3MPSA

Peroxide bound oxidized rubrerythrin from pyrococcus furiosus
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
VVKRTMTKKFLEEAFAGESMAHMRYLIFAEKAEQEGFPNIAKLFRAIAYAEFVHAKNHFIALGKLGKTPENLQMGIEGETFEVEEMYPVYNKAAEFQGEKEAVRTTHYALEAEKIHAELYRKAKEKAEKGEDIEIKKVYICPICGYTAVDEAPEYCPVCGAPKEKFVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubrerythrin
publication title A cryo-crystallographic time course for peroxide reduction by rubrerythrin from Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 62
structure length 170
sequence length 170
chains with identical sequence B, D, F, G, H, I, K
ec nomenclature
pdb deposition date 2010-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3mpsA01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3mpsA02
1O9IA 3RE7A 3F35A 1FHMA 3PWFA 1OTKA 2M4YA 3UNOA 2ZA7A 3HL1A 3SIDA 3GE4A 4DYXA 1UMNA 1JREA 4M34A 3SH6A 4KVRA 5AI2A 2FFXJ 1IRNA 5LBHA 1JI5A 2V2MA 2YJKA 3QHCA 4U3GA 3FI6A 5E1UA 3E1NA 5GU0X 2OH3A 4AM4A 2KN9A 4LYUA 3BVKA 1L8IA 4DI0A 4TO9A 5K52A 3IS8A 4DE6A 2XJMA 3Q4RA 1B71A 4TOCA 4LYXA 2VL6A 5HJFA 2FL0A 1O9RA 4AM2A 1F30A 2CN6A 4LQVA 1DX8A 2BK6A 1CADA 1TJOA 3FVBA 3PW1B 3Q4QA 5GN8A 4LPMA 3PVTB 4TW3A 4ITTA 3KA4A 2C2UA 4ERUA 2FG8A 4ML5A 3TA8A 1EUMA 3IQ1A 1CAAA 2K2DA 2Y3QA 4EVCA 3OGHA 3T9JA 3UOIA 4REUA 3PW1A 4EVEA 4TODA 2VXXA 5D8QA 3WVUA 5LG8A 1Z6OA 2OC5A 1QCVA 4CVPA 3GHQA 2C2JA 4ZL5A 5GU3X 4CYBA 2Z6MA 2ZURX 3KYWA 3F32A 1MFRA 3R2SA 4P18A 4RC7A 4TOFA 3O7SA 2XGWA 3Q4OA 4YWMA 3A44A 4II4A 1QYBA 1JI4A 1JKUA 1JKVA 2XKQA 1R0JA 3MPSA 4XKTA 5FFAA 3OJ5A 3RGDA 4TOEA 2WLAA 4XKUA 1T9QA 2ITBA 2XJNA 3AK9A 5CMRA 4TOBA 3A9QA 3PVRB 4R42A 2GS4A 4YKHA 3KYUA 3QZ3A 1NF6A 5GOUA 3KX9A 1ZUJA 4ISPA 4ETRA 1VCXA 2HR5A 4IWKA 1R0IA 3WNWA 2Z90A 3E6RA 4CVTA 2V3BB 1YUZA 5JKMG 2V15A 4MJYA 3PZAA 5GU1X 4ZKHA 2CHIA 4ZJKA 1VEIA 4POFA 2JD80 3AF8X 2V2IA 3R2HA 1YK5A 3KYYA 4ZLWA 3E1PA 3E6SA 2CF7A 1IERA 2CLBA 1RWDA 1LKPA 1Z4AA 3ES3A 5D8PA 4CYAA 2D5KA 3KWOA 4A25A 3RZ6A 3RZTA 2WLUA 3O7RA 5D8RA 5JKMA 5CMQA 4CMYV 4TOHA 2CIHA 4CVSA 3RBCA 2GYDA 3NP2X 1RCCA 1ZS3A 2FKZA 4MKUA 3PVYA 3R2MA 1SQ3A 3PWQC 1S3QA 1N1QA 3F34A 5GN8B 2GYQA 1SMWA 1H96A 3F39A 1S24A 1LKMA 3PWQA 3E1MA 2CN7A 3AJPA 3BVFA 5I4JA 3KA9A 2ZG7X 5J9VA 2VZBA 1JIGA 2YJJA 6RXNA 1LB3A 3F36A 3Q4NA 5JKLA 4CMYA 2PVEA 1Z6OM 4AR6A 3EZUA 3ISEA 4LQHA 1BCFA 5K53A 1IU5A 1RCEA 1LTLA 4PGIA 1BFYA 3FSEA 3AK8A 2GMGA 2FZFA 4RC7B 1NFVA 4DYYA 2PYBA 1BRFA 4II4B 1VLGA 4RC6A 2V2OA 1IU6A 1LKOA 4AM5A 5ERJA 3BVLA 1F33A 3WVVA 4Z3BA 5D8YA 3SE1A 2Z5QA 1RB9A 5LS9A 4LQJA 2BW1A 2V2NA 1XZ3A 4MN9A 3U90A 2G4HA 4RXNA 2WTLA 3ISFA 3NOZX 2QL0A 1TKOA 1FHHA 4M32A 1R0GA 4TPUA 1UVHA 3KA6A 1RCIA 4DASA 1T9PA 1R03A 1S2ZA 4EVBA 5FFDA 4XGSA 2JD70 3EGMA 1VJXA 1T9OA 3AJOA 2LCQA 2Z5PA 4IXKA 1L8HA 4DYUA 1NF4A 1SMMA 4E6KA 3SHXA 1QGHA 4RC8A 1YUXA 2CHPA 4AR5A 1TK6A 2FHAA 2PVXA 3BT5A 3RAVA 2FG4A 3EZ0A 3R2LA 1RYTA 3RD0A 1BQ8A 5J93A 4PG0A 1E8JA 1RDGA 1RDVA 1IROA 4RC5A 2BKCA 3AJQA 5D8SA 2C2FA 5IY0A 3AF7X 1TKPA 3WVWA 2VXIA 3RYGA 4MY7A 4TOGA 4XKSA 4DZ0A 1AEWA 4CVRA 2YW7A 4EVDA 2ZA8A 1SOFA 2ZG8X 2X170 1YK4A 5RXNA 5LG2A 3KYVA 1IESA 5D8OA 3BKNA 3PVYB 2ZA6A 5JKLG 1RCGA 3AF9X 2QQYA 1J30A 2V2JA 3A68A 4MUDA 2C6RA 3GVYA 1VELA 4Z5SA 1BFRA 4ZKXA 5ERKA 4QUWA 2XJOA 3E1LA 5CZUA 5HQOA 1BQ9A 1BE7A 1B2JA 3VNXA 5FFEA 2W0OA 5FFBA 3F38A 3KA3A 2DSXA 4ME3A 4LQNA 5FEJA 2V2SA 2IU2A 1JTSA 2FJCA 1FHAA 1S30A 1NNQA 3QHBA 1R0FA 4M33A 2RBDA 2YW6A 1H7VA 4TOAA 1GWGA 1B13A 1VEQA 5J8SA 1DPSA 5AI3A 4IWJA 3F37A 2IB0A 4RC6B 4ZL6A 2BJYA 4CY9A 1BG7A 1R0HA 2V2PA 4AR4A 1HRSA 4ITWA 3R2OA 3R2RA 5GU2X 4DYZA 2QF9A 4LPNA 1MOJA 1C09A 2RDVA 5D8XA 4ZMCA 1RCDA 3NP0X 2C41A 3QB9A 3UOFA 5J8WA 3QD8A 2CLUA 4PGKA 2V2LA 3E1QA 2MS3A 4ZTTA 3BVIA 3PVTA 3PW8C 2HTNA 4YWLA 1DVBA 4KVSA 2F7NA 2PYAA 3PW8A 3KXUA 4M35A 1B2OA 2JD60 1KRQA 5JACA 5E2DA 3F33A 7RXNA 4RC5B 3SS2A 4AR3A 2CEIA 1JYBA 1XZ1A 4ZKWA 3HIUA 1JGCA 2ZG9X 3E1OA 4KVQA 3H7GA 3E2CA 2V2RA 3R2KA 1YV1A 3PVRA 3E1JA 4PG1A 5HJHA 4K9FA 5IX6A 3ERZA 5FFCA 3IS7A 1ZRPA 5AXSA 4ISMA 4OYNA 2KKDA 1DATA 4POGA 3BVEA 3KA8A 2Z5RA 8RXNA 2IY4A 3KYXA 4Y08A 1SMUA 5C6FA 4LPJA 3QVDA 2UX1A
chains in the Genus database with same CATH superfamily
1O9IA 3MQKB 3RE7A 3F35A 1FHMA 3PIO1 3PWFA 1OTKA 4A3EL 3LKDA 2M4YA 1Y1VL 3UNOA 4XGHA 2ZA7A 2PMZP 2ZIXA 2BE5D 5K2ME 3HL1A 3SIDA 3GE4A 3HOZL 4DYXA 1UMNA 1JREA 4M34A 2XJSA 3SH6A 4KVRA 5AI2A 2FFXJ 3PIP1 3FRSA 1IRNA 5LBHA 1JI5A 3FKIL 2V2MA 2YJKA 3QHCA 4U3GA 4YXMA 3FI6A 4WFN1 1PFVA 2APOB 3GTJL 5E1UA 2V0FA 3E1NA 5GU0X 2E2JL 4A3KL 2OH3A 4AM4A 1I50L 2KN9A 4LYUA 3BVKA 1L8IA 4DI0A 4A3ML 4TO9A 4U671 5K52A 3KHKA 3IS8A 4DE6A 2XJMA 3Q4RA 1B71A 4TOCA 4LYXA 2VL6A 5HJFA 3ZG6A 2FL0A 1O9RA 2Z3QB 4AM2A 4AYBP 1F30A 3HAXC 2WWXB 2CN6A 4LQVA 4TVMA 1I6HL 1DX8A 4YVZA 2BK6A 1CADA 1TJOA 3FVBA 3PW1B 3Q4QA 5GN8A 4LPMA 3HKZP 3PVTB 4TW3A 4ITTA 1PFUA 3KA4A 2C2UA 2WB1P 4ERUA 3GTGL 2FG8A 4ML5A 3JZAB 1Y1WL 3TA8A 1EUMA 3IQ1A 4W4LB 1CAAA 2K2DA 5M3ML 2WAQP 2Y3QA 4EVCA 5C4XL 3S16L 3OGHA 2A69D 3T9JA 3UOIA 3QQCE 4REUA 3PW1A 4EVEA 4TODA 2VXXA 5D8QA 2Z3RB 1WCML 3WVUA 5LG8A 1Z6OA 2OC5A 2J9UB 1QCVA 3J7Y1 2NVYL 4CVPA 3GHQA 2C2JA 4ZL5A 5MFPA 1IW7D 5GU3X 4CYBA 4XXBB 1PZXA 2Z6MA 2ZURX 2ERSA 3KYWA 1TWCL 3F32A 1MFRA 2YU9L 3I4NL 3R2SA 4P18A 4RC7A 2N02A 4TOFA 3O7SA 2XGWA 3Q4OA 1OWCA 5GAEc 3S15L 4YWMA 3A44A 4II4A 1QYBA 1JI4A 1JKUA 1JKVA 2XKQA 1R0JA 3MPSA 5M5WL 4XKTA 5FFAA 3OJ5A 3RGDA 4TOEA 3H3VM 2A6HD 2WLAA 4XKUA 1T9QA 3JZ9A 3C1YA 2ITBA 2XJNA 2CR8A 3AK9A 5CMRA 4TOBA 3A9QA 3PVRB 5HU6D 1R9TL 2NVTL 4R42A 2GS4A 4YKHA 3KYUA 2E2IL 3QZ3A 1NF6A 3J7Z1 5GOUA 3KX9A 1ZUJA 4ISPA 4ETRA 1VCXA 2HR5A 4IWKA 2Y0SP 1R0IA 1TWGL 5GAGc 3WNWA 3PKJA 2Z90A 2B63L 3E6RA 4CVTA 4A3LL 1TWHL 2V3BB 1YUZA 3B0AB 5JKMG 2RFKB 1NXGA 2V15A 4Y52L 4MJYA 3PZAA 5GU1X 4ZKHA 2CHIA 2JI2A 4ZJKA 3PKIA 5C44L 1PFYA 4W4KB 1VEIA 3IU3I 2XJPA 2JD80 4POFA 3AF8X 5JVG1 4BBSL 2V2IA 3R2HA 1YK5A 3KYYA 4ZLWA 3GTLL 3E1PA 3E6SA 2PPTA 2XJQA 2CF7A 1IERA 2CLBA 5JDOB 1RWDA 4ZN3B 1LKPA 1Z4AA 3ES3A 3GGYA 4AHYA 5D8PA 4CYAA 2D5KA 3KWOA 4A25A 4JAFA 3RZ6A 3RZTA 2C6AA 2WLUA 3O7RA 4A3GL 3P8BA 5D8RA 1PFWA 5M5YL 5JKMA 5CMQA 3B08B 3GTKL 3S17L 2CKAA 3KDQA 3H0GL 2JA8L 4CMYV 3M6JA 5JDOA 4TOHA 2CIHA 3LWRB 1WJVA 4CVSA 2C6BA 3RBCA 2GYDA 2M6OA 4A3DL 3HJWB 3NP2X 3HOYL 1RCCA 1ZS3A 2FKZA 3H97A 4MKUA 2JA7L 3S1RL 3PVYA 3R2MA 1SQ3A 3PWQC 1S3QA 3M4OL 1N1QA 3F34A 5GN8B 2GYQA 1SMWA 1H96A 3F39A 1Z92B 4Y7NL 1S24A 1LKMA 2V8UA 1VZIA 2NVXL 3PWQA 3E1MA 2CN7A 3AJPA 5M5XL 2JA6L 3BVFA 4AI2A 5I4JA 3KA9A 2ZG7X 5J9VA 2VZBA 1JIGA 2PSMC 2YJJA 6RXNA 1LB3A 3F36A 3Q4NA 5JKLA 4CMYA 2PVEA 1Z6OM 4AR6A 3EZUA 3ISEA 4LQHA 1BCFA 5K53A 3GTML 3HOVL 2R92L 1IU5A 1RCEA 1LTLA 2JI3A 4PGIA 1BFYA 5IP7L 3FSEA 3AK8A 2GMGA 3S1QL 2FZFA 4RC7B 1NFVA 4DYYA 2V8TA 4UY81 2PYBA 1BRFA 4II4B 1VLGA 5FLML 4RC6A 2V2OA 1IU6A 1LKOA 4AM5A 3LPEB 5ERJA 3BVLA 1F33A 3WVVA 5EINC 2XJRA 2H12A 4Z3BA 2EY4E 5D8YA 3SE1A 2Z5QA 4B8CD 1RB9A 2HVYC 5LS9A 4LQJA 2BW1A 2V2NA 1ODHA 1XZ3A 4MN9A 1RYQA 3U90A 2G4HA 4RXNA 2WTLA 3ISFA 3NOZX 2QL0A 1TKOA 1FHHA 4M32A 1R0GA 4TPUA 1UVHA 4C3HL 3LWQB 4GS7D 3KA6A 1RCIA 2CWLA 4DASA 4AHXA 1T9PA 1R03A 1S2ZA 4A3FL 4EVBA 5FFDA 4XGSA 3N6OA 2JD70 3EGMA 3WWLA 1VJXA 1T9OA 3AJOA 2LCQA 2Z5PA 4IXKA 1L8HA 5IP9L 5GADc 4DYUA 4A3CL 1NF4A 1SMMA 4E6KA 3SHXA 1QGHA 4RC8A 1YUXA 1SFOL 5M3FL 3WWNB 2CHPA 4AR5A 4YXJA 1TK6A 2FHAA 2PVXA 3BT5A 3RAVA 4E6YA 2FG4A 3D19A 3EZ0A 3R2LA 1RYTA 3RD0A 1NXEA 1BQ8A 5J93A 4PG0A 1E8JA 1RDGA 1RDVA 1IROA 4RC5A 3GGZA 2BKCA 3AJQA 5D8SA 2C2FA 5IY0A 3AF7X 1TKPA 3WVWA 2VXIA 3VVAA 4MY7A 3RYGA 5GAHc 3HJYB 4TOGA 4XKSA 3MSUA 4DZ0A 1AEWA 4CVRA 2YW7A 4EVDA 1I3QL 2ZA8A 1SOFA 2ZG8X 2X170 1YK4A 5RXNA 2Y44A 2M6PA 5LG2A 3KYVA 1IESA 5D8OA 4MXPA 3C1ZA 3BKNA 3PVYB 3RZDL 2ZA6A 3L0MA 5EIOC 5JKLG 3GTOL 1RCGA 3AF9X 2QQYA 1J30A 2V2JA 3A68A 3LWVB 3HOUL 5AN9H 4MUDA 2C6RA 3GVYA 3K35A 1VELA 4Z5SA 2AYJA 2B5ID 1BFRA 4ZKXA 2XJVA 5ERKA 2R93L 4V196 4QUWA 2XJOA 2ERJA 3E1LA 5CZUA 5HQOA 1BQ9A 1BE7A 3FDJA 1B2JA 4LHLA 3VNXA 5FFEA 4A3IL 2W0OA 5FFBA 3F38A 3KA3A 2DSXA 4ME3A 4LQNA 4BY1L 3HOWL 4AHZA 5FEJA 2V2SA 2IU2A 1JTSA 2FJCA 1FHAA 3V3KB 1S30A 1NNQA 3QHBA 3H99A 2AUSB 3I4ML 1R0FA 4M33A 4QIWP 2RBDA 2YW6A 1H7VA 5IYCL 4BBRL 2AQCA 4AI1A 2G38B 4TOAA 2VUML 4E40A 1TWFL 1GWGA 1B13A 1VEQA 5J8SA 1DPSA 5AI3A 3P2AA 2V0EA 4IWJA 3PL5A 3HOXL 3GTPL 1OWBA 3F37A 2IB0A 4RC6B 4X0JA 3W54A 1TWAL 4ZL6A 2BJYA 4CY9A 1BG7A 5FJ8L 3DBYA 1R0HA 2L0ZA 2V2PA 3H9CA 3CQZL 4AR4A 3VV9A 1HRSA 4ITWA 3R2OA 3R2RA 5GU2X 4DYZA 2QF9A 4LPNA 1MOJA 5IYBL 1C09A 3C23A 2E2HL 1VZHA 5D8XA 4ZMCA 2RDVA 3S1ML 4G6BA 1RCDA 3NP0X 4JAGA 2C41A 3QB9A 3UOFA 2A6ED 5J8WA 5DM61 3QD8A 2CLUA 4PGKA 2V2LA 4BXXL 4BY7L 3E1QA 2MS3A 4ZTTA 3PO2L 3JR7A 2O5JD 3BVIA 3PVTA 3PW8C 3NFPI 3M3YL 2HTNA 5H1Sc 4YWLA 3S14L 1DVBA 4KVSA 2F7NA 2PYAA 4JAEA 4AHWA 4C3IL 4AI3A 3PW8A 3KXUA 4M35A 1B2OA 2JD60 2M4VA 4ZN1B 3LNLA 1KRQA 5JACA 5MF6A 5C4JL 4X6AL 5E2DA 3UFBA 3S1NL 3F33A 2XJUA 7RXNA 4C3JL 3GTQL 4RC5B 3SS2A 4AR3A 2A68D 4C2M1 3S2HL 2MGYA 2CEIA 1JYBA 1XZ1A 4ZKWA 1F4LA 3HIUA 5MFZA 1VZGA 4LHNA 1JGCA 2NVQL 2JA5L 5JVH1 2ZG9X 3LWPB 3C21A 2NYDA 3E1OA 2AR0A 4KVQA 1QQTA 3H7GA 3E2CA 2V2RA 3R2KA 3S2DL 1YV1A 3PVRA 3PO3L 3E1JA 5C3EL 4A3BL 3H9BA 4A3JL 4PG1A 4WJG4 5HJHA 4K9FA 3FRRA 5IX6A 3ERZA 5FFCA 4JADA 5MGNA 2JI1A 3IS7A 2R7ZL 1P7PA 1ZRPA 4KXRB 4ISMA 5AXSA 2CKCA 4OYNA 2KKDA 3RZOL 5MLC3 1DATA 4POGA 3BVEA 3KA8A 3K7AL 3LWOB 4A93L 2Z5RA 4AI0A 8RXNA 5DM71 2IY4A 3VPBE 3KYXA 4Y08A 1SMUA 2XJTA 5C6FA 4LPJA 3QVDA 5IYDL 2OKCA 2UX1A 1K83L
chains in the Genus database with same CATH topology
1O9IA 3RE7A 3F35A 1FHMA 3PIO1 3PWFA 1OTKA 3LKDA 2M4YA 3UNOA 4XGHA 2ZA7A 2ZIXA 2BE5D 5K2ME 3HL1A 3SIDA 3GE4A 4DYXA 1UMNA 1JREA 4M34A 2XJSA 3SH6A 4KVRA 5AI2A 2FFXJ 3PIP1 3FRSA 1IRNA 5LBHA 1JI5A 2V2MA 2YJKA 3QHCA 4U3GA 4YXMA 3FI6A 4WFN1 5E1UA 2V0FA 3E1NA 5GU0X 2OH3A 4AM4A 2KN9A 4LYUA 3BVKA 1L8IA 4DI0A 4TO9A 4U671 5K52A 3KHKA 3IS8A 4DE6A 2XJMA 3Q4RA 1B71A 4TOCA 4LYXA 2VL6A 5HJFA 3ZG6A 2FL0A 1O9RA 2Z3QB 4AM2A 1F30A 2WWXB 2CN6A 4LQVA 4TVMA 1DX8A 4YVZA 2BK6A 1CADA 1TJOA 3FVBA 3PW1B 3Q4QA 5GN8A 4LPMA 3PVTB 4TW3A 4ITTA 3KA4A 2C2UA 4ERUA 2FG8A 4ML5A 3JZAB 3TA8A 1EUMA 3IQ1A 4W4LB 1CAAA 2K2DA 2Y3QA 4EVCA 3OGHA 2A69D 3T9JA 3UOIA 3QQCE 4REUA 3PW1A 4EVEA 4TODA 2VXXA 5D8QA 2Z3RB 3WVUA 5LG8A 1Z6OA 2OC5A 2J9UB 1QCVA 3J7Y1 4CVPA 3GHQA 2C2JA 4ZL5A 5MFPA 1IW7D 5GU3X 4CYBA 4XXBB 2Z6MA 2ZURX 2ERSA 3KYWA 3F32A 1MFRA 3R2SA 4P18A 4RC7A 2N02A 4TOFA 3O7SA 2XGWA 3Q4OA 1OWCA 5GAEc 4YWMA 3A44A 4II4A 1QYBA 1JI4A 1JKUA 1JKVA 2XKQA 1R0JA 3MPSA 4XKTA 5FFAA 3OJ5A 3RGDA 4TOEA 2A6HD 2WLAA 4XKUA 1T9QA 3JZ9A 3C1YA 2ITBA 2XJNA 2CR8A 3AK9A 5CMRA 4TOBA 3A9QA 3PVRB 5HU6D 4R42A 2GS4A 4YKHA 3KYUA 3QZ3A 1NF6A 3J7Z1 5GOUA 3KX9A 1ZUJA 4ISPA 4ETRA 1VCXA 2HR5A 4IWKA 1R0IA 5GAGc 3WNWA 3PKJA 2Z90A 3E6RA 4CVTA 2V3BB 1YUZA 3B0AB 5JKMG 1NXGA 2V15A 4MJYA 3PZAA 5GU1X 4ZKHA 2CHIA 2JI2A 4ZJKA 3PKIA 4W4KB 1VEIA 3IU3I 2XJPA 2JD80 4POFA 3AF8X 5JVG1 2V2IA 3R2HA 1YK5A 3KYYA 4ZLWA 3E1PA 3E6SA 2PPTA 2XJQA 2CF7A 1IERA 2CLBA 5JDOB 1RWDA 4ZN3B 1LKPA 1Z4AA 3ES3A 3GGYA 4AHYA 5D8PA 4CYAA 2D5KA 3KWOA 4A25A 4JAFA 3RZ6A 3RZTA 2C6AA 2WLUA 3O7RA 3P8BA 5D8RA 5JKMA 5CMQA 3B08B 2CKAA 3KDQA 4CMYV 3M6JA 5JDOA 4TOHA 2CIHA 1WJVA 4CVSA 2C6BA 3RBCA 2GYDA 2M6OA 3NP2X 1RCCA 1ZS3A 2FKZA 4MKUA 3PVYA 3R2MA 1SQ3A 3PWQC 1S3QA 1N1QA 3F34A 5GN8B 2GYQA 1SMWA 1H96A 3F39A 1Z92B 1S24A 1LKMA 2V8UA 1VZIA 3PWQA 3E1MA 2CN7A 3AJPA 3BVFA 4AI2A 5I4JA 3KA9A 2ZG7X 5J9VA 2VZBA 1JIGA 2PSMC 2YJJA 6RXNA 1LB3A 3F36A 3Q4NA 5JKLA 4CMYA 2PVEA 1Z6OM 4AR6A 3EZUA 3ISEA 4LQHA 1BCFA 5K53A 1IU5A 1RCEA 1LTLA 2JI3A 4PGIA 1BFYA 3FSEA 3AK8A 2GMGA 2FZFA 4RC7B 1NFVA 4DYYA 2V8TA 4UY81 2PYBA 1BRFA 4II4B 1VLGA 4RC6A 2V2OA 1IU6A 1LKOA 4AM5A 3LPEB 5ERJA 3BVLA 1F33A 3WVVA 5EINC 2XJRA 2H12A 4Z3BA 5D8YA 3SE1A 2Z5QA 4B8CD 1RB9A 5LS9A 4LQJA 2BW1A 2V2NA 1ODHA 1XZ3A 4MN9A 1RYQA 3U90A 2G4HA 4RXNA 2WTLA 3ISFA 3NOZX 2QL0A 1TKOA 1FHHA 4M32A 1R0GA 4TPUA 1UVHA 4GS7D 3KA6A 1RCIA 2CWLA 4DASA 4AHXA 1T9PA 1R03A 1S2ZA 4EVBA 5FFDA 4XGSA 3N6OA 2JD70 3EGMA 3WWLA 1VJXA 1T9OA 3AJOA 2LCQA 2Z5PA 4IXKA 1L8HA 5GADc 4DYUA 1NF4A 1SMMA 4E6KA 3SHXA 1QGHA 4RC8A 1YUXA 3WWNB 2CHPA 4AR5A 4YXJA 1TK6A 2FHAA 2PVXA 3BT5A 3RAVA 4E6YA 2FG4A 3D19A 3EZ0A 3R2LA 1RYTA 3RD0A 1NXEA 1BQ8A 5J93A 4PG0A 1E8JA 1RDGA 1RDVA 1IROA 4RC5A 3GGZA 2BKCA 3AJQA 5D8SA 2C2FA 5IY0A 3AF7X 1TKPA 3WVWA 2VXIA 3VVAA 4MY7A 3RYGA 5GAHc 4TOGA 4XKSA 3MSUA 4DZ0A 1AEWA 4CVRA 2YW7A 4EVDA 2ZA8A 1SOFA 2ZG8X 2X170 1YK4A 5RXNA 2Y44A 2M6PA 5LG2A 3KYVA 1IESA 5D8OA 4MXPA 3C1ZA 3BKNA 3PVYB 2ZA6A 3L0MA 5EIOC 5JKLG 1RCGA 3AF9X 2QQYA 1J30A 2V2JA 3A68A 5AN9H 4MUDA 2C6RA 3GVYA 3K35A 1VELA 4Z5SA 2AYJA 2B5ID 1BFRA 4ZKXA 2XJVA 5ERKA 4V196 4QUWA 2XJOA 2ERJA 3E1LA 5CZUA 5HQOA 1BQ9A 1BE7A 4LHLA 1B2JA 3VNXA 5FFEA 2W0OA 5FFBA 3F38A 3KA3A 2DSXA 4ME3A 4LQNA 4AHZA 5FEJA 2V2SA 2IU2A 1JTSA 2FJCA 1FHAA 3V3KB 1S30A 1NNQA 3QHBA 1R0FA 4M33A 2RBDA 2YW6A 1H7VA 4AI1A 2G38B 4TOAA 4E40A 1GWGA 1B13A 1VEQA 5J8SA 1DPSA 5AI3A 3P2AA 2V0EA 4IWJA 1OWBA 3F37A 2IB0A 4RC6B 4X0JA 3W54A 4ZL6A 2BJYA 4CY9A 1BG7A 3DBYA 1R0HA 2L0ZA 2V2PA 4AR4A 3VV9A 1HRSA 4ITWA 3R2OA 3R2RA 5GU2X 4DYZA 2QF9A 4LPNA 1MOJA 1C09A 3C23A 1VZHA 5D8XA 4ZMCA 2RDVA 4G6BA 1RCDA 3NP0X 4JAGA 2C41A 3QB9A 3UOFA 2A6ED 5J8WA 5DM61 3QD8A 2CLUA 4PGKA 2V2LA 3E1QA 2MS3A 4ZTTA 2O5JD 3BVIA 3PVTA 3PW8C 3NFPI 2HTNA 5H1Sc 4YWLA 1DVBA 4KVSA 2F7NA 2PYAA 4JAEA 4AHWA 4AI3A 3PW8A 3KXUA 4M35A 1B2OA 2JD60 2M4VA 4ZN1B 3LNLA 1KRQA 5JACA 5MF6A 5E2DA 3UFBA 3F33A 2XJUA 7RXNA 4RC5B 3SS2A 4AR3A 2A68D 2MGYA 2CEIA 1JYBA 1XZ1A 4ZKWA 3HIUA 5MFZA 1VZGA 4LHNA 1JGCA 5JVH1 2ZG9X 3C21A 2NYDA 3E1OA 2AR0A 4KVQA 3H7GA 3E2CA 2V2RA 3R2KA 1YV1A 3PVRA 3E1JA 4PG1A 4WJG4 5HJHA 4K9FA 3FRRA 5IX6A 3ERZA 5FFCA 4JADA 5MGNA 2JI1A 3IS7A 1ZRPA 4KXRB 4ISMA 5AXSA 2CKCA 4OYNA 2KKDA 5MLC3 1DATA 4POGA 3BVEA 3KA8A 2Z5RA 4AI0A 8RXNA 5DM71 2IY4A 3VPBE 3KYXA 4Y08A 1SMUA 2XJTA 5C6FA 4LPJA 3QVDA 2OKCA 2UX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O9I A;  3RE7 A;  3F35 A;  1FHM A;  3PWF A;  1OTK A;  2M4Y A;  3UNO A;  2ZA7 A;  3HL1 A;  3SID A;  3GE4 A;  4DYX A;  1UMN A;  1JRE A;  4M34 A;  3SH6 A;  4KVR A;  5AI2 A;  2FFX J;  1IRN A;  5LBH A;  1JI5 A;  2V2M A;  2YJK A;  3QHC A;  4U3G A;  3FI6 A;  5E1U A;  3E1N A;  5GU0 X;  2OH3 A;  4AM4 A;  2KN9 A;  4LYU A;  3BVK A;  1L8I A;  4DI0 A;  4TO9 A;  5K52 A;  3IS8 A;  4DE6 A;  2XJM A;  3Q4R A;  1B71 A;  4TOC A;  4LYX A;  2VL6 A;  5HJF A;  2FL0 A;  1O9R A;  4AM2 A;  1F30 A;  2CN6 A;  4LQV A;  1DX8 A;  2BK6 A;  1CAD A;  1TJO A;  3FVB A;  3PW1 B;  3Q4Q A;  5GN8 A;  4LPM A;  3PVT B;  4TW3 A;  4ITT A;  3KA4 A;  2C2U A;  4ERU A;  2FG8 A;  4ML5 A;  3TA8 A;  1EUM A;  3IQ1 A;  1CAA A;  2K2D A;  2Y3Q A;  4EVC A;  3OGH A;  3T9J A;  3UOI A;  4REU A;  3PW1 A;  4EVE A;  4TOD A;  2VXX A;  5D8Q A;  3WVU A;  5LG8 A;  1Z6O A;  2OC5 A;  1QCV A;  4CVP A;  3GHQ A;  2C2J A;  4ZL5 A;  5GU3 X;  4CYB A;  2Z6M A;  2ZUR X;  3KYW A;  3F32 A;  1MFR A;  3R2S A;  4P18 A;  4RC7 A;  4TOF A;  3O7S A;  2XGW A;  3Q4O A;  4YWM A;  3A44 A;  4II4 A;  1QYB A;  1JI4 A;  1JKU A;  1JKV A;  2XKQ A;  1R0J A;  3MPS A;  4XKT A;  5FFA A;  3OJ5 A;  3RGD A;  4TOE A;  2WLA A;  4XKU A;  1T9Q A;  2ITB A;  2XJN A;  3AK9 A;  5CMR A;  4TOB A;  3A9Q A;  3PVR B;  4R42 A;  2GS4 A;  4YKH A;  3KYU A;  3QZ3 A;  1NF6 A;  5GOU A;  3KX9 A;  1ZUJ A;  4ISP A;  4ETR A;  1VCX A;  2HR5 A;  4IWK A;  1R0I A;  3WNW A;  2Z90 A;  3E6R A;  4CVT A;  2V3B B;  1YUZ A;  5JKM G;  2V15 A;  4MJY A;  3PZA A;  5GU1 X;  4ZKH A;  2CHI A;  4ZJK A;  1VEI A;  4POF A;  2JD8 0;  3AF8 X;  2V2I A;  3R2H A;  1YK5 A;  3KYY A;  4ZLW A;  3E1P A;  3E6S A;  2CF7 A;  1IER A;  2CLB A;  1RWD A;  1LKP A;  1Z4A A;  3ES3 A;  5D8P A;  4CYA A;  2D5K A;  3KWO A;  4A25 A;  3RZ6 A;  3RZT A;  2WLU A;  3O7R A;  5D8R A;  5JKM A;  5CMQ A;  4CMY V;  4TOH A;  2CIH A;  4CVS A;  3RBC A;  2GYD A;  3NP2 X;  1RCC A;  1ZS3 A;  2FKZ A;  4MKU A;  3PVY A;  3R2M A;  1SQ3 A;  3PWQ C;  1S3Q A;  1N1Q A;  3F34 A;  5GN8 B;  2GYQ A;  1SMW A;  1H96 A;  3F39 A;  1S24 A;  1LKM A;  3PWQ A;  3E1M A;  2CN7 A;  3AJP A;  3BVF A;  5I4J A;  3KA9 A;  2ZG7 X;  5J9V A;  2VZB A;  1JIG A;  2YJJ A;  6RXN A;  1LB3 A;  3F36 A;  3Q4N A;  5JKL A;  4CMY A;  2PVE A;  1Z6O M;  4AR6 A;  3EZU A;  3ISE A;  4LQH A;  1BCF A;  5K53 A;  1IU5 A;  1RCE A;  1LTL A;  4PGI A;  1BFY A;  3FSE A;  3AK8 A;  2GMG A;  2FZF A;  4RC7 B;  1NFV A;  4DYY A;  2PYB A;  1BRF A;  4II4 B;  1VLG A;  4RC6 A;  2V2O A;  1IU6 A;  1LKO A;  4AM5 A;  5ERJ A;  3BVL A;  1F33 A;  3WVV A;  4Z3B A;  5D8Y A;  3SE1 A;  2Z5Q A;  1RB9 A;  5LS9 A;  4LQJ A;  2BW1 A;  2V2N A;  1XZ3 A;  4MN9 A;  3U90 A;  2G4H A;  4RXN A;  2WTL A;  3ISF A;  3NOZ X;  2QL0 A;  1TKO A;  1FHH A;  4M32 A;  1R0G A;  4TPU A;  1UVH A;  3KA6 A;  1RCI A;  4DAS A;  1T9P A;  1R03 A;  1S2Z A;  4EVB A;  5FFD A;  4XGS A;  2JD7 0;  3EGM A;  1VJX A;  1T9O A;  3AJO A;  2LCQ A;  2Z5P A;  4IXK A;  1L8H A;  4DYU A;  1NF4 A;  1SMM A;  4E6K A;  3SHX A;  1QGH A;  4RC8 A;  1YUX A;  2CHP A;  4AR5 A;  1TK6 A;  2FHA A;  2PVX A;  3BT5 A;  3RAV A;  2FG4 A;  3EZ0 A;  3R2L A;  1RYT A;  3RD0 A;  1BQ8 A;  5J93 A;  4PG0 A;  1E8J A;  1RDG A;  1RDV A;  1IRO A;  4RC5 A;  2BKC A;  3AJQ A;  5D8S A;  2C2F A;  5IY0 A;  3AF7 X;  1TKP A;  3WVW A;  2VXI A;  3RYG A;  4MY7 A;  4TOG A;  4XKS A;  4DZ0 A;  1AEW A;  4CVR A;  2YW7 A;  4EVD A;  2ZA8 A;  1SOF A;  2ZG8 X;  2X17 0;  1YK4 A;  5RXN A;  5LG2 A;  3KYV A;  1IES A;  5D8O A;  3BKN A;  3PVY B;  2ZA6 A;  5JKL G;  1RCG A;  3AF9 X;  2QQY A;  1J30 A;  2V2J A;  3A68 A;  4MUD A;  2C6R A;  3GVY A;  1VEL A;  4Z5S A;  1BFR A;  4ZKX A;  5ERK A;  4QUW A;  2XJO A;  3E1L A;  5CZU A;  5HQO A;  1BQ9 A;  1BE7 A;  1B2J A;  3VNX A;  5FFE A;  2W0O A;  5FFB A;  3F38 A;  3KA3 A;  2DSX A;  4ME3 A;  4LQN A;  5FEJ A;  2V2S A;  2IU2 A;  1JTS A;  2FJC A;  1FHA A;  1S30 A;  1NNQ A;  3QHB A;  1R0F A;  4M33 A;  2RBD A;  2YW6 A;  1H7V A;  4TOA A;  1GWG A;  1B13 A;  1VEQ A;  5J8S A;  1DPS A;  5AI3 A;  4IWJ A;  3F37 A;  2IB0 A;  4RC6 B;  4ZL6 A;  2BJY A;  4CY9 A;  1BG7 A;  1R0H A;  2V2P A;  4AR4 A;  1HRS A;  4ITW A;  3R2O A;  3R2R A;  5GU2 X;  4DYZ A;  2QF9 A;  4LPN A;  1MOJ A;  1C09 A;  2RDV A;  5D8X A;  4ZMC A;  1RCD A;  3NP0 X;  2C41 A;  3QB9 A;  3UOF A;  5J8W A;  3QD8 A;  2CLU A;  4PGK A;  2V2L A;  3E1Q A;  2MS3 A;  4ZTT A;  3BVI A;  3PVT A;  3PW8 C;  2HTN A;  4YWL A;  1DVB A;  4KVS A;  2F7N A;  2PYA A;  3PW8 A;  3KXU A;  4M35 A;  1B2O A;  2JD6 0;  1KRQ A;  5JAC A;  5E2D A;  3F33 A;  7RXN A;  4RC5 B;  3SS2 A;  4AR3 A;  2CEI A;  1JYB A;  1XZ1 A;  4ZKW A;  3HIU A;  1JGC A;  2ZG9 X;  3E1O A;  4KVQ A;  3H7G A;  3E2C A;  2V2R A;  3R2K A;  1YV1 A;  3PVR A;  3E1J A;  4PG1 A;  5HJH A;  4K9F A;  5IX6 A;  3ERZ A;  5FFC A;  3IS7 A;  1ZRP A;  5AXS A;  4ISM A;  4OYN A;  2KKD A;  1DAT A;  4POG A;  3BVE A;  3KA8 A;  2Z5R A;  8RXN A;  2IY4 A;  3KYX A;  4Y08 A;  1SMU A;  5C6F A;  4LPJ A;  3QVD A;  2UX1 A; 
#chains in the Genus database with same CATH topology
 1O9I A;  3MQK B;  3RE7 A;  3F35 A;  1FHM A;  3PIO 1;  3PWF A;  1OTK A;  4A3E L;  3LKD A;  2M4Y A;  1Y1V L;  3UNO A;  4XGH A;  2ZA7 A;  2PMZ P;  2ZIX A;  2BE5 D;  5K2M E;  3HL1 A;  3SID A;  3GE4 A;  3HOZ L;  4DYX A;  1UMN A;  1JRE A;  4M34 A;  2XJS A;  3SH6 A;  4KVR A;  5AI2 A;  2FFX J;  3PIP 1;  3FRS A;  1IRN A;  5LBH A;  1JI5 A;  3FKI L;  2V2M A;  2YJK A;  3QHC A;  4U3G A;  4YXM A;  3FI6 A;  4WFN 1;  1PFV A;  2APO B;  3GTJ L;  5E1U A;  2V0F A;  3E1N A;  5GU0 X;  2E2J L;  4A3K L;  2OH3 A;  4AM4 A;  1I50 L;  2KN9 A;  4LYU A;  3BVK A;  1L8I A;  4DI0 A;  4A3M L;  4TO9 A;  4U67 1;  5K52 A;  3KHK A;  3IS8 A;  4DE6 A;  2XJM A;  3Q4R A;  1B71 A;  4TOC A;  4LYX A;  2VL6 A;  5HJF A;  3ZG6 A;  2FL0 A;  1O9R A;  2Z3Q B;  4AM2 A;  4AYB P;  1F30 A;  3HAX C;  2WWX B;  2CN6 A;  4LQV A;  4TVM A;  1I6H L;  1DX8 A;  4YVZ A;  2BK6 A;  1CAD A;  1TJO A;  3FVB A;  3PW1 B;  3Q4Q A;  5GN8 A;  4LPM A;  3HKZ P;  3PVT B;  4TW3 A;  4ITT A;  1PFU A;  3KA4 A;  2C2U A;  2WB1 P;  4ERU A;  3GTG L;  2FG8 A;  4ML5 A;  3JZA B;  1Y1W L;  3TA8 A;  1EUM A;  3IQ1 A;  4W4L B;  1CAA A;  2K2D A;  5M3M L;  2WAQ P;  2Y3Q A;  4EVC A;  5C4X L;  3S16 L;  3OGH A;  2A69 D;  3T9J A;  3UOI A;  3QQC E;  4REU A;  3PW1 A;  4EVE A;  4TOD A;  2VXX A;  5D8Q A;  2Z3R B;  1WCM L;  3WVU A;  5LG8 A;  1Z6O A;  2OC5 A;  2J9U B;  1QCV A;  3J7Y 1;  2NVY L;  4CVP A;  3GHQ A;  2C2J A;  4ZL5 A;  5MFP A;  1IW7 D;  5GU3 X;  4CYB A;  4XXB B;  1PZX A;  2Z6M A;  2ZUR X;  2ERS A;  3KYW A;  1TWC L;  3F32 A;  1MFR A;  2YU9 L;  3I4N L;  3R2S A;  4P18 A;  4RC7 A;  2N02 A;  4TOF A;  3O7S A;  2XGW A;  3Q4O A;  1OWC A;  5GAE c;  3S15 L;  4YWM A;  3A44 A;  4II4 A;  1QYB A;  1JI4 A;  1JKU A;  1JKV A;  2XKQ A;  1R0J A;  3MPS A;  5M5W L;  4XKT A;  5FFA A;  3OJ5 A;  3RGD A;  4TOE A;  3H3V M;  2A6H D;  2WLA A;  4XKU A;  1T9Q A;  3JZ9 A;  3C1Y A;  2ITB A;  2XJN A;  2CR8 A;  3AK9 A;  5CMR A;  4TOB A;  3A9Q A;  3PVR B;  5HU6 D;  1R9T L;  2NVT L;  4R42 A;  2GS4 A;  4YKH A;  3KYU A;  2E2I L;  3QZ3 A;  1NF6 A;  3J7Z 1;  5GOU A;  3KX9 A;  1ZUJ A;  4ISP A;  4ETR A;  1VCX A;  2HR5 A;  4IWK A;  2Y0S P;  1R0I A;  1TWG L;  5GAG c;  3WNW A;  3PKJ A;  2Z90 A;  2B63 L;  3E6R A;  4CVT A;  4A3L L;  1TWH L;  2V3B B;  1YUZ A;  3B0A B;  5JKM G;  2RFK B;  1NXG A;  2V15 A;  4Y52 L;  4MJY A;  3PZA A;  5GU1 X;  4ZKH A;  2CHI A;  2JI2 A;  4ZJK A;  3PKI A;  5C44 L;  1PFY A;  4W4K B;  1VEI A;  3IU3 I;  2XJP A;  2JD8 0;  4POF A;  3AF8 X;  5JVG 1;  4BBS L;  2V2I A;  3R2H A;  1YK5 A;  3KYY A;  4ZLW A;  3GTL L;  3E1P A;  3E6S A;  2PPT A;  2XJQ A;  2CF7 A;  1IER A;  2CLB A;  5JDO B;  1RWD A;  4ZN3 B;  1LKP A;  1Z4A A;  3ES3 A;  3GGY A;  4AHY A;  5D8P A;  4CYA A;  2D5K A;  3KWO A;  4A25 A;  4JAF A;  3RZ6 A;  3RZT A;  2C6A A;  2WLU A;  3O7R A;  4A3G L;  3P8B A;  5D8R A;  1PFW A;  5M5Y L;  5JKM A;  5CMQ A;  3B08 B;  3GTK L;  3S17 L;  2CKA A;  3KDQ A;  3H0G L;  2JA8 L;  4CMY V;  3M6J A;  5JDO A;  4TOH A;  2CIH A;  3LWR B;  1WJV A;  4CVS A;  2C6B A;  3RBC A;  2GYD A;  2M6O A;  4A3D L;  3HJW B;  3NP2 X;  3HOY L;  1RCC A;  1ZS3 A;  2FKZ A;  3H97 A;  4MKU A;  2JA7 L;  3S1R L;  3PVY A;  3R2M A;  1SQ3 A;  3PWQ C;  1S3Q A;  3M4O L;  1N1Q A;  3F34 A;  5GN8 B;  2GYQ A;  1SMW A;  1H96 A;  3F39 A;  1Z92 B;  4Y7N L;  1S24 A;  1LKM A;  2V8U A;  1VZI A;  2NVX L;  3PWQ A;  3E1M A;  2CN7 A;  3AJP A;  5M5X L;  2JA6 L;  3BVF A;  4AI2 A;  5I4J A;  3KA9 A;  2ZG7 X;  5J9V A;  2VZB A;  1JIG A;  2PSM C;  2YJJ A;  6RXN A;  1LB3 A;  3F36 A;  3Q4N A;  5JKL A;  4CMY A;  2PVE A;  1Z6O M;  4AR6 A;  3EZU A;  3ISE A;  4LQH A;  1BCF A;  5K53 A;  3GTM L;  3HOV L;  2R92 L;  1IU5 A;  1RCE A;  1LTL A;  2JI3 A;  4PGI A;  1BFY A;  5IP7 L;  3FSE A;  3AK8 A;  2GMG A;  3S1Q L;  2FZF A;  4RC7 B;  1NFV A;  4DYY A;  2V8T A;  4UY8 1;  2PYB A;  1BRF A;  4II4 B;  1VLG A;  5FLM L;  4RC6 A;  2V2O A;  1IU6 A;  1LKO A;  4AM5 A;  3LPE B;  5ERJ A;  3BVL A;  1F33 A;  3WVV A;  5EIN C;  2XJR A;  2H12 A;  4Z3B A;  2EY4 E;  5D8Y A;  3SE1 A;  2Z5Q A;  4B8C D;  1RB9 A;  2HVY C;  5LS9 A;  4LQJ A;  2BW1 A;  2V2N A;  1ODH A;  1XZ3 A;  4MN9 A;  1RYQ A;  3U90 A;  2G4H A;  4RXN A;  2WTL A;  3ISF A;  3NOZ X;  2QL0 A;  1TKO A;  1FHH A;  4M32 A;  1R0G A;  4TPU A;  1UVH A;  4C3H L;  3LWQ B;  4GS7 D;  3KA6 A;  1RCI A;  2CWL A;  4DAS A;  4AHX A;  1T9P A;  1R03 A;  1S2Z A;  4A3F L;  4EVB A;  5FFD A;  4XGS A;  3N6O A;  2JD7 0;  3EGM A;  3WWL A;  1VJX A;  1T9O A;  3AJO A;  2LCQ A;  2Z5P A;  4IXK A;  1L8H A;  5IP9 L;  5GAD c;  4DYU A;  4A3C L;  1NF4 A;  1SMM A;  4E6K A;  3SHX A;  1QGH A;  4RC8 A;  1YUX A;  1SFO L;  5M3F L;  3WWN B;  2CHP A;  4AR5 A;  4YXJ A;  1TK6 A;  2FHA A;  2PVX A;  3BT5 A;  3RAV A;  4E6Y A;  2FG4 A;  3D19 A;  3EZ0 A;  3R2L A;  1RYT A;  3RD0 A;  1NXE A;  1BQ8 A;  5J93 A;  4PG0 A;  1E8J A;  1RDG A;  1RDV A;  1IRO A;  4RC5 A;  3GGZ A;  2BKC A;  3AJQ A;  5D8S A;  2C2F A;  5IY0 A;  3AF7 X;  1TKP A;  3WVW A;  2VXI A;  3VVA A;  4MY7 A;  3RYG A;  5GAH c;  3HJY B;  4TOG A;  4XKS A;  3MSU A;  4DZ0 A;  1AEW A;  4CVR A;  2YW7 A;  4EVD A;  1I3Q L;  2ZA8 A;  1SOF A;  2ZG8 X;  2X17 0;  1YK4 A;  5RXN A;  2Y44 A;  2M6P A;  5LG2 A;  3KYV A;  1IES A;  5D8O A;  4MXP A;  3C1Z A;  3BKN A;  3PVY B;  3RZD L;  2ZA6 A;  3L0M A;  5EIO C;  5JKL G;  3GTO L;  1RCG A;  3AF9 X;  2QQY A;  1J30 A;  2V2J A;  3A68 A;  3LWV B;  3HOU L;  5AN9 H;  4MUD A;  2C6R A;  3GVY A;  3K35 A;  1VEL A;  4Z5S A;  2AYJ A;  2B5I D;  1BFR A;  4ZKX A;  2XJV A;  5ERK A;  2R93 L;  4V19 6;  4QUW A;  2XJO A;  2ERJ A;  3E1L A;  5CZU A;  5HQO A;  1BQ9 A;  1BE7 A;  3FDJ A;  1B2J A;  4LHL A;  3VNX A;  5FFE A;  4A3I L;  2W0O A;  5FFB A;  3F38 A;  3KA3 A;  2DSX A;  4ME3 A;  4LQN A;  4BY1 L;  3HOW L;  4AHZ A;  5FEJ A;  2V2S A;  2IU2 A;  1JTS A;  2FJC A;  1FHA A;  3V3K B;  1S30 A;  1NNQ A;  3QHB A;  3H99 A;  2AUS B;  3I4M L;  1R0F A;  4M33 A;  4QIW P;  2RBD A;  2YW6 A;  1H7V A;  5IYC L;  4BBR L;  2AQC A;  4AI1 A;  2G38 B;  4TOA A;  2VUM L;  4E40 A;  1TWF L;  1GWG A;  1B13 A;  1VEQ A;  5J8S A;  1DPS A;  5AI3 A;  3P2A A;  2V0E A;  4IWJ A;  3PL5 A;  3HOX L;  3GTP L;  1OWB A;  3F37 A;  2IB0 A;  4RC6 B;  4X0J A;  3W54 A;  1TWA L;  4ZL6 A;  2BJY A;  4CY9 A;  1BG7 A;  5FJ8 L;  3DBY A;  1R0H A;  2L0Z A;  2V2P A;  3H9C A;  3CQZ L;  4AR4 A;  3VV9 A;  1HRS A;  4ITW A;  3R2O A;  3R2R A;  5GU2 X;  4DYZ A;  2QF9 A;  4LPN A;  1MOJ A;  5IYB L;  1C09 A;  3C23 A;  2E2H L;  1VZH A;  5D8X A;  4ZMC A;  2RDV A;  3S1M L;  4G6B A;  1RCD A;  3NP0 X;  4JAG A;  2C41 A;  3QB9 A;  3UOF A;  2A6E D;  5J8W A;  5DM6 1;  3QD8 A;  2CLU A;  4PGK A;  2V2L A;  4BXX L;  4BY7 L;  3E1Q A;  2MS3 A;  4ZTT A;  3PO2 L;  3JR7 A;  2O5J D;  3BVI A;  3PVT A;  3PW8 C;  3NFP I;  3M3Y L;  2HTN A;  5H1S c;  4YWL A;  3S14 L;  1DVB A;  4KVS A;  2F7N A;  2PYA A;  4JAE A;  4AHW A;  4C3I L;  4AI3 A;  3PW8 A;  3KXU A;  4M35 A;  1B2O A;  2JD6 0;  2M4V A;  4ZN1 B;  3LNL A;  1KRQ A;  5JAC A;  5MF6 A;  5C4J L;  4X6A L;  5E2D A;  3UFB A;  3S1N L;  3F33 A;  2XJU A;  7RXN A;  4C3J L;  3GTQ L;  4RC5 B;  3SS2 A;  4AR3 A;  2A68 D;  4C2M 1;  3S2H L;  2MGY A;  2CEI A;  1JYB A;  1XZ1 A;  4ZKW A;  1F4L A;  3HIU A;  5MFZ A;  1VZG A;  4LHN A;  1JGC A;  2NVQ L;  2JA5 L;  5JVH 1;  2ZG9 X;  3LWP B;  3C21 A;  2NYD A;  3E1O A;  2AR0 A;  4KVQ A;  1QQT A;  3H7G A;  3E2C A;  2V2R A;  3R2K A;  3S2D L;  1YV1 A;  3PVR A;  3PO3 L;  3E1J A;  5C3E L;  4A3B L;  3H9B A;  4A3J L;  4PG1 A;  4WJG 4;  5HJH A;  4K9F A;  3FRR A;  5IX6 A;  3ERZ A;  5FFC A;  4JAD A;  5MGN A;  2JI1 A;  3IS7 A;  2R7Z L;  1P7P A;  1ZRP A;  4KXR B;  4ISM A;  5AXS A;  2CKC A;  4OYN A;  2KKD A;  3RZO L;  5MLC 3;  1DAT A;  4POG A;  3BVE A;  3KA8 A;  3K7A L;  3LWO B;  4A93 L;  2Z5R A;  4AI0 A;  8RXN A;  5DM7 1;  2IY4 A;  3VPB E;  3KYX A;  4Y08 A;  1SMU A;  2XJT A;  5C6F A;  4LPJ A;  3QVD A;  5IYD L;  2OKC A;  2UX1 A;  1K83 L; 
#chains in the Genus database with same CATH homology
 1O9I A;  3RE7 A;  3F35 A;  1FHM A;  3PIO 1;  3PWF A;  1OTK A;  3LKD A;  2M4Y A;  3UNO A;  4XGH A;  2ZA7 A;  2ZIX A;  2BE5 D;  5K2M E;  3HL1 A;  3SID A;  3GE4 A;  4DYX A;  1UMN A;  1JRE A;  4M34 A;  2XJS A;  3SH6 A;  4KVR A;  5AI2 A;  2FFX J;  3PIP 1;  3FRS A;  1IRN A;  5LBH A;  1JI5 A;  2V2M A;  2YJK A;  3QHC A;  4U3G A;  4YXM A;  3FI6 A;  4WFN 1;  5E1U A;  2V0F A;  3E1N A;  5GU0 X;  2OH3 A;  4AM4 A;  2KN9 A;  4LYU A;  3BVK A;  1L8I A;  4DI0 A;  4TO9 A;  4U67 1;  5K52 A;  3KHK A;  3IS8 A;  4DE6 A;  2XJM A;  3Q4R A;  1B71 A;  4TOC A;  4LYX A;  2VL6 A;  5HJF A;  3ZG6 A;  2FL0 A;  1O9R A;  2Z3Q B;  4AM2 A;  1F30 A;  2WWX B;  2CN6 A;  4LQV A;  4TVM A;  1DX8 A;  4YVZ A;  2BK6 A;  1CAD A;  1TJO A;  3FVB A;  3PW1 B;  3Q4Q A;  5GN8 A;  4LPM A;  3PVT B;  4TW3 A;  4ITT A;  3KA4 A;  2C2U A;  4ERU A;  2FG8 A;  4ML5 A;  3JZA B;  3TA8 A;  1EUM A;  3IQ1 A;  4W4L B;  1CAA A;  2K2D A;  2Y3Q A;  4EVC A;  3OGH A;  2A69 D;  3T9J A;  3UOI A;  3QQC E;  4REU A;  3PW1 A;  4EVE A;  4TOD A;  2VXX A;  5D8Q A;  2Z3R B;  3WVU A;  5LG8 A;  1Z6O A;  2OC5 A;  2J9U B;  1QCV A;  3J7Y 1;  4CVP A;  3GHQ A;  2C2J A;  4ZL5 A;  5MFP A;  1IW7 D;  5GU3 X;  4CYB A;  4XXB B;  2Z6M A;  2ZUR X;  2ERS A;  3KYW A;  3F32 A;  1MFR A;  3R2S A;  4P18 A;  4RC7 A;  2N02 A;  4TOF A;  3O7S A;  2XGW A;  3Q4O A;  1OWC A;  5GAE c;  4YWM A;  3A44 A;  4II4 A;  1QYB A;  1JI4 A;  1JKU A;  1JKV A;  2XKQ A;  1R0J A;  3MPS A;  4XKT A;  5FFA A;  3OJ5 A;  3RGD A;  4TOE A;  2A6H D;  2WLA A;  4XKU A;  1T9Q A;  3JZ9 A;  3C1Y A;  2ITB A;  2XJN A;  2CR8 A;  3AK9 A;  5CMR A;  4TOB A;  3A9Q A;  3PVR B;  5HU6 D;  4R42 A;  2GS4 A;  4YKH A;  3KYU A;  3QZ3 A;  1NF6 A;  3J7Z 1;  5GOU A;  3KX9 A;  1ZUJ A;  4ISP A;  4ETR A;  1VCX A;  2HR5 A;  4IWK A;  1R0I A;  5GAG c;  3WNW A;  3PKJ A;  2Z90 A;  3E6R A;  4CVT A;  2V3B B;  1YUZ A;  3B0A B;  5JKM G;  1NXG A;  2V15 A;  4MJY A;  3PZA A;  5GU1 X;  4ZKH A;  2CHI A;  2JI2 A;  4ZJK A;  3PKI A;  4W4K B;  1VEI A;  3IU3 I;  2XJP A;  2JD8 0;  4POF A;  3AF8 X;  5JVG 1;  2V2I A;  3R2H A;  1YK5 A;  3KYY A;  4ZLW A;  3E1P A;  3E6S A;  2PPT A;  2XJQ A;  2CF7 A;  1IER A;  2CLB A;  5JDO B;  1RWD A;  4ZN3 B;  1LKP A;  1Z4A A;  3ES3 A;  3GGY A;  4AHY A;  5D8P A;  4CYA A;  2D5K A;  3KWO A;  4A25 A;  4JAF A;  3RZ6 A;  3RZT A;  2C6A A;  2WLU A;  3O7R A;  3P8B A;  5D8R A;  5JKM A;  5CMQ A;  3B08 B;  2CKA A;  3KDQ A;  4CMY V;  3M6J A;  5JDO A;  4TOH A;  2CIH A;  1WJV A;  4CVS A;  2C6B A;  3RBC A;  2GYD A;  2M6O A;  3NP2 X;  1RCC A;  1ZS3 A;  2FKZ A;  4MKU A;  3PVY A;  3R2M A;  1SQ3 A;  3PWQ C;  1S3Q A;  1N1Q A;  3F34 A;  5GN8 B;  2GYQ A;  1SMW A;  1H96 A;  3F39 A;  1Z92 B;  1S24 A;  1LKM A;  2V8U A;  1VZI A;  3PWQ A;  3E1M A;  2CN7 A;  3AJP A;  3BVF A;  4AI2 A;  5I4J A;  3KA9 A;  2ZG7 X;  5J9V A;  2VZB A;  1JIG A;  2PSM C;  2YJJ A;  6RXN A;  1LB3 A;  3F36 A;  3Q4N A;  5JKL A;  4CMY A;  2PVE A;  1Z6O M;  4AR6 A;  3EZU A;  3ISE A;  4LQH A;  1BCF A;  5K53 A;  1IU5 A;  1RCE A;  1LTL A;  2JI3 A;  4PGI A;  1BFY A;  3FSE A;  3AK8 A;  2GMG A;  2FZF A;  4RC7 B;  1NFV A;  4DYY A;  2V8T A;  4UY8 1;  2PYB A;  1BRF A;  4II4 B;  1VLG A;  4RC6 A;  2V2O A;  1IU6 A;  1LKO A;  4AM5 A;  3LPE B;  5ERJ A;  3BVL A;  1F33 A;  3WVV A;  5EIN C;  2XJR A;  2H12 A;  4Z3B A;  5D8Y A;  3SE1 A;  2Z5Q A;  4B8C D;  1RB9 A;  5LS9 A;  4LQJ A;  2BW1 A;  2V2N A;  1ODH A;  1XZ3 A;  4MN9 A;  1RYQ A;  3U90 A;  2G4H A;  4RXN A;  2WTL A;  3ISF A;  3NOZ X;  2QL0 A;  1TKO A;  1FHH A;  4M32 A;  1R0G A;  4TPU A;  1UVH A;  4GS7 D;  3KA6 A;  1RCI A;  2CWL A;  4DAS A;  4AHX A;  1T9P A;  1R03 A;  1S2Z A;  4EVB A;  5FFD A;  4XGS A;  3N6O A;  2JD7 0;  3EGM A;  3WWL A;  1VJX A;  1T9O A;  3AJO A;  2LCQ A;  2Z5P A;  4IXK A;  1L8H A;  5GAD c;  4DYU A;  1NF4 A;  1SMM A;  4E6K A;  3SHX A;  1QGH A;  4RC8 A;  1YUX A;  3WWN B;  2CHP A;  4AR5 A;  4YXJ A;  1TK6 A;  2FHA A;  2PVX A;  3BT5 A;  3RAV A;  4E6Y A;  2FG4 A;  3D19 A;  3EZ0 A;  3R2L A;  1RYT A;  3RD0 A;  1NXE A;  1BQ8 A;  5J93 A;  4PG0 A;  1E8J A;  1RDG A;  1RDV A;  1IRO A;  4RC5 A;  3GGZ A;  2BKC A;  3AJQ A;  5D8S A;  2C2F A;  5IY0 A;  3AF7 X;  1TKP A;  3WVW A;  2VXI A;  3VVA A;  4MY7 A;  3RYG A;  5GAH c;  4TOG A;  4XKS A;  3MSU A;  4DZ0 A;  1AEW A;  4CVR A;  2YW7 A;  4EVD A;  2ZA8 A;  1SOF A;  2ZG8 X;  2X17 0;  1YK4 A;  5RXN A;  2Y44 A;  2M6P A;  5LG2 A;  3KYV A;  1IES A;  5D8O A;  4MXP A;  3C1Z A;  3BKN A;  3PVY B;  2ZA6 A;  3L0M A;  5EIO C;  5JKL G;  1RCG A;  3AF9 X;  2QQY A;  1J30 A;  2V2J A;  3A68 A;  5AN9 H;  4MUD A;  2C6R A;  3GVY A;  3K35 A;  1VEL A;  4Z5S A;  2AYJ A;  2B5I D;  1BFR A;  4ZKX A;  2XJV A;  5ERK A;  4V19 6;  4QUW A;  2XJO A;  2ERJ A;  3E1L A;  5CZU A;  5HQO A;  1BQ9 A;  1BE7 A;  4LHL A;  1B2J A;  3VNX A;  5FFE A;  2W0O A;  5FFB A;  3F38 A;  3KA3 A;  2DSX A;  4ME3 A;  4LQN A;  4AHZ A;  5FEJ A;  2V2S A;  2IU2 A;  1JTS A;  2FJC A;  1FHA A;  3V3K B;  1S30 A;  1NNQ A;  3QHB A;  1R0F A;  4M33 A;  2RBD A;  2YW6 A;  1H7V A;  4AI1 A;  2G38 B;  4TOA A;  4E40 A;  1GWG A;  1B13 A;  1VEQ A;  5J8S A;  1DPS A;  5AI3 A;  3P2A A;  2V0E A;  4IWJ A;  1OWB A;  3F37 A;  2IB0 A;  4RC6 B;  4X0J A;  3W54 A;  4ZL6 A;  2BJY A;  4CY9 A;  1BG7 A;  3DBY A;  1R0H A;  2L0Z A;  2V2P A;  4AR4 A;  3VV9 A;  1HRS A;  4ITW A;  3R2O A;  3R2R A;  5GU2 X;  4DYZ A;  2QF9 A;  4LPN A;  1MOJ A;  1C09 A;  3C23 A;  1VZH A;  5D8X A;  4ZMC A;  2RDV A;  4G6B A;  1RCD A;  3NP0 X;  4JAG A;  2C41 A;  3QB9 A;  3UOF A;  2A6E D;  5J8W A;  5DM6 1;  3QD8 A;  2CLU A;  4PGK A;  2V2L A;  3E1Q A;  2MS3 A;  4ZTT A;  2O5J D;  3BVI A;  3PVT A;  3PW8 C;  3NFP I;  2HTN A;  5H1S c;  4YWL A;  1DVB A;  4KVS A;  2F7N A;  2PYA A;  4JAE A;  4AHW A;  4AI3 A;  3PW8 A;  3KXU A;  4M35 A;  1B2O A;  2JD6 0;  2M4V A;  4ZN1 B;  3LNL A;  1KRQ A;  5JAC A;  5MF6 A;  5E2D A;  3UFB A;  3F33 A;  2XJU A;  7RXN A;  4RC5 B;  3SS2 A;  4AR3 A;  2A68 D;  2MGY A;  2CEI A;  1JYB A;  1XZ1 A;  4ZKW A;  3HIU A;  5MFZ A;  1VZG A;  4LHN A;  1JGC A;  5JVH 1;  2ZG9 X;  3C21 A;  2NYD A;  3E1O A;  2AR0 A;  4KVQ A;  3H7G A;  3E2C A;  2V2R A;  3R2K A;  1YV1 A;  3PVR A;  3E1J A;  4PG1 A;  4WJG 4;  5HJH A;  4K9F A;  3FRR A;  5IX6 A;  3ERZ A;  5FFC A;  4JAD A;  5MGN A;  2JI1 A;  3IS7 A;  1ZRP A;  4KXR B;  4ISM A;  5AXS A;  2CKC A;  4OYN A;  2KKD A;  5MLC 3;  1DAT A;  4POG A;  3BVE A;  3KA8 A;  2Z5R A;  4AI0 A;  8RXN A;  5DM7 1;  2IY4 A;  3VPB E;  3KYX A;  4Y08 A;  1SMU A;  2XJT A;  5C6F A;  4LPJ A;  3QVD A;  2OKC A;  2UX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...