 1I4RA 1LGRA 1P9DU 1ZOYB 2WXFA 2ZCBA 2LGSA 2RMMA 3ZDTA 1C3TA 1FRDA 1KTKA 3ZNHB 2L1AA 3AEAB 2KLGA 1UH6A 4ZRIA 1VCBA 5C2TB 4ZDVA 1T5XD 3AM9A 5CHFA 4BFRA 1G6JA 4L1BA 3NS8A 3RCZA 3V05A 1PQSA 1V80A 4GXBA 2KX0A 3KUZA 3PVLA 3PT2B 2DZMA 5AUKA 3C19A 3QIJA 4A3PA 4MT5A 3RD2A 4TQ1A 3GS2A 2CJOA 1CZPA 4HCPB 5IA7A 3TBLD 1WWTA 1KOTA 2OJRA 1TZ1A 2Y5CA 3DBHB 3S2AA 4WIPA 1WRDB 4JX1C 1RLFA 1BT0A 5CX3A 3H8HA 1RFKA 3DWMA 4LNOA 2NS5A 1FXTB 3BYYB 2C7NB 3VUXA 5IO9A 3IVFA 1KLVA 1TKGA 1RM6C 1UBIA 4E74A 4REZA 2LASA 4WWMA 3UF8A 1L5PA 3WA0A 1UGJA 1WGDA 2KMCA 2JZPA 3OJ4B 2XK5A 1SJHD 2IPKD 3ABVB 2G4DB 3A4RA 5DCNA 2J0JA 2CHWA 3PGEA 3P4QB 2KXJA 3PZ7A 2L3ZA 4ACFA 4YTNB 4B95A 5D94A 3VUWA 2KWVB 3RPFC 3L0WB 1CQVA 3TEWA 5E6PA 1E7PB 2MA9B 2C9WB 2DAFA 3HRDD 1XT9B 1V2YA 2L0TA 1MHXA 1VJKA 2N7DA 2CR5A 2O2VA 4C00A 3U7ZA 2KQSA 3R2IA 4K7WA 1JWSD 1H4RA 3TEXA 4C7YA 4NZLB 2QIEB 3VAWA 2WP9B 1YN5A 2ZVNA 2LRWA 2BT6A 2KZRA 1FMAD 2NR2A 4S17A 2L52A 4W9FA 2PIAA 1ZXHA 2AX5A 5FKAC 1TKEA 4CHKA 2G1EA 3M62B 4S0RA 3A9KA 2FAZA 3TIXA 2W9NA 2ZVOA 2WDVB 3I3TB 1BMLC 2WU5B 4KKJA 3IBEA 3ZIMA 2PE6B 3QAQA 4BAXA 1GAQB 2REXA 3VR9B 1YIWA 3SDLC 1ROEA 3ZNGC 2OHFA 1RYJA 3QC8B 1VZ6A 2N9EB 1WXQA 1RRBA 1E7UA 1C9FA 4KGTA 1WM2A 4AUQC 1EF5A 1IYFA 4OVVA 3H7SA 1Q10A 2RSUA 3ZUNA 3N1XC 2JRIB 3A1QA 1C4AA 4HEA1 1WJ4A 2JY6A 2VH1A 3ECIA 2KHWB 1JWAD 1N60A 2KC2A 3DVNU 1C1YB 3UIOB 3GE3C 3DWGC 2IO2B 1WYWB 2LI5A 1HEZE 3QJZA 2IJ0A 2KVRA 1GOZA 1GUAB 4IC7B 4NQLB 3L4PA 3DHHC 2I38A 1J7AA 4XC2A 4YTPB 3MHZA 3JVZX 3RNAC 2KJHB 3DCGA 3APCA 1HTOA 2KLCA 4GMVA 2YVCA 5DPRA 3AE8B 5AUIA 3NVVA 2ZCCA 2K6QA 3NVYA 1E8ZA 2HDEA 1FM0D 3K9OB 1TKYA 1FCLA 3UI3A 2LD9A 2IGHA 2KOXA 4IG7B 3AE2B 3EGRA 1YQBA 4K81A 2FNJB 2DYMA 1Y8RC 1QZEA 4P16A 2WDTB 1AW7A 2WXOA 3GP7A 1V5OA 1ISNA 2QHOA 3PHXB 5EE0A 1JRPA 2PVGC 1E90A 3VDZA 3PRZA 2NBVB 3RZFA 4HLEA 5G5HA 3JYUA 2VRRB 5DPTA 1FCCC 3AE4B 3PTFC 2J0MA 1IBXB 4MGZE 1B9RA 3QQ8B 1ZUD2 4EE2A 3H1UA 1QOFA 2R2OA 1MG8A 3QARA 4GDLB 4LLGM 1GC7A 3IAM1 4GOCA 4KZ0A 1MJDA 2WXLA 2L05A 2G3QB 3AE7B 2ZW1A 3IT4B 2WGSA 2DZIA 4EFOA 5LNK1 2BW2A 2B3AA 4LK0M 5FK9C 1YJ1A 2BYFA 4ANVA 2KK8A 4OZCA 3DQVA 3VR8B 2V3PA 3FC4A 3IXSA 2DHZA 5C1ZA 1ET9A 3MFGA 3DHIC 2GI9A 5JHBA 2BGFA 4DDID 2WXHA 2RR9A 3HM3A 2AQ1B 1BXTA 4XGAB 4P7IA 1XLNA 2NBUA 4XWWA 1J19A 3VTWA 2V9HA 2NMQA 5BMIA 1XQQA 3BVGA 4ZYSA 4YWGG 2CS4A 4YL8A 1ACCA 2FCQA 3FILB 3B0AA 2MBOA 5C23A 4K3CA 3WCQA 2XBBC 4FA6A 3B9JA 2J42A 1WE7A 2HD5B 5HHDG 2NVUI 2XNAC 3RI7C 4URKA 1T0YA 4FXCA 4LNIA 4KDLB 4PK1A 4JWSC 1J7CA 5IKCM 1I7HA 2HTME 4A8XC 1QF6A 3V6EB 1VZ8A 1QLBB 1R4MB 1KRHA 3RULA 5CTRC 4C4VB 1KH0A 3X0WA 1FPYA 2RDHA 1WR1A 4OVUA 4J6IA 2QMTA 2PMVA 4NAWA 1WZ0A 2HTHA 2KMMA 2M56B 4N6EB 3RNGC 3UIPB 4W9LA 1MFWA 3I5JC 2LUMA 4F1SA 3ZQ4A 4LJOB 4RH6A 1MG4A 2JX5A 3KW5B 5FR6A 1SIJA 2MBEA 4MSQB 3PZDA 4HPPA 1EWYC 1I4HA 2D3GA 4YT0B 4ZRPA 2JF5A 3QHTA 5AEKB 2MBQA 3Q14C 1UWXA 4NJ6A 2M1MA 1SE4A 3GOEA 4NAWB 3W9CB 4D2KA 3NVZA 2K8CA 2MP2B 4UDUC 4ASWC 1ZW7A 3L16A 3NZSA 2RPQA 2YEPF 1MI0A 5IAAC 2XEWA 4IWOA 3VFKA 5DPWA 4LDTB 3D32A 4HWIB 2N7JA 3AB5A 5J2RA 1L0VB 2RD0A 2LGXA 4XYCA 3A1QB 2L0FA 2W3SA 1N63A 3ZGZA 1DYQA 2AL3A 2KJ6A 3DHGC 4N59A 1MVKA 1SIFA 5BO4B 3NHEB 5G55A 2KQ4X 1QOGA 4KX6B 1SE2A 3W5VB 3CF6E 2PE9A 3MC9A 2RPVA 4RGNA 3U30A 1C76A 3HHMA 5AZGA 2V3SA 2DNFA 2AL6A 2KDBA 2LMCA 3NRZA 4XDCA 3CSTA 4RGMA 2WXKA 5EDSA 1UGMA 1UF0A 2LZ6A 3P4SB 4CYEA 1H8CA 3VH4B 2LRUA 2O6VB 4NY0A 4MGIE 1ENFA 1TS2A 1YN3A 3RFZB 1EF1A 2PTLA 1VD2A 2YEPB 2W82A 4FJVB 1YQ4B 4KGSA 2GMIC 4DXGA 4A55A 2V4LA 4BKTA 3LDZE 2ZPYA 3R7RA 2E3TA 3V60A 4A6QA 1ZP0B 4IKGA 1V1PA 3Q8BA 4AP4C 1I42A 3AEEB 1CJEA 4I6LB 1DOXA 1GB1A 3TL5A 4MGYE 1ZE3D 2MJ3A 4GDKA 4BKGA 1NENB 1MPEA 2JWZA 3VH3B 3C8YA 3U8ZA 2KTFA 2MLBA 2WLBA 1HZ6A 4MELA 2N0SB 4BVUC 4TV3A 2WXQA 5CHVC 2K3UA 3WAOA 1XLOA 3SFEB 4MH8A 2K25A 1V97A 4WWNA 2KTRA 5J17A 3VQIA 3VTVA 2M0AA 4K1RB 2GRIA 2BVCA 2ZW0A 4Q2JA 1YMHE 3HUIA 2GOWA 3TSSA 1NDDA 4B6WA 4IWQA 1VR9A 2QILA 2JYTA 4AQ7A 4X57B 4CQNA 1PUTA 1I35A 4E71A 3N1ZC 1YJIA 4DHJB 1SF0A 4KGRA 1OFFA 3PRMB 2N9KA 1D5XC 3N1YC 5D3DA 4AJWA 2WXRA 3MJ5A 2N9PC 1YX6B 2ACZB 2DYBA 2AQ3B 2M8SA 2D07B 2JXTA 3APFA 2UWQA 3PPAA 1STEA 3Q3JA 4M01A 4HPLB 4DXFA 3AMZA 3H6NA 4KKIA 1T3QA 1L6VA 1RWSA 4HKZE 2EKIA 2KN4A 4TSSA 1TTNA 2PW9A 3CIRB 1JMLA 4MEMA 1V9JA 1FRRA 1VRAB 4J3OD 4OZAA 1HZ5A 2EKEC 2N9XA 4M8MA 3JW0X 2PPHA 3J9CA 2K0PA 3VHTC 2E6XA 1E7VA 1UNSA 5E6JA 1SXTA 4W9CA 5I4DA 3ZNID 5H92C 3BWUD 1JALA 3Q8EA 4MJSA 2K9XA 3A9JB 4ZRJA 5LLIA 4ANWA 1T0QC 3Q3NC 4RNAA 2GBNA 2WNMA 2MBBB 1WRIA 2X38A 4GIVA 4HJGE 3ZRFA 4P6VF 1OTRB 3P1MA 4FHJA 4M0WB 3ZJVA 4G11A 2WXIA 3Q8CA 3L17A 2KDFB 2K1FA 2DYOA 2O6VD 2FCNA 1VZ7A 4US9A 3ZTCA 2QC8A 5DPSA 2INPE 4ZHPA 2JUOA 2WXGA 2D10A 1PGXA 4GU2A 3BVMA 4L2YA 2LJ5A 1S1QB 4IM0A 2LVOA 1CK1A 1SGHA 4IM3A 2VZKD 3HVZA 2MW5A 2L32A 1PYWD 4CO7A 4K3BA 2Y5PA 1DOYA 4WWOA 3RUIB 1WFYA 4MACA 2BYTA 4DHZE 4YSXB 4IDIA 3BYTB 2K6DB 1XO3A 3Q69A 2L00B 2JXXA 5HFYA 2LHDA 3R7QA 4N58A 3L54A 2DX5B 4FN2A 1OQRA 4HRSA 2BTEA 1I4QA 2FCMA 1XEEA 4NJCA 3U7DA 3KVFB 1K51A 4MJSB 1KLUD 2V4IB 4LNFA 4TKNA 4GDLA 1EUVB 1OQYA 3H9DA 4LDTD 5LXIB 1XLPA 5JHAA 1D3ZA 2KMAA 1OGWA 3GE8C 4JIOU 2A4ZA 4AOFA 2ZPNA 4BOSC 3UINB 1FD6A 1IGDA 2IO0B 1L6UA 4FJZA 4JLCA 3U52E 1U4AA 2BYEA 3H7PB 3VTUA 3RNEC 1LQBA 3ETRA 2KTRB 4FULA 2C60A 2PLPA 1IP9A 5BYSA 1SE9A 3V62A 3ZKJC 4DBGA 1R7SA 4OW0A 1TJEA 3M63B 1LFDA 4YSYB 4WQMA 1WGKA 1UUPA 1K50A 2NTTA 2CJNA 1P0RA 2NPTA 4W9HA 1R4NB 3SR6A 2HJ1A 3ZJUA 1Q0WB 2KT7A 4KSLC 2QSDA 5IP4D 1V5TA 4W9DA 3W1SA 1M4VA 2D3CA 4FJYA 1KFYB 3PS6A 1NI2A 1J7BA 3KLSX 2ON8A 2BWFA 3I57A 3HM6X 1PGAA 3C0RB 2BYVE 1K53A 1WH3A 4KVGB 1GJZA 1AARA 4RM8A 1TBEA 5JXVA 4IM2A 2G4SA 3DBSA 2Z0DB 3BVZA 1EU4A 1Y56A 2K39A 4ZRKA 3AE6B 3BIID 4DQOC 4F8CB 3Q6BA 3R2TA 4JWUC 2NCNA 3EHVA 2UU7A 2MRPA 1I4GA 1YD8U 1YX5B 1R4MI 2KFKB 2WXJA 2ICIA 2W3RA 2BKRB 3OG5A 3Q2AC 3QWZB 4YTMB 4W9JA 3KH0A 3IG3A 2MEKA 3IT6B 2PJHA 1N5WA 4W9EA 3V6CB 5BYQA 4ZYNA 4K7UA 1WXSA 3PV1A 4N9F4 1MHHE 4XWTA 1WZ3A 5FR3A 2IZVB 1L0YB 2JWUA 2L83A 3WAPA 3L08A 3O65B 4ANUA 2LVQA 3FAHA 1JQ4A 3ZDMC 1QOAA 1HXYD 3ZNZB 4XE0A 2OEDA 3DBHI 1VLBA 1ZDVA 4NJ7A 3KQ4A 2EMSA 2JT4B 1F52A 5HI1A 5C3JB 1NBFC 3EC8A 3A4SC 3I9V1 3QX1A 4PS3A 3W5UB 1PFDA 2D11A 3ZW3A 3N9YC 3HK0A 3SU8X 1UELA 1UBQA 2FCSA 3IAS1 3P4PB 3CSFA 2TSSA 1OEYA 1Z5SB 3TJPA 2WXPA 1J8CA 3DBLB
chains in the Genus database with same CATH topology
1FMAD 4A6QA 1JCKB 2INNE 2E3TA 1ZP0B 2SAKA 3U4EG 3AH7A 2L52A 1YNTE 4IKGA 3HVDA 3Q8AA 1V1PA 2PIAA 3Q8BA 5EE1A 3AEEB 1CJEA 1ZXHA 3MP9A 2N9LA 1DOXA 1TYGB 1WSPA 2AX5A 5FKAC 5TSSA 1TKEA 1GB1A 1TZOA 2G1EA 2JYEA 2NTSA 4H2AA 1ZE3D 1IBXA 2MJ3A 3SEBA 2KWDA 1NENB 2BBCA 2QEJC 2WXNA 2WDVB 2Y3AA 5EE3A 1BMLC 2WU5B 1MPEA 4KKJA 4M0WA 1GAQB 3C8YA 1FNUA 1JWBD 2WLBA 3VR9B 1HZ6A 1ROEA 4R3DA 2N0SB 2OHFA 3BZDB 1RYJA 2WXQA 3R8BA 2K3UA 1VZ6A 1FNVA 1WXQA 2K5PA 1XLOA 2XN9C 3SFEB 1C9FA 4MH8A 4KGTA 2BB5A 1V97A 2I2YA 3LYYA 1F2RI 1AWDA 3VQIA 1YN4A 2M0AA 3URYA 1Q10A 2GRIA 2ZW0A 1QOBA 4Q2JA 1YMHE 3HUIA 3TSSA 1SB3C 1KLGD 1VR9A 3V3XA 2V0GA 2QILA 2JYTA 4ARIA 1C4AA 4AQ7A 4HEA1 3O13A 4CQNA 1PUTA 4OHJA 3AV8A 5BMHA 1YJIA 1JWAD 1N60A 1SF0A 4KGRA 4A90A 2FUG1 1I4PA 2V3NA 1OFFA 2WDRB 2N9KA 1D5XC 5D3DA 2SEBD 2Q5WD 3DWGC 2WXRA 3MJ5A 2ACZB 1N61A 1C78A 2AQ3B 1HEZE 4RCOA 1TS3A 2JXTA 4RF0A 1FXIA 2EELA 1EU3A 2IJ0A 1STEA 1TS5A 3MC0B 1XCTL 3SFDB 4DXFA 3AMZA 4KKIA 1T3QA 1GOZA 4HROA 3TEYA 3L4PA 1L6VA 1RWSA 4HKZE 2I38A 1J7AA 3TEZA 1ESFA 4YTPB 3MHZA 2DLBA 2EKIA 2KN4A 4TSSA 2PW9A 3NZ3A 3AE3B 3CIRB 5D7GA 2LEKA 1JMLA 4WH4A 3P42A 3VRAB 1FRRA 1F0ZA 1VRAB 3AE8B 4J3OD 5AUIA 2M19A 1FIQA 1XLQA 3NVVA 1TY2A 4OZAA 1QQRA 2LJIA 1HZ5A 2DWQA 3AEDB 1EWCA 3J9CA 5GXGB 3NVYA 2K0PA 2E6XA 1UNSA 2HDEA 1FM0D 5G5GA 2IDYA 3B2FA 5E6JA 1SXTA 5I4DA 1TKYA 5H92C 3AE9B 3BWUD 1JALA 2DBYA 3Q8EA 1FCLA 3KWLA 1KF6B 3UI3A 2IGHA 1DOIA 2K9XA 4YSZB 3AE2B 1BUIC 3EGRA 4RNAA 1JWMD 2DYMA 2WNMA 3T3OA 4P16A 4C56C 1JROA 1XF5L 1WRIA 2X38A 3NVWA 4HJGE 1FXAA 1AW7A 1YQ3B 2BS2B 2WXOA 4P6VF 2R61A 3GP7A 4AS1A 1B1ZA 3P1MA 1PDXA 3KWVA 1TS4A 4B0EA 1T6BX 2J4XA 3ZJVA 4YXDB 2WXIA 1FO4A 3Q8CA 2Z8LA 5EE0A 4ZRQA 1JRPA 1P7EA 2PVGC 2DYOA 4NAMA 1JWUD 1VZ7A 4US9A 2J53A 2INPE 4ZHPA 2WXGA 5G5HA 4RGOS 1PGXA 3BVMA 4L2YA 1V1PB 1I4XA 1FCCC 1JW9D 1NEKB 3AE4B 5HG2A 4HKQA 1IBXB 1CK1A 1K52A 2VZKD 3NUHB 3HVZA 2L32A 1B9RA 1PYWD 4L23A 3ZJTA 1ZUD2 2Y5PA 4EE2A 1DOYA 1QOFA 2G9HD 5H8YE 4MACA 2K22A 4GDLB 4LLGM 2BYTA 3CWIA 3IAM1 4YSXB 4IDIA 4OVZA 2WXLA 3BYTB 4GDKB 2IGGA 3AE7B 2ZW1A 1XO3A 3IT4B 3AE5B 3Q69A 5HFYA 5LNK1 2BW2A 2LHDA 1E6EB 4ARCA 3U2SC 4LK0M 4N58A 5FK9C 1HA5A 4A9AA 2ONQA 1OQRA 1AN8A 4HRSA 4OZCA 2BTEA 1IGCA 2GB1A 1I4QA 2JQRB 3VR8B 2W54A 2V3PA 1XEEA 4NJCA 3FC4A 3IXSA 1K51A 4RF1A 1ET9A 3MFGA 1KLUD 2GI9A 5T8IA 2JU6X 2V4IB 1D5ZC 5BYRA 2QJLA 2WXHA 1A70A 1D6EC 3EUB2 4XDDA 3P4RB 1UWMA 5EE9A 1ZXIA 1QKZA 2AQ1B 1XLPA 1D5MC 1BXTA 3EA6A 4ITKA 1VDVA 1XLNA 2MJEA 4XWWA 2LGIA 4LTUA 1DGJA 1OQQA 3AE1B 1ZPSA 1FFVA 2NMQA 3BVGA 5BMIA 1QILA 4ZHOA 1FD6A 1XXGA 4ZYSA 1IGDA 2LFIA 2WXMA 4YWGG 3P63A 1L6UA 2AQ2B 1ACCA 3U52E 3VRBB 1F2RC 1TY0A 3W2DA 3GB1A 2BS4B 5BMGA 2D5GA 3BK1A 3Q8FA 3ETRA 3FILB 4PT5A 1V8CA 1XCQL 4JE3B 4B0MA 2PLPA 3B2GA 5BYSA 2H89B 4WAFA 3ZYYX 3WCQA 4RGTA 1FFUA 2WU2B 1LO5D 1AYFA 1R7SA 1C79A 2H88B 1L0XB 2WQYB 1TJEA 3B9JA 4OW0A 2J42A 1ZDXA 2KACA 1SBBB 1L4ZB 1QT9A 2CU3A 3LB8C 3PO0A 4YSYB 5HHDG 2XNAC 1E9MA 1WYGA 4WQMA 3AEGB 2RDGA 1WGKA 3AEBB 1UUPA 2WDQB 2W55A 4FXCA 1K50A 2NTTA 1NVID 2CJNA 4JWSC 2KDMA 1J7CA 1EM7A 1I7HA 3E56A 2HTME 4TMAB 4MM3B 4A8XC 1QF6A 1C4CA 1L4DB 1VZ8A 2BB6A 1QLBB 3NS1A 3E9SA 1KRHA 4WURA 3SR6A 3ZJUA 1KH0A 3TUOA 2QSDA 2MJDA 1E10A 1YJJA 4OZBA 2RDHA 1PGBA 3W1SA 1M4VA 2QMTA 5D3IB 1FNWA 1KFYB 3T3NA 1C77A 2PMVA 1NYRA 1F77A 1J7BA 3KLSX 4JPSA 2BS3B 2KMMA 2ON8A 1FEHA 2M56B 4N6EB 2JSVX 2PKOA 3I57A 1SEBD 1V1OA 1I4RA 1D4BA 1PGAA 2LUMA 1C4PA 1ZOYB 1K53A 2WXFA 3ZQ4A 2MH7A 1GB4A 4RH6A 2JX5A 2RMMA 1FRDA 1KTKA 5JXVA 2L1AA 3AEAB 1SIJA 5C2TB 3AEFB 1T5XD 3AM9A 3BVZA 1EU4A 4L1BA 2VZKB 2J52A 3V05A 1EWYC 1I4HA 4YT0B 4ZRPA 1N5XA 4C80A 4O1NA 1Y56A 1UWXA 5AUKA 3AE6B 3BIID 4DQOC 4NAWB 1SE4A 3R2TA 3W9CB 4JWUC 4D2KA 3NVZA 4MT5A 4UDUC 2B76B 4TQ1A 3GS2A 1I4GA 2CJOA 1CZPA 2FBWB 4ZOHC 1IUEA 1WWTA 2WXJA 2ICIA 2W3RA 4YTMB 2YEPF 2Y5CA 1MI0A 4WIPA 2MEKA 3IT6B 5MPOA 4JX1C 1N5WA 3LXFA 1E0ZA 2N7JA 3AB5A 5BYQA 1L0VB 3H8HA 1RFKA 3DWMA 3ZGZA 2W3SA 3BYYB 1N63A 1N62A 2WS3B 1DYQA 2KAJA 4N59A 1MVKA 1TKGA 1SSNA 4USAA 1MHHE 1RM6C 4XWTA 2LHEA 5FR3A 2JWUA 1L0YB 2KQ4X 1QOGA 2L83A 4KX6B 4REZA 1SJED 4WWMA 1NI3A 3FAHA 1SE2A 1L5PA 3W5VB 1P7FA 4RFBA 2RPVA 1UGJA 4C7ZA 4RGNA 3BK2A 1JQ4A 1QOAA 1HXYD 2JZPA 1C76A 4XE0A 2OEDA 2IGDA 4US8A 1SJHD 2IPKD 3ABVB 4GLSC 1VLBA 1ZDVA 1HQRD 2LMCA 3NRZA 3P4QB 3PZ7A 3KQ4A 4XDCA 4TQ0A 4YTNB 2FE8A 3FILA 5HI1A 3RPFC 1NYQA 4RGMA 5C3JB 1CQVA 2WXKA 3TEWA 3I9V1 1E7PB 1GPXA 3P4SB 3W5UB 1PFDA 3HRDD 3N9YC 4IOIE 1MHXA 1VJKA 3PZ8A 1ENFA 1SE3A 3U7ZA 3R2IA 3AECB 1TS2A 1JWSD 1YN3A 3IAS1 3P4PB 3TEXA 3RFZB 2PTLA 4C7YA 2TSSA 4NZLB 2YEPB 2W82A 2PVOD 2QIEB 1YQ4B 3OWEB 4KGSA 2WP9B 1ET6A 1YN5A 2WXPA 4DXGA 3AN1A 4A55A 2BT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWX A;  4OZA A;  4IKG A;  1YNT E;  1HZ5 A;  2LGI A;  4D2K A;  1ZXH A;  2K0P A;  2N9L A;  3MP9 A;  1GB1 A;  2NMQ A;  5BMI A;  1IBX A;  2KWD A;  1FD6 A;  1FCL A;  3UI3 A;  1IGD A;  2IGH A;  1MI0 A;  1MPE A;  1F2R C;  3GB1 A;  5BMG A;  3FIL B;  1HZ6 A;  1XCQ L;  2PLP A;  1XF5 L;  2N7J A;  4HJG E;  1C9F A;  4KGT A;  1MVK A;  2KAC A;  1MHH E;  2I2Y A;  2LHE A;  1F2R I;  1P7E A;  2JWU A;  2KQ4 X;  5HHD G;  1K50 A;  1Q10 A;  2J53 A;  2ZW0 A;  1YMH E;  1PGX A;  1P7F A;  2KDM A;  1EM7 A;  2RPV A;  1FCC C;  3V3X A;  5HG2 A;  2JZP A;  1IBX B;  1K52 A;  2OED A;  2IGD A;  4GLS C;  5BMH A;  1KH0 A;  4KGR A;  2QSD A;  4MAC A;  4OZB A;  2N9K A;  1PGB A;  2QMT A;  2IGG A;  2ZW1 A;  5HFY A;  3FIL A;  5HI1 A;  1HEZ E;  2LHD A;  2ON8 A;  2JXT A;  2JSV X;  2EEL A;  1XCT L;  1D4B A;  1PGA A;  2ONQ A;  2LUM A;  4OZC A;  1K53 A;  1IGC A;  2GB1 A;  4IOI E;  1MHX A;  1GB4 A;  4HKZ E;  2RMM A;  2I38 A;  1K51 A;  5JXV A;  2GI9 A;  2KN4 A;  2JU6 X;  2PTL A;  2PW9 A;  2J52 A;  4KGS A;  1JML A;  4WH4 A;  1QKZ A; 
#chains in the Genus database with same CATH topology
 1Q5W B;  2SAK A;  3AH7 A;  2Z59 B;  4XZ4 A;  3MP9 A;  2N9L A;  1HE8 A;  5L95 C;  3PHW B;  4H2A A;  2NTS A;  5D6J B;  2WXN A;  2C5L C;  2Y3A A;  2BQQ A;  3A9K B;  5EE3 A;  3WAL A;  4A20 A;  2UYZ B;  4HVB A;  5G2N A;  1WX8 A;  2LXC A;  3ZTD A;  2MWS B;  3BZD B;  3EEC A;  1XD3 B;  2OOB B;  1FNV A;  2K5P A;  1T0S C;  2CU1 A;  1F2R I;  1AWD A;  3Q3M C;  4DWF A;  1YN4 A;  2JPH A;  3MC8 A;  2RDB C;  3SHQ A;  2CHX A;  3V3X A;  2V0G A;  4EZJ A;  4ARI A;  3RZW C;  3O13 A;  2IND C;  4EKU A;  3QCA A;  2M4N A;  3AV8 A;  4A90 A;  4E3C A;  3RNF C;  4HCN B;  2Q5W D;  1TT5 B;  4HDQ A;  3A33 B;  3RNB C;  4G3X B;  3AU5 A;  3QA8 A;  2DEN B;  1TS3 A;  1CMX B;  3R66 C;  3NOB A;  1TS5 A;  3MC0 B;  1XCT L;  3SFD B;  3KYC D;  4HRO A;  2DLB A;  2IO1 B;  1R4N I;  3JSV A;  4LNN A;  3AE3 B;  4MGK E;  4W9K A;  2LEK A;  4WH4 A;  3P42 A;  3VRA B;  3EFU A;  1FIQ A;  1XLQ A;  2MHJ A;  3AED B;  5GXG B;  5G5G A;  3B2F A;  2GLS A;  3DBR I;  3AE9 B;  2FID A;  2IYD B;  4C4V A;  4KZC A;  3ZVV A;  2DBY A;  3UQA A;  4YSZ B;  3RMK C;  4II2 B;  1WIA A;  3T3O A;  4HDO A;  3RT3 B;  2R2Q A;  2J7Q B;  3OAW A;  1FXA A;  4AS1 A;  1YQ3 B;  1F1H A;  1WXM A;  4WJQ A;  3KWV A;  1TS4 A;  1T6B X;  2J4X A;  4YXD B;  1FO4 A;  2LUE A;  2MX2 A;  2DZK A;  1P7E A;  1V86 A;  2G45 B;  2Y5B B;  3FKY A;  1WR6 E;  2J53 A;  4NNJ B;  4BOZ B;  4HJK A;  5L83 A;  2BWE S;  4BKS A;  1WY8 A;  4HKQ A;  5HG2 A;  1V81 A;  4A3O A;  2WWZ A;  4MSM B;  1J0G A;  1GC6 A;  1K52 A;  2JZ3 B;  2L8J A;  4GGQ A;  4L23 A;  3ZJT A;  4EUT A;  4FBJ B;  2WX0 A;  5H8Y E;  1V49 A;  2K22 A;  2C7H A;  3AUL A;  3JSV B;  1IPG A;  4GDK B;  3ONS A;  2IGG A;  3N30 A;  4ARC A;  3U2S C;  4KIK B;  2A5U A;  5AZH A;  3IFW B;  3Q3O C;  2GB1 A;  3AI5 A;  2JQR B;  3DVG X;  2W54 A;  2ZEQ A;  4RF1 A;  3DDC B;  2JU6 X;  4IW0 A;  1D5Z C;  5BYR A;  2QJL A;  1A70 A;  4I6P A;  3ZRC A;  1D6E C;  4RMA A;  2MP2 A;  3P4R B;  1KM7 A;  1UWM A;  5EE9 A;  4FAD A;  2KC1 A;  1QKZ A;  1D5M C;  2EMT A;  2KDE B;  1M94 A;  4ITK A;  2MJE A;  2M17 A;  2INC C;  2LGI A;  3WIM A;  1WXV A;  2N4F A;  3AU4 A;  3AE1 B;  1Q1O A;  2IY1 B;  1ZPS A;  1FFV A;  2K8B A;  1QIL A;  3KUD B;  1V6E A;  2D2Q A;  1TGZ B;  4WJP A;  3VXW A;  3W2D A;  3GB1 A;  2D5G A;  3Q8F A;  4PT5 A;  1V8C A;  1XCQ L;  4JE3 B;  3ZXR A;  4B0M A;  2VH2 A;  3ZYY X;  2WU2 B;  1LO5 D;  1C79 A;  2H88 B;  2KDI A;  2WQY B;  3W1S C;  4KDI C;  1SBB B;  1L4Z B;  1E9M A;  4KV2 A;  3AEG B;  2KFK A;  1WJ6 A;  2BKF A;  3DOW A;  2O2V B;  1EM7 A;  3APD A;  2D3A A;  3E56 A;  3CMM B;  1L4D B;  3RYT A;  3AXC A;  1K8R B;  3NS1 A;  3E9S A;  3R3M A;  2FIF A;  1WGG A;  3OLM D;  3TUO A;  1E10 A;  2D3B A;  2BPS A;  3T3N A;  1EO6 A;  1F77 A;  2KJR A;  2ASQ A;  2YLM A;  1WMH B;  4KSK C;  1FEH A;  5IOI A;  2JSV X;  2RGF A;  1SEB D;  2LGD A;  4ICU A;  1V1O A;  3B08 A;  4MDK E;  1WGH A;  1D4B A;  1C4P A;  1P1A A;  3EFC A;  4FLH A;  3TMP B;  2MH7 A;  2NPT B;  1GB4 A;  1YOV B;  2KNB A;  1E5W A;  4JGH B;  3TCA A;  3N32 A;  3UQB A;  3AEF B;  5TR5 A;  2VZK B;  2J52 A;  4G50 A;  4M8N A;  1N5X A;  4C80 A;  4O1N A;  1E8W A;  3BY4 B;  3RNC C;  4LNK A;  2LXA A;  3IHP C;  3UGB B;  3I63 C;  2B76 B;  1A5R A;  4IWP A;  3DVN V;  2FBW B;  4ZOH C;  1IUE A;  2WX1 A;  1LXD A;  3NJT A;  5MPO A;  2GBK A;  2QCZ A;  5CHW A;  3LXF A;  1E0Z A;  2PEA A;  4GN1 A;  1JRU A;  3T9L A;  3DBR B;  2JRH A;  1N62 A;  2KX3 A;  2WS3 B;  3OJ3 A;  4LCD E;  2KAJ A;  2KWC A;  4USA A;  1SSN A;  4ICV A;  2LHE A;  1P3Q U;  2ZNV B;  4F7Z A;  4DHJ D;  1F9J A;  3DBL I;  1SJE D;  3ALB A;  1NI3 A;  3KUC B;  4K7S A;  4NPN A;  2IBI B;  1P98 A;  1P7F A;  1S3S G;  4RFB A;  4C7Z A;  3BK2 A;  1LM8 B;  4W9G A;  2ZJD A;  2IGD A;  4US8 A;  4GLS C;  4KIK A;  5D2M B;  2KFJ A;  1HQR D;  2GBJ A;  2DAJ A;  4DK5 A;  4TQ0 A;  3L13 A;  2FE8 A;  4WAA A;  3FIL A;  1WX7 A;  1NYQ A;  2C7M B;  5KHO A;  4EZK A;  3H7P A;  1Z2M A;  1GPX A;  2L76 A;  2JZZ A;  4GSW A;  4IUM B;  4IOI E;  2M0X A;  3PZ8 A;  1SE3 A;  3AEC B;  1WJN A;  2KAN A;  2GBM A;  2X8X X;  4AJY B;  1KJT A;  2PVO D;  3OWE B;  4I6N B;  1ET6 A;  1RFA A;  3AN1 A;  5AZF A;  2L7R A;  2KD0 A;  1JCK B;  2INN E;  3U4E G;  1YNT E;  3B1L X;  3HVD A;  3Q8A A;  4DHZ B;  5EE1 A;  4WJN A;  1TYG B;  1WSP A;  5TSS A;  1WJU A;  3PLV A;  1TZO A;  2JYE A;  2CKH B;  1IBX A;  3SEB A;  2KWD A;  3PSE B;  5IN7 A;  4LJP B;  3GZN I;  2BBC A;  2QEJ C;  4JQW C;  4M0W A;  1FNU A;  4ANX A;  1JWB D;  1T0R C;  4BZA A;  4R3D A;  2XK5 B;  5GMV A;  3R8B A;  3ZLZ A;  2XN9 C;  2V1Y A;  4PS8 A;  2BB5 A;  2I2Y A;  1WM3 A;  3LYY A;  2IY0 B;  3URY A;  1UD7 A;  1QOB A;  5JH5 C;  1SB3 C;  1KLG D;  2CHZ A;  2AEH A;  4OHJ A;  5BMH A;  2N1W A;  2FUG 1;  3ML9 A;  1I4P A;  2V3N A;  2WDR B;  3T8M A;  2SEB D;  4GB9 A;  4HXD A;  2J0K A;  4P1C C;  2LGY A;  1N61 A;  1C78 A;  2DZJ A;  4RCO A;  4WJO A;  2KWU B;  4RF0 A;  1FXI A;  2EEL A;  3PRP B;  1EU3 A;  3N20 C;  2MQJ A;  2N1V A;  1L7Y A;  3TEY A;  1OEY J;  4DXA B;  2O6V A;  2MSE D;  4XX5 A;  4EOY A;  3TEZ A;  3MHS D;  1ESF A;  5KHQ A;  2GBR A;  3ML8 A;  4PYU A;  3HIZ A;  3NZ3 A;  2ZZP B;  2HJ8 A;  5D7G A;  4AWJ A;  3PRE A;  1E8X A;  1F0Z A;  2M19 A;  4PS7 A;  1TY2 A;  3Q3F A;  2MCN B;  1QQR A;  2LJI A;  2DWQ A;  1EWC A;  3SD5 A;  1ZGU B;  2ZNV C;  1WI0 A;  1WX9 A;  4P1B C;  4G0N B;  2IDY A;  4WWP A;  4M02 A;  2N7E A;  5HKH A;  2JVC A;  3KWL A;  1KF6 B;  2IO3 B;  1DOI A;  4PYZ A;  2KO3 A;  4DDG D;  1BUI C;  1L2N A;  1JWM D;  2OJW A;  3KYD D;  3BIN A;  4C56 C;  1JRO A;  1XF5 L;  3NVW A;  4W9I A;  2LVP A;  2BS2 B;  2LWP A;  4BKS D;  2R61 A;  1B1Z A;  1PDX A;  4B0E A;  1UZX B;  3V61 A;  3M3J A;  2Z8L A;  4ZRQ A;  1E8Y A;  4NAM A;  4B9K A;  1JWU D;  4II3 B;  1X1M A;  5E6O A;  1WGY A;  2AYO B;  4FHK A;  4RGO S;  4RM9 A;  5J18 A;  3ZXV A;  1V1P B;  1I4X A;  1JW9 D;  1NEK B;  3QK0 A;  3NUH B;  3P2B A;  2G9H D;  3N3K B;  3CWI A;  4OVZ A;  1WE6 A;  3VUY A;  2NBW B;  3AE5 B;  1GNU A;  3MTN B;  4QAY A;  4TUU A;  3W1Y A;  1N6Z A;  1E6E B;  2KKC A;  1ZKH A;  2MBH A;  4M00 A;  4HK2 A;  3VVW B;  2WHI A;  1HA5 A;  3WAN A;  4A9A A;  2ONQ A;  5LXH A;  1AN8 A;  3L10 B;  2BF8 B;  1IGC A;  2KYW A;  5T8I A;  4NQK E;  2KVZ A;  4EZL A;  3EUB 2;  4XDD A;  1WMH A;  2Z0E B;  1ZXI A;  2K8H A;  5E6N A;  3RN9 C;  4WQO B;  3EA6 A;  3X23 A;  4HPM B;  1VDV A;  3ENE A;  1TIF A;  2KQ7 A;  1DGJ A;  3M95 A;  4LTU A;  1OQQ A;  3MJW A;  1WF9 A;  3PLU A;  2QDF A;  4MM3 A;  2FUH B;  4JL9 A;  4ZHO A;  1XXG A;  2LFI A;  2WXM A;  2AWT A;  1GG3 A;  3P63 A;  4BBN F;  2AQ2 B;  3VRB B;  1F2R C;  1TY0 A;  3K9P B;  2BS4 B;  5BMG A;  3BK1 A;  3DVG Y;  3B2G A;  3NG0 A;  4EEW A;  5JZE B;  2H89 B;  4WAF A;  4RGT A;  1FFU A;  1AYF A;  1RAX A;  1L0X B;  2HE7 A;  1ZDX A;  2I1K A;  2KAC A;  4MH0 E;  2CU3 A;  1QT9 A;  3PO0 A;  1WGR A;  3LB8 C;  1WYG A;  3DPD A;  4BBN C;  2RDG A;  3AEB B;  2I1J A;  2WDQ B;  2W55 A;  3LJ3 A;  2WYQ A;  1NVI D;  2KDM A;  3ZO5 B;  1HTQ A;  4TMA B;  4MM3 B;  1C4C A;  2BB6 A;  3GZN B;  4WUR A;  2KN5 A;  3NY5 A;  2MJD A;  1YJJ A;  4OZB A;  1PGB A;  3A9J A;  3NZU A;  5D3I B;  1FNW A;  1C77 A;  1NYR A;  1WXA A;  4JPS A;  2BS3 B;  2PKO A;  3WAM A;  1I4R A;  1LGR A;  1P9D U;  1ZOY B;  2WXF A;  2ZCB A;  2LGS A;  2RMM A;  3ZDT A;  1C3T A;  1FRD A;  1KTK A;  3ZNH B;  2L1A A;  3AEA B;  2KLG A;  1UH6 A;  4ZRI A;  1VCB A;  5C2T B;  4ZDV A;  1T5X D;  3AM9 A;  5CHF A;  4BFR A;  1G6J A;  4L1B A;  3NS8 A;  3RCZ A;  3V05 A;  1PQS A;  1V80 A;  4GXB A;  2KX0 A;  3KUZ A;  3PVL A;  3PT2 B;  2DZM A;  5AUK A;  3C19 A;  3QIJ A;  4A3P A;  4MT5 A;  3RD2 A;  4TQ1 A;  3GS2 A;  2CJO A;  1CZP A;  4HCP B;  5IA7 A;  3TBL D;  1WWT A;  1KOT A;  2OJR A;  1TZ1 A;  2Y5C A;  3DBH B;  3S2A A;  4WIP A;  1WRD B;  4JX1 C;  1RLF A;  1BT0 A;  5CX3 A;  3H8H A;  1RFK A;  3DWM A;  4LNO A;  2NS5 A;  1FXT B;  3BYY B;  2C7N B;  3VUX A;  5IO9 A;  3IVF A;  1KLV A;  1TKG A;  1RM6 C;  1UBI A;  4E74 A;  4REZ A;  2LAS A;  4WWM A;  3UF8 A;  1L5P A;  3WA0 A;  1UGJ A;  1WGD A;  2KMC A;  2JZP A;  3OJ4 B;  2XK5 A;  1SJH D;  2IPK D;  3ABV B;  2G4D B;  3A4R A;  5DCN A;  2J0J A;  2CHW A;  3PGE A;  3P4Q B;  2KXJ A;  3PZ7 A;  2L3Z A;  4ACF A;  4YTN B;  4B95 A;  5D94 A;  3VUW A;  2KWV B;  3RPF C;  3L0W B;  1CQV A;  3TEW A;  5E6P A;  1E7P B;  2MA9 B;  2C9W B;  2DAF A;  3HRD D;  1XT9 B;  1V2Y A;  2L0T A;  1MHX A;  1VJK A;  2N7D A;  2CR5 A;  2O2V A;  4C00 A;  3U7Z A;  2KQS A;  3R2I A;  4K7W A;  1JWS D;  1H4R A;  3TEX A;  4C7Y A;  4NZL B;  2QIE B;  3VAW A;  2WP9 B;  1YN5 A;  2ZVN A;  2LRW A;  2BT6 A;  2KZR A;  1FMA D;  2NR2 A;  4S17 A;  2L52 A;  4W9F A;  2PIA A;  1ZXH A;  2AX5 A;  5FKA C;  1TKE A;  4CHK A;  2G1E A;  3M62 B;  4S0R A;  3A9K A;  2FAZ A;  3TIX A;  2W9N A;  2ZVO A;  2WDV B;  3I3T B;  1BML C;  2WU5 B;  4KKJ A;  3IBE A;  3ZIM A;  2PE6 B;  3QAQ A;  4BAX A;  1GAQ B;  2REX A;  3VR9 B;  1YIW A;  3SDL C;  1ROE A;  3ZNG C;  2OHF A;  1RYJ A;  3QC8 B;  1VZ6 A;  2N9E B;  1WXQ A;  1RRB A;  1E7U A;  1C9F A;  4KGT A;  1WM2 A;  4AUQ C;  1EF5 A;  1IYF A;  4OVV A;  3H7S A;  1Q10 A;  2RSU A;  3ZUN A;  3N1X C;  2JRI B;  3A1Q A;  1C4A A;  4HEA 1;  1WJ4 A;  2JY6 A;  2VH1 A;  3ECI A;  2KHW B;  1JWA D;  1N60 A;  2KC2 A;  3DVN U;  1C1Y B;  3UIO B;  3GE3 C;  3DWG C;  2IO2 B;  1WYW B;  2LI5 A;  1HEZ E;  3QJZ A;  2IJ0 A;  2KVR A;  1GOZ A;  1GUA B;  4IC7 B;  4NQL B;  3L4P A;  3DHH C;  2I38 A;  1J7A A;  4XC2 A;  4YTP B;  3MHZ A;  3JVZ X;  3RNA C;  2KJH B;  3DCG A;  3APC A;  1HTO A;  2KLC A;  4GMV A;  2YVC A;  5DPR A;  3AE8 B;  5AUI A;  3NVV A;  2ZCC A;  2K6Q A;  3NVY A;  1E8Z A;  2HDE A;  1FM0 D;  3K9O B;  1TKY A;  1FCL A;  3UI3 A;  2LD9 A;  2IGH A;  2KOX A;  4IG7 B;  3AE2 B;  3EGR A;  1YQB A;  4K81 A;  2FNJ B;  2DYM A;  1Y8R C;  1QZE A;  4P16 A;  2WDT B;  1AW7 A;  2WXO A;  3GP7 A;  1V5O A;  1ISN A;  2QHO A;  3PHX B;  5EE0 A;  1JRP A;  2PVG C;  1E90 A;  3VDZ A;  3PRZ A;  2NBV B;  3RZF A;  4HLE A;  5G5H A;  3JYU A;  2VRR B;  5DPT A;  1FCC C;  3AE4 B;  3PTF C;  2J0M A;  1IBX B;  4MGZ E;  1B9R A;  3QQ8 B;  1ZUD 2;  4EE2 A;  3H1U A;  1QOF A;  2R2O A;  1MG8 A;  3QAR A;  4GDL B;  4LLG M;  1GC7 A;  3IAM 1;  4GOC A;  4KZ0 A;  1MJD A;  2WXL A;  2L05 A;  2G3Q B;  3AE7 B;  2ZW1 A;  3IT4 B;  2WGS A;  2DZI A;  4EFO A;  5LNK 1;  2BW2 A;  2B3A A;  4LK0 M;  5FK9 C;  1YJ1 A;  2BYF A;  4ANV A;  2KK8 A;  4OZC A;  3DQV A;  3VR8 B;  2V3P A;  3FC4 A;  3IXS A;  2DHZ A;  5C1Z A;  1ET9 A;  3MFG A;  3DHI C;  2GI9 A;  5JHB A;  2BGF A;  4DDI D;  2WXH A;  2RR9 A;  3HM3 A;  2AQ1 B;  1BXT A;  4XGA B;  4P7I A;  1XLN A;  2NBU A;  4XWW A;  1J19 A;  3VTW A;  2V9H A;  2NMQ A;  5BMI A;  1XQQ A;  3BVG A;  4ZYS A;  4YWG G;  2CS4 A;  4YL8 A;  1ACC A;  2FCQ A;  3FIL B;  3B0A A;  2MBO A;  5C23 A;  4K3C A;  3WCQ A;  2XBB C;  4FA6 A;  3B9J A;  2J42 A;  1WE7 A;  2HD5 B;  5HHD G;  2NVU I;  2XNA C;  3RI7 C;  4URK A;  1T0Y A;  4FXC A;  4LNI A;  4KDL B;  4PK1 A;  4JWS C;  1J7C A;  5IKC M;  1I7H A;  2HTM E;  4A8X C;  1QF6 A;  3V6E B;  1VZ8 A;  1QLB B;  1R4M B;  1KRH A;  3RUL A;  5CTR C;  4C4V B;  1KH0 A;  3X0W A;  1FPY A;  2RDH A;  1WR1 A;  4OVU A;  4J6I A;  2QMT A;  2PMV A;  4NAW A;  1WZ0 A;  2HTH A;  2KMM A;  2M56 B;  4N6E B;  3RNG C;  3UIP B;  4W9L A;  1MFW A;  3I5J C;  2LUM A;  4F1S A;  3ZQ4 A;  4LJO B;  4RH6 A;  1MG4 A;  2JX5 A;  3KW5 B;  5FR6 A;  1SIJ A;  2MBE A;  4MSQ B;  3PZD A;  4HPP A;  1EWY C;  1I4H A;  2D3G A;  4YT0 B;  4ZRP A;  2JF5 A;  3QHT A;  5AEK B;  2MBQ A;  3Q14 C;  1UWX A;  4NJ6 A;  2M1M A;  1SE4 A;  3GOE A;  4NAW B;  3W9C B;  4D2K A;  3NVZ A;  2K8C A;  2MP2 B;  4UDU C;  4ASW C;  1ZW7 A;  3L16 A;  3NZS A;  2RPQ A;  2YEP F;  1MI0 A;  5IAA C;  2XEW A;  4IWO A;  3VFK A;  5DPW A;  4LDT B;  3D32 A;  4HWI B;  2N7J A;  3AB5 A;  5J2R A;  1L0V B;  2RD0 A;  2LGX A;  4XYC A;  3A1Q B;  2L0F A;  2W3S A;  1N63 A;  3ZGZ A;  1DYQ A;  2AL3 A;  2KJ6 A;  3DHG C;  4N59 A;  1MVK A;  1SIF A;  5BO4 B;  3NHE B;  5G55 A;  2KQ4 X;  1QOG A;  4KX6 B;  1SE2 A;  3W5V B;  3CF6 E;  2PE9 A;  3MC9 A;  2RPV A;  4RGN A;  3U30 A;  1C76 A;  3HHM A;  5AZG A;  2V3S A;  2DNF A;  2AL6 A;  2KDB A;  2LMC A;  3NRZ A;  4XDC A;  3CST A;  4RGM A;  2WXK A;  5EDS A;  1UGM A;  1UF0 A;  2LZ6 A;  3P4S B;  4CYE A;  1H8C A;  3VH4 B;  2LRU A;  2O6V B;  4NY0 A;  4MGI E;  1ENF A;  1TS2 A;  1YN3 A;  3RFZ B;  1EF1 A;  2PTL A;  1VD2 A;  2YEP B;  2W82 A;  4FJV B;  1YQ4 B;  4KGS A;  2GMI C;  4DXG A;  4A55 A;  2V4L A;  4BKT A;  3LDZ E;  2ZPY A;  3R7R A;  2E3T A;  3V60 A;  4A6Q A;  1ZP0 B;  4IKG A;  1V1P A;  3Q8B A;  4AP4 C;  1I42 A;  3AEE B;  1CJE A;  4I6L B;  1DOX A;  1GB1 A;  3TL5 A;  4MGY E;  1ZE3 D;  2MJ3 A;  4GDK A;  4BKG A;  1NEN B;  1MPE A;  2JWZ A;  3VH3 B;  3C8Y A;  3U8Z A;  2KTF A;  2MLB A;  2WLB A;  1HZ6 A;  4MEL A;  2N0S B;  4BVU C;  4TV3 A;  2WXQ A;  5CHV C;  2K3U A;  3WAO A;  1XLO A;  3SFE B;  4MH8 A;  2K25 A;  1V97 A;  4WWN A;  2KTR A;  5J17 A;  3VQI A;  3VTV A;  2M0A A;  4K1R B;  2GRI A;  2BVC A;  2ZW0 A;  4Q2J A;  1YMH E;  3HUI A;  2GOW A;  3TSS A;  1NDD A;  4B6W A;  4IWQ A;  1VR9 A;  2QIL A;  2JYT A;  4AQ7 A;  4X57 B;  4CQN A;  1PUT A;  1I35 A;  4E71 A;  3N1Z C;  1YJI A;  4DHJ B;  1SF0 A;  4KGR A;  1OFF A;  3PRM B;  2N9K A;  1D5X C;  3N1Y C;  5D3D A;  4AJW A;  2WXR A;  3MJ5 A;  2N9P C;  1YX6 B;  2ACZ B;  2DYB A;  2AQ3 B;  2M8S A;  2D07 B;  2JXT A;  3APF A;  2UWQ A;  3PPA A;  1STE A;  3Q3J A;  4M01 A;  4HPL B;  4DXF A;  3AMZ A;  3H6N A;  4KKI A;  1T3Q A;  1L6V A;  1RWS A;  4HKZ E;  2EKI A;  2KN4 A;  4TSS A;  1TTN A;  2PW9 A;  3CIR B;  1JML A;  4MEM A;  1V9J A;  1FRR A;  1VRA B;  4J3O D;  4OZA A;  1HZ5 A;  2EKE C;  2N9X A;  4M8M A;  3JW0 X;  2PPH A;  3J9C A;  2K0P A;  3VHT C;  2E6X A;  1E7V A;  1UNS A;  5E6J A;  1SXT A;  4W9C A;  5I4D A;  3ZNI D;  5H92 C;  3BWU D;  1JAL A;  3Q8E A;  4MJS A;  2K9X A;  3A9J B;  4ZRJ A;  5LLI A;  4ANW A;  1T0Q C;  3Q3N C;  4RNA A;  2GBN A;  2WNM A;  2MBB B;  1WRI A;  2X38 A;  4GIV A;  4HJG E;  3ZRF A;  4P6V F;  1OTR B;  3P1M A;  4FHJ A;  4M0W B;  3ZJV A;  4G11 A;  2WXI A;  3Q8C A;  3L17 A;  2KDF B;  2K1F A;  2DYO A;  2O6V D;  2FCN A;  1VZ7 A;  4US9 A;  3ZTC A;  2QC8 A;  5DPS A;  2INP E;  4ZHP A;  2JUO A;  2WXG A;  2D10 A;  1PGX A;  4GU2 A;  3BVM A;  4L2Y A;  2LJ5 A;  1S1Q B;  4IM0 A;  2LVO A;  1CK1 A;  1SGH A;  4IM3 A;  2VZK D;  3HVZ A;  2MW5 A;  2L32 A;  1PYW D;  4CO7 A;  4K3B A;  2Y5P A;  1DOY A;  4WWO A;  3RUI B;  1WFY A;  4MAC A;  2BYT A;  4DHZ E;  4YSX B;  4IDI A;  3BYT B;  2K6D B;  1XO3 A;  3Q69 A;  2L00 B;  2JXX A;  5HFY A;  2LHD A;  3R7Q A;  4N58 A;  3L54 A;  2DX5 B;  4FN2 A;  1OQR A;  4HRS A;  2BTE A;  1I4Q A;  2FCM A;  1XEE A;  4NJC A;  3U7D A;  3KVF B;  1K51 A;  4MJS B;  1KLU D;  2V4I B;  4LNF A;  4TKN A;  4GDL A;  1EUV B;  1OQY A;  3H9D A;  4LDT D;  5LXI B;  1XLP A;  5JHA A;  1D3Z A;  2KMA A;  1OGW A;  3GE8 C;  4JIO U;  2A4Z A;  4AOF A;  2ZPN A;  4BOS C;  3UIN B;  1FD6 A;  1IGD A;  2IO0 B;  1L6U A;  4FJZ A;  4JLC A;  3U52 E;  1U4A A;  2BYE A;  3H7P B;  3VTU A;  3RNE C;  1LQB A;  3ETR A;  2KTR B;  4FUL A;  2C60 A;  2PLP A;  1IP9 A;  5BYS A;  1SE9 A;  3V62 A;  3ZKJ C;  4DBG A;  1R7S A;  4OW0 A;  1TJE A;  3M63 B;  1LFD A;  4YSY B;  4WQM A;  1WGK A;  1UUP A;  1K50 A;  2NTT A;  2CJN A;  1P0R A;  2NPT A;  4W9H A;  1R4N B;  3SR6 A;  2HJ1 A;  3ZJU A;  1Q0W B;  2KT7 A;  4KSL C;  2QSD A;  5IP4 D;  1V5T A;  4W9D A;  3W1S A;  1M4V A;  2D3C A;  4FJY A;  1KFY B;  3PS6 A;  1NI2 A;  1J7B A;  3KLS X;  2ON8 A;  2BWF A;  3I57 A;  3HM6 X;  1PGA A;  3C0R B;  2BYV E;  1K53 A;  1WH3 A;  4KVG B;  1GJZ A;  1AAR A;  4RM8 A;  1TBE A;  5JXV A;  4IM2 A;  2G4S A;  3DBS A;  2Z0D B;  3BVZ A;  1EU4 A;  1Y56 A;  2K39 A;  4ZRK A;  3AE6 B;  3BII D;  4DQO C;  4F8C B;  3Q6B A;  3R2T A;  4JWU C;  2NCN A;  3EHV A;  2UU7 A;  2MRP A;  1I4G A;  1YD8 U;  1YX5 B;  1R4M I;  2KFK B;  2WXJ A;  2ICI A;  2W3R A;  2BKR B;  3OG5 A;  3Q2A C;  3QWZ B;  4YTM B;  4W9J A;  3KH0 A;  3IG3 A;  2MEK A;  3IT6 B;  2PJH A;  1N5W A;  4W9E A;  3V6C B;  5BYQ A;  4ZYN A;  4K7U A;  1WXS A;  3PV1 A;  4N9F 4;  1MHH E;  4XWT A;  1WZ3 A;  5FR3 A;  2IZV B;  1L0Y B;  2JWU A;  2L83 A;  3WAP A;  3L08 A;  3O65 B;  4ANU A;  2LVQ A;  3FAH A;  1JQ4 A;  3ZDM C;  1QOA A;  1HXY D;  3ZNZ B;  4XE0 A;  2OED A;  3DBH I;  1VLB A;  1ZDV A;  4NJ7 A;  3KQ4 A;  2EMS A;  2JT4 B;  1F52 A;  5HI1 A;  5C3J B;  1NBF C;  3EC8 A;  3A4S C;  3I9V 1;  3QX1 A;  4PS3 A;  3W5U B;  1PFD A;  2D11 A;  3ZW3 A;  3N9Y C;  3HK0 A;  3SU8 X;  1UEL A;  1UBQ A;  2FCS A;  3IAS 1;  3P4P B;  3CSF A;  2TSS A;  1OEY A;  1Z5S B;  3TJP A;  2WXP A;  1J8C A;  3DBL B; 
#chains in the Genus database with same CATH homology
 1FMA D;  4A6Q A;  1JCK B;  2INN E;  2E3T A;  1ZP0 B;  2SAK A;  3U4E G;  3AH7 A;  2L52 A;  1YNT E;  4IKG A;  3HVD A;  3Q8A A;  1V1P A;  2PIA A;  3Q8B A;  5EE1 A;  3AEE B;  1CJE A;  1ZXH A;  3MP9 A;  2N9L A;  1DOX A;  1TYG B;  1WSP A;  2AX5 A;  5FKA C;  5TSS A;  1TKE A;  1GB1 A;  1TZO A;  2G1E A;  2JYE A;  2NTS A;  4H2A A;  1ZE3 D;  1IBX A;  2MJ3 A;  3SEB A;  2KWD A;  1NEN B;  2BBC A;  2QEJ C;  2WXN A;  2WDV B;  2Y3A A;  5EE3 A;  1BML C;  2WU5 B;  1MPE A;  4KKJ A;  4M0W A;  1GAQ B;  3C8Y A;  1FNU A;  1JWB D;  2WLB A;  3VR9 B;  1HZ6 A;  1ROE A;  4R3D A;  2N0S B;  2OHF A;  3BZD B;  1RYJ A;  2WXQ A;  3R8B A;  2K3U A;  1VZ6 A;  1FNV A;  1WXQ A;  2K5P A;  1XLO A;  2XN9 C;  3SFE B;  1C9F A;  4MH8 A;  4KGT A;  2BB5 A;  1V97 A;  2I2Y A;  3LYY A;  1F2R I;  1AWD A;  3VQI A;  1YN4 A;  2M0A A;  3URY A;  1Q10 A;  2GRI A;  2ZW0 A;  1QOB A;  4Q2J A;  1YMH E;  3HUI A;  3TSS A;  1SB3 C;  1KLG D;  1VR9 A;  3V3X A;  2V0G A;  2QIL A;  2JYT A;  4ARI A;  1C4A A;  4AQ7 A;  4HEA 1;  3O13 A;  4CQN A;  1PUT A;  4OHJ A;  3AV8 A;  5BMH A;  1YJI A;  1JWA D;  1N60 A;  1SF0 A;  4KGR A;  4A90 A;  2FUG 1;  1I4P A;  2V3N A;  1OFF A;  2WDR B;  2N9K A;  1D5X C;  5D3D A;  2SEB D;  2Q5W D;  3DWG C;  2WXR A;  3MJ5 A;  2ACZ B;  1N61 A;  1C78 A;  2AQ3 B;  1HEZ E;  4RCO A;  1TS3 A;  2JXT A;  4RF0 A;  1FXI A;  2EEL A;  1EU3 A;  2IJ0 A;  1STE A;  1TS5 A;  3MC0 B;  1XCT L;  3SFD B;  4DXF A;  3AMZ A;  4KKI A;  1T3Q A;  1GOZ A;  4HRO A;  3TEY A;  3L4P A;  1L6V A;  1RWS A;  4HKZ E;  2I38 A;  1J7A A;  3TEZ A;  1ESF A;  4YTP B;  3MHZ A;  2DLB A;  2EKI A;  2KN4 A;  4TSS A;  2PW9 A;  3NZ3 A;  3AE3 B;  3CIR B;  5D7G A;  2LEK A;  1JML A;  4WH4 A;  3P42 A;  3VRA B;  1FRR A;  1F0Z A;  1VRA B;  3AE8 B;  4J3O D;  5AUI A;  2M19 A;  1FIQ A;  1XLQ A;  3NVV A;  1TY2 A;  4OZA A;  1QQR A;  2LJI A;  1HZ5 A;  2DWQ A;  3AED B;  1EWC A;  3J9C A;  5GXG B;  3NVY A;  2K0P A;  2E6X A;  1UNS A;  2HDE A;  1FM0 D;  5G5G A;  2IDY A;  3B2F A;  5E6J A;  1SXT A;  5I4D A;  1TKY A;  5H92 C;  3AE9 B;  3BWU D;  1JAL A;  2DBY A;  3Q8E A;  1FCL A;  3KWL A;  1KF6 B;  3UI3 A;  2IGH A;  1DOI A;  2K9X A;  4YSZ B;  3AE2 B;  1BUI C;  3EGR A;  4RNA A;  1JWM D;  2DYM A;  2WNM A;  3T3O A;  4P16 A;  4C56 C;  1JRO A;  1XF5 L;  1WRI A;  2X38 A;  3NVW A;  4HJG E;  1FXA A;  1AW7 A;  1YQ3 B;  2BS2 B;  2WXO A;  4P6V F;  2R61 A;  3GP7 A;  4AS1 A;  1B1Z A;  3P1M A;  1PDX A;  3KWV A;  1TS4 A;  4B0E A;  1T6B X;  2J4X A;  3ZJV A;  4YXD B;  2WXI A;  1FO4 A;  3Q8C A;  2Z8L A;  5EE0 A;  4ZRQ A;  1JRP A;  1P7E A;  2PVG C;  2DYO A;  4NAM A;  1JWU D;  1VZ7 A;  4US9 A;  2J53 A;  2INP E;  4ZHP A;  2WXG A;  5G5H A;  4RGO S;  1PGX A;  3BVM A;  4L2Y A;  1V1P B;  1I4X A;  1FCC C;  1JW9 D;  1NEK B;  3AE4 B;  5HG2 A;  4HKQ A;  1IBX B;  1CK1 A;  1K52 A;  2VZK D;  3NUH B;  3HVZ A;  2L32 A;  1B9R A;  1PYW D;  4L23 A;  3ZJT A;  1ZUD 2;  2Y5P A;  4EE2 A;  1DOY A;  1QOF A;  2G9H D;  5H8Y E;  4MAC A;  2K22 A;  4GDL B;  4LLG M;  2BYT A;  3CWI A;  3IAM 1;  4YSX B;  4IDI A;  4OVZ A;  2WXL A;  3BYT B;  4GDK B;  2IGG A;  3AE7 B;  2ZW1 A;  1XO3 A;  3IT4 B;  3AE5 B;  3Q69 A;  5HFY A;  5LNK 1;  2BW2 A;  2LHD A;  1E6E B;  4ARC A;  3U2S C;  4LK0 M;  4N58 A;  5FK9 C;  1HA5 A;  4A9A A;  2ONQ A;  1OQR A;  1AN8 A;  4HRS A;  4OZC A;  2BTE A;  1IGC A;  2GB1 A;  1I4Q A;  2JQR B;  3VR8 B;  2W54 A;  2V3P A;  1XEE A;  4NJC A;  3FC4 A;  3IXS A;  1K51 A;  4RF1 A;  1ET9 A;  3MFG A;  1KLU D;  2GI9 A;  5T8I A;  2JU6 X;  2V4I B;  1D5Z C;  5BYR A;  2QJL A;  2WXH A;  1A70 A;  1D6E C;  3EUB 2;  4XDD A;  3P4R B;  1UWM A;  5EE9 A;  1ZXI A;  1QKZ A;  2AQ1 B;  1XLP A;  1D5M C;  1BXT A;  3EA6 A;  4ITK A;  1VDV A;  1XLN A;  2MJE A;  4XWW A;  2LGI A;  4LTU A;  1DGJ A;  1OQQ A;  3AE1 B;  1ZPS A;  1FFV A;  2NMQ A;  3BVG A;  5BMI A;  1QIL A;  4ZHO A;  1FD6 A;  1XXG A;  4ZYS A;  1IGD A;  2LFI A;  2WXM A;  4YWG G;  3P63 A;  1L6U A;  2AQ2 B;  1ACC A;  3U52 E;  3VRB B;  1F2R C;  1TY0 A;  3W2D A;  3GB1 A;  2BS4 B;  5BMG A;  2D5G A;  3BK1 A;  3Q8F A;  3ETR A;  3FIL B;  4PT5 A;  1V8C A;  1XCQ L;  4JE3 B;  4B0M A;  2PLP A;  3B2G A;  5BYS A;  2H89 B;  4WAF A;  3ZYY X;  3WCQ A;  4RGT A;  1FFU A;  2WU2 B;  1LO5 D;  1AYF A;  1R7S A;  1C79 A;  2H88 B;  1L0X B;  2WQY B;  1TJE A;  3B9J A;  4OW0 A;  2J42 A;  1ZDX A;  2KAC A;  1SBB B;  1L4Z B;  1QT9 A;  2CU3 A;  3LB8 C;  3PO0 A;  4YSY B;  5HHD G;  2XNA C;  1E9M A;  1WYG A;  4WQM A;  3AEG B;  2RDG A;  1WGK A;  3AEB B;  1UUP A;  2WDQ B;  2W55 A;  4FXC A;  1K50 A;  2NTT A;  1NVI D;  2CJN A;  4JWS C;  2KDM A;  1J7C A;  1EM7 A;  1I7H A;  3E56 A;  2HTM E;  4TMA B;  4MM3 B;  4A8X C;  1QF6 A;  1C4C A;  1L4D B;  1VZ8 A;  2BB6 A;  1QLB B;  3NS1 A;  3E9S A;  1KRH A;  4WUR A;  3SR6 A;  3ZJU A;  1KH0 A;  3TUO A;  2QSD A;  2MJD A;  1E10 A;  1YJJ A;  4OZB A;  2RDH A;  1PGB A;  3W1S A;  1M4V A;  2QMT A;  5D3I B;  1FNW A;  1KFY B;  3T3N A;  1C77 A;  2PMV A;  1NYR A;  1F77 A;  1J7B A;  3KLS X;  4JPS A;  2BS3 B;  2KMM A;  2ON8 A;  1FEH A;  2M56 B;  4N6E B;  2JSV X;  2PKO A;  3I57 A;  1SEB D;  1V1O A;  1I4R A;  1D4B A;  1PGA A;  2LUM A;  1C4P A;  1ZOY B;  1K53 A;  2WXF A;  3ZQ4 A;  2MH7 A;  1GB4 A;  4RH6 A;  2JX5 A;  2RMM A;  1FRD A;  1KTK A;  5JXV A;  2L1A A;  3AEA B;  1SIJ A;  5C2T B;  3AEF B;  1T5X D;  3AM9 A;  3BVZ A;  1EU4 A;  4L1B A;  2VZK B;  2J52 A;  3V05 A;  1EWY C;  1I4H A;  4YT0 B;  4ZRP A;  1N5X A;  4C80 A;  4O1N A;  1Y56 A;  1UWX A;  5AUK A;  3AE6 B;  3BII D;  4DQO C;  4NAW B;  1SE4 A;  3R2T A;  3W9C B;  4JWU C;  4D2K A;  3NVZ A;  4MT5 A;  4UDU C;  2B76 B;  4TQ1 A;  3GS2 A;  1I4G A;  2CJO A;  1CZP A;  2FBW B;  4ZOH C;  1IUE A;  1WWT A;  2WXJ A;  2ICI A;  2W3R A;  4YTM B;  2YEP F;  2Y5C A;  1MI0 A;  4WIP A;  2MEK A;  3IT6 B;  5MPO A;  4JX1 C;  1N5W A;  3LXF A;  1E0Z A;  2N7J A;  3AB5 A;  5BYQ A;  1L0V B;  3H8H A;  1RFK A;  3DWM A;  3ZGZ A;  2W3S A;  3BYY B;  1N63 A;  1N62 A;  2WS3 B;  1DYQ A;  2KAJ A;  4N59 A;  1MVK A;  1TKG A;  1SSN A;  4USA A;  1MHH E;  1RM6 C;  4XWT A;  2LHE A;  5FR3 A;  2JWU A;  1L0Y B;  2KQ4 X;  1QOG A;  2L83 A;  4KX6 B;  4REZ A;  1SJE D;  4WWM A;  1NI3 A;  3FAH A;  1SE2 A;  1L5P A;  3W5V B;  1P7F A;  4RFB A;  2RPV A;  1UGJ A;  4C7Z A;  4RGN A;  3BK2 A;  1JQ4 A;  1QOA A;  1HXY D;  2JZP A;  1C76 A;  4XE0 A;  2OED A;  2IGD A;  4US8 A;  1SJH D;  2IPK D;  3ABV B;  4GLS C;  1VLB A;  1ZDV A;  1HQR D;  2LMC A;  3NRZ A;  3P4Q B;  3PZ7 A;  3KQ4 A;  4XDC A;  4TQ0 A;  4YTN B;  2FE8 A;  3FIL A;  5HI1 A;  3RPF C;  1NYQ A;  4RGM A;  5C3J B;  1CQV A;  2WXK A;  3TEW A;  3I9V 1;  1E7P B;  1GPX A;  3P4S B;  3W5U B;  1PFD A;  3HRD D;  3N9Y C;  4IOI E;  1MHX A;  1VJK A;  3PZ8 A;  1ENF A;  1SE3 A;  3U7Z A;  3R2I A;  3AEC B;  1TS2 A;  1JWS D;  1YN3 A;  3IAS 1;  3P4P B;  3TEX A;  3RFZ B;  2PTL A;  4C7Y A;  2TSS A;  4NZL B;  2YEP B;  2W82 A;  2PVO D;  2QIE B;  1YQ4 B;  3OWE B;  4KGS A;  2WP9 B;  1ET6 A;  1YN5 A;  2WXP A;  4DXG A;  3AN1 A;  4A55 A;  2BT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...