3MQ0A

Crystal structure of agobacterium tumefaciens repressor blcr
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
251
structure length
243
Chain Sequence
b'SQISDTVPALRRAVRILDLVAGSPRDLTAAELTRFLDLPSAHGLLAVMTELDLLARSADGTLRIGPHSLRWANGFLSHLDIVSTFNDHLAQRHDLDPYTVTLTVREGGEVVYIGCRNHTFRIGMRLPAPFTATGKILLSDLGPGELRMLFSQFPQPLTSRSVAGLSQLEEELALTRARGYSIDDGQIREGMLCIGAAIRDYSGAASAGIAISLIRSEASDEKIAYLGEELRTTANALSEKLGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional repressor of the blcABC operon
publication title The Agrobacterium tumefaciens Transcription Factor BlcR Is Regulated via Oligomerization.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Transcription repressor
total genus 76
structure length 243
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
A PF09339 HTH_IclR IclR helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mq0A01
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mq0A02
3CUQB 3GO5A 2ZO4A 1ON2A 5HPIA 4CZZA 3ZN1A 3ZN0A 4HZFA 4KT5C 4JK1X 4LRXC 5HDGA 4B09A 2MBFA 1HW1A 1XGSA 3NOUC 2CGPA 1FZPB 1VTNC 4RGUA 4PGHA 2L01A 4Y3IA 2FF4A 3B02A 2DW4A 5ICGA 4M71A 1J7KA 1YTYA 3MZHA 5L3DA 4ZYEA 2ELHA 2FA5A 1G3WA 4IJGA 4IRIA 3IKVA 2B0LA 2UXXA 3J80Z 5TJJA 1IXRC 1XD7A 5BQTA 2M8EA 2IVMA 3RIRA 4FHTA 4M72A 4HLXA 2XKOA 2W1TB 3ISPA 1WSUA 4U0YA 1XMKA 3GFLA 1W7PA 1QGPA 1U5TB 2KRFA 5ILSA 2IA2A 3BPXA 2AS5F 1ZG5A 3JAMK 2LF7A 2W57A 3W6JB 2F5DA 1FNNA 3LQQA 4CO8A 2YX4A 2RGVA 4U88A 2EJRA 3KO6A 3RKXA 4PCQA 2QUFA 3RKYA 4HBLA 4E70A 2OZ6A 3WE3A 5ERIA 3DV8A 1FBUA 4R8HA 1O3SA 4CGZA 1ZRCA 1BOAA 3BDDA 2VBYA 3MMHA 1FYMA 4N9HA 4O3MA 4A6DA 5JI6A 2HKXA 2IP2A 3I64A 1T0FA 3KSGA 1F9NA 4G7OF 3K2ZA 2EV0A 5ILUA 5IT9K 2JTVA 2Y79A 3CUQC 1QO0D 5D5UB 1ZN2A 4HQEA 1USSA 2Z5UA 1MJBA 1ZREA 2GQQA 3T5XA 4IPAA 4B8XA 5DCMB 1YSPA 4R70A 4DNCA 3E0YA 3D0SA 3MAJA 1UB9A 5BS6A 3GF2A 4XLNF 4HA8A 4BHPA 3Q9VA 1W7PD 3EYIA 3FF5A 1R1TA 3M8FA 3ZMDA 2V6CA 3P7NA 2DPUA 1QBJA 2BYVE 3COAC 3ABUA 1JHFA 3P9KA 2VC0A 3ZMSA 1QQIA 2OU2A 4Y17A 2KJBA 3WE2A 2K4JA 3H3ZA 1ZGJA 2K2NA 2COMA 2O9AA 1LDKB 2UWMA 4KICA 5DDGA 1S7AA 3EETA 3TO9A 2K02A 1IRGA 4EGZA 1IN6A 1TNTA 3L09A 4YIFA 1KYWA 4Q47A 2PBIA 3F72A 1U5TC 2OZUA 3QPTA 3F8BA 2VXZA 3TOAA 3W2ZA 3HSFA 3BWGA 4RB0A 3R0AA 4RGRA 1XGNA 2EFPA 2MC3A 2CQKA 2MLGA 1F1ZA 5LEJA 4RS8A 3MEXA 4ZZDA 2AXLA 2P7VB 3G6OA 2DT5A 2W24A 4EU0A 4OU0A 1KA8A 1CGPA 1IZ1A 3E6BA 4EJVA 5FFXA 3K0LA 3M8EA 1R36A 4ZYGA 5E8GA 1IN5A 1JGSA 4G6DA 2NYXA 1UFMA 2JPBA 5FLXK 5K5QA 1KU2A 3P9CA 4AD9A 1O3QA 4PZJA 5E1WA 2ESNA 4MHGA 4S04A 2R7DA 2OOLA 3MCZA 4ZYDA 1ZHFA 2HGVA 1MC0A 3E5QA 3ZPLA 1OKRA 2MH2A 5LHHA 1FSEA 1KU3A 3TKYA 2ZXJA 1SD5A 4OIQF 3GLXA 3LA7A 2PMUA 4Y15A 1OYIA 4LB6B 2DTRA 1HKQA 1DDNA 2FMLA 1R22A 2GXBA 1EH6A 3TO7A 3KSFA 3RKWA 1KQ8A 2VE9A 1SAXA 2GA2A 4MEXF 4KDPA 3S7OA 5LGUA 5DD8A 1IN4A 4I0BA 3K1MA 1K78A 3LAJA 4HF2A 5JVTA 3VODA 3CDHA 1S6LA 4LGWA 1ONVA 4FX0A 4HAMA 2VOPA 2JSCA 1OYYA 1J0RA 2ZCWA 4IJAA 4WCGA 5EEHA 2NS0A 1F4KA 4M73A 4DN0A 2F2EA 4GYGA 2M5WA 1U8RA 2R3SA 1P92A 3F6OA 3HRTA 3M1EA 2GAUA 2PQ8A 1PDNC 3CUQA 4O5VA 3F8NA 3EQLF 3K1NA 4G7ZF 2YSRA 1T2KA 2HKOA 1QZZA 2O3FA 1Y0UA 3HSRA 2G9WA 4UUVA 2PFBA 3V7SA 3VB2A 4FOFA 2K27A 2A61A 1ZGAA 3GW2A 2EWNA 3RDIA 1J5YA 1SFXA 5L3FA 3F22A 4CYDA 1FWZA 4MTDA 5FD6A 3I5UA 2FEZA 2HS5A 3KLOA 4N0BA 4LLGF 5A2QZ 1UHMA 5LBQA 3V7CA 2A6EF 1XCVA 5DFYA 4ETSA 1X3UA 1XGOA 1W5SA 3DKWA 3CO7C 4ENMA 4PGGA 3ZP5A 2WTEA 3CLOA 1Z91A 2XAGA 5LHIA 3TOBA 3BJOA 2XAHA 4ENNA 4HQMA 2WC2A 2V9VA 4KIBA 4L9JA 3F21A 1KU7A 3TRCA 2QQ9A 2Z9OA 3E5UA 4IRGA 2H09A 4LMYA 3ZQ5A 4I01A 2QZ8A 5F64A 3WU0A 5ILVA 2V1DA 3IBJA 1U5TA 5L3CA 1EH8A 4A0XA 4EGYA 5H6QA 1Z1DA 4CICA 5D6FA 2H27A 1S8NA 3CO6C 2LF8A 3C7JA 4GGGA 5F6FA 3KCCA 5E17F 1XDSA 1YW9A 2O9CA 3H92A 2KIMA 4I2OA 2ADUA 2E1CA 3JSPA 4YNRA 3N4MA 1P6RA 1MJAA 2VOOA 2EV5A 4YFNF 4Z2YA 4RB1A 3DXJF 1G6NA 3FMSA 1ZG1A 1P4AA 2NAZA 4KN4X 1RZ4A 1ZH5A 4O01A 3IWFA 5CJ9A 5FFZA 4UVCA 4LG0B 4UV8A 2FU4A 1H9GA 2STWA 3R60A 4ON0A 2BBYA 4HOBA 4A12A 4U0VA 4IVNA 2M7UA 1MGTA 1SD7A 4R6LA 4Q0IA 4MTEA 1TTYA 1MJ9A 3E3VA 1VHMA 4HF0A 3BROA 5HDKA 1L0OC 2VE8A 3IWZA 3G73A 1P4XA 1SFEA 4UHTA 4BAYA 3LFVA 1GHCA 1WRJA 2IPQX 2HGCA 4L5IA 2YU3A 3J81Z 2EK5A 1FP2A 2Y0MA 2EFQA 2K86A 5JFRA 1R58A 3F8FA 2MLKA 3NQOA 3F6VA 3OBFA 4OINF 2A68F 2V79A 1BBYA 1BC8C 3SZTA 5D5WB 1IF1A 3QOPA 1MDMB 2KOIA 1U6GA 4AIJA 3HUGA 3KEOA 1SFUA 2JZYA 4P9UA 4CXFA 4IHTA 2HDCA 1W4MA 4ETXA 3GZ5A 4GYIA 1FPQA 4GO1A 4L9VA 5DUIA 2A69F 1KGSA 2STTA 1KQ9A 5D5XB 3W6KB 5EEGA 2EA2A 4WK8F 4HX4A 5LRRA 1MKMA 1TF1A 2DFIA 4D0PA 3ZMTA 1K7AA 4MGRA 3R61A 2CWEA 1HW2A 3GFIA 4EJUA 1Z7UA 3M7GA 4CDGA 4M74A 2HTSA 1XSXA 3JTGA 5FB2A 5ICFA 4G9YA 3DPTA 2O99A 2CG4A 4M9SA 3WTYC 4I09A 4HDVA 1PUEE 2RKHA 3WGGA 3ZMUA 3BJNA 6PAXA 5ED4A 3SFZA 4EM1A 1H0MA 1BI0A 3V8JA 4I7HA 3MQ0A 3SQNA 1FYKA 4QWQA 2ZMEB 3BJAA 1DP7P 1FC3A 2EV6A 4ESJA 5E1XA 1HSTA 3U1DA 4HDUA 1USTA 1Z6RA 1V4RA 4CQHA 1FBQA 2D2WA 1S29A 5H20A 2VN2A 5DV5A 3IRQA 3O5YA 3F8CA 4ZYHA 3P9IA 4I98B 1S3JA 3I59B 2OD5A 1LJ9A 2KJCA 1B59A 3HHHA 3FMQA 3GFMA 1XN7A 1LEAA 3VOEA 2CYYA 2F5FA 2JPCA 1I1GA 1TLHB 1KU9A 2ZFWA 4YFXF 3WTUC 1E17A 4HW0A 4AIHA 2Z99A 1OMIA 3VEPA 4TV7A 4P55A 4RB3C 2PN6A 2WV0A 5H6RA 2Y75A 2V1XA 4UVBA 5K1YA 3KSIA 1V3FA 5E18F 2TDXA 3C2WA 1R7JA 2XVCA 3OV8A 2YR2A 2EA4A 5E1ZB 2Z3YA 1T98A 1IRFA 4OMYA 3I0TA 1R5GA 3RYRA 4RAYA 2K31A 2DO7A 2HWVA 2QLZA 2XAFA 3QRFF 1KQ0A 3ABTA 1B9NA 3RYPA 3HRSA 1D8KA 3ELKA 4LK0F 3WTWC 1L3LA 2ZNYA 4Y13A 1W5TA 2QYBA 2D45A 5AJGA 5CYVA 2XROA 2LKPA 4U7BA 2L4MA 2CFXA 2ZKZA 1RNLA 2IW5A 3KSHA 2QBYB 2A07F 4KYWA 2F5CA 2GWRA 3HRMA 3JW4A 1YKDA 1YS7A 3D3OA 3FX3A 1SMTA 3DF8A 2VEAA 1SMYF 5D8LB 3CTAA 3MFKA 2BGCA 1ZG3A 1Z9CA 2KIUA 3TQNA 2XRNA 1RI7A 1HXDA 1TBXA 2O0YA 1GXQA 3HCYA 3ZMVA 1IXSB 3LAPA 2RC4A 2VONA 4CHUA 4LK1F 2DK8A 4S05A 4N9IA 4IXAA 3DBAA 4Q48A 1J9IA 1GVJA 1ZARA 2E7WA 4GLQA 3JAMZ 2FNAA 4MN7A 3RFBA 4MDZA 2RV8A 3GWZA 4Q0JA 4LB5A 3EYYA 5L3GA 1BN5A 3T8RA 2A3SA 2MD5A 4A2UA 1YLFA 3TDZC 2KIFA 2FOKA 1FX7A 5CVJA 3IL2A 1REPC 4KNYA 2G7HA 5HOOA 2XUBA 5HS8A 2IT0A 1JHHA 4LJZF 1BI1A 4G6QA 4PAUA 2VC1A 4XBFA 2HR3A 1FBSA 1LDJA 2E1NA 4I02A 3N97A 3NEUA 4LG0A 2K7LA 2P5LC 1DPUA 3B73A 4DQ2A 4NHJA 5IT9Z 2M7VA 5IT3A 1CF7A 2RNJA 1YW8A 1JE8A 3KP3A 1PP8F 2R7FA 5DCFA 1AWCA 3I54A 2KLIA 1F5MA 3V7RA 3I71A 4BQAA 4EQQA 2FXAA 2W1RA 5DFXA 2HYFA 3KP4A 4G94A 4EV0A 1RUNA 3VV4A 3HOTA 5BOXA 2O9BA 2CO5A 2UXNA 3L7WA 4NQWA 4YFKF 3HTSB 1MZBA 2XV4S 2A6HF 4IUKA 3KP6A 4KFCA 3GVAA 2P5KA 4JQFA 5LLQA 2QWWA 1AOYA 3QP6A 1G3TA 3WU1B 1UHWA 4G3KA 4F7ZA 3PFIA 3E97A 2RDPA 3J80K 1R23A 4EMSA 1ON1A 2A5YB 2OBPA 2P7CB 2BV6A 1KYZA 1XSVA 3VFZA 4HV6A 1BM9A 5JHUA 4EJTA 2L4AA 2L54A 3BOQA 2IJLA 1SD6A 1LQ1A 5K5OA 2CSOA 2DI3A 2DK5A 3RTRA 1J59A 1UCRA 3DQVC 1D8JA 3F3XA 4RQ9A 4L0YB 2W1TA 4BNCA 1YFHA 3HHGA 4BYYA 4KMFA 2O6GE 2HQNA 3QP5A 3L2CA 5KK1A 4G3WA 2X0LA 3QAHA 5JR3A 2IA0A 2G7UA 1U3EM 3R6SA 2W3HA 2P8TA 2XASA 2NNNA 2XGXA 3F8MA 5FLXZ 3IKTA 3CITA 3L9FA 1FP1D 2H94A 4A5MA 4HV5A 3H3UA 4LLLA 4KN7X 3K9TA 3SHFA 2PJPA 3V8KA 4XSZF 5D5VB 2MA3A 2PG4A 3K1PA 3AAFA 4XRFA 2LNBA 3GX4X 3HYIA 4WXCA 4XSXF 4JBAA 1LVAA 2QQAA 3JTHA 5TRDA 4E04A 3O6BB 5AIPA 2ZMEA 3ECHA 4G3VA 4Y2FA 1ZTUA 3IRRA 2JT1A 3S7QA 4HX8A 5E20A 2RVCA 4G8XA 2X4HA 3DPLC 1IUYA 2D1VA 1JXSA 4O0PA 2FBHA 3QU3A 1TQPA 3FXRA 4UV9A 4OIPF 1FOKA 2LDUA 4U7DA 1O3TA 5DCMA 3L00A 3I59A 4IF4A 3FXQA 4ENKA 1U78A 2HZTA 1C0WA 3GYHX 2XSSA 4EVIA 1IN8A 2L02A 2O61A 4G7HF 5LGTA 1ZYRF 4WXDA 5HL6A 1QNTA 3HTUA 3DP7A 1I27A 1A04A 2FRHA 2W84A 5J6XA 3WTZA 2E7XA 2F5EA 4HX7A 1B4AA 3FHZA 2HEOA 5FGMA 1BI3A 1XSDA 5CVRA 4KIFA 5L3BA 5FD5A 1B9MA 4MQVA 5BMZA 4OOIA 4L18B 4XLPF 4QLCU 4DMZA 2DAOA 5L8MA 3PQKA 3GXOA 3SXYA 2ACJA 4YG2F 1XGMA 4A0YA 3J7AO 5AIQA 1IAWA 2UZKA 5L3EA 4I0AA 5BPDA 3WTTC 1R1VA 1ODDA 2O03A 1XCBA 3KP2A 2VT2A 4BWIA 3EEAA 3MZYA 4M6YA 2W3DA 5HPFA 3OOVA 4A6EA 3R0JA 2VBZA 2FBKA 4IRHA 4EUVA 5E8IA 4BXUA 3V8LA 3ZQ7A 4KA4A 3U9GA 4YOFA 1O57A 2QBYA 3Q5FA 2YPRA 4L0ZB 1G3SA 1YW7A 1O7FA 4OIOF 5K5BA 4MMNA 1R5HA 1WQ2A 1ZRDA 3ULQB 5C5KA 4M9XA 2GXGA 5CVIA 3GUDA 4U0WA 2WWYA 1FT9A 3NOTC 4AWXB 1EH7A 1EV7A 5AONA 3KZYA 5DEQA 4GW9A 1HQCA 3DFGA 3K69A 2PI0A 3BP8A 2P6SA 3G3ZA 3CI6A 1B1BA 3ERED 2GX5A 4RGSA 3LA3A 2JRTA 2HQRA 2K4BA 2RQPA 2DQRA 3I53A 1RIOH 2FMYA 2W85A 5DUKA 1Z05A 3NOPC 4ESBA 4HF1A 4ZH4F 3LFKA 3CJNA 2OAZA 4Z1WA 2XKPA 2QYOA 2P5VA 2KKOA 3FWEA 1I6XA 3S7NA 3BZ6A 4ME4A 1YIOA 4L9NA 4ASNA 4R79A 2H6BA 2Q0OA 1U2WA 2EFNA 2D1HA 2VJWA 5J8FA 4ZRRA 4ESFA 1R00A 5HSQA 3RPUA 2L3DA 1K79A 1DUXC 3C3WA 2VODA 5HVQC 2LB5A 3LSTA 2NRAC 2Q2EA 1I1SA 4KIGA 1YG2A 5HS9A 3GZ6A 2FBIA 1G4DA 5D6EA 4RAZA 4ENJA 2OQGA 5LRSA 1TW3A 3I4PA 3ECOA 3LQRA 4L5JA 3WTVC 1TQIA 1ZLJA 1HKTA 2M45A 5CVUA 1HW5A 4WWCA 5A2QK 3MWMA 3D5LA 3OOPA 1NHAA 3TO6A 4OMZA 2ZJ2A 1O7LA 3HSEA 3F23A 2ISYA 1Q1HA 1ZAOA 1F5TA 4YIIA 4MEYF 3EDPA 5BPIA 3ML6A 2VZWA 1LB2A 1R1UA 4MNUA 3FZVA 1ULYA 2XAJA 3WG9A 3K2NA 2BEOA 2DBBA 3WTSC 1Z6TA 3LA2A 1G3YA 3EUHA 1OPCA 1T39A 1K6OA 3WTXC 3HIFA 3R4KA 5HLIA 4P96A 4EJOA 1YQAA 4KUMA 1IXCA 1W7PB 3RI4A 2HOEA 3E6MA 3I58A 1WWXA 1XB4A 4UVAA 4LD5A 2RN7A 2ZBKA 1YO5C 1IW7F 1ZRFA 1FYLA 5HLHA 4H0EA 1TW2A 4O8GA 1WI9A 3JSOA 2EB7A 4IUHA 5HS7A 3CUOA 3MF0A 4WX9A 5D8KB 4NB5A 1PP7U 3Q9SA 2MH9A 4QPRA 4RGXA 2J5PA 4EM2A 3E6CC 1T6SA 4R1HA 3DEUA 1FY7A 2DU9A 5J8CA 1STZA 2LSOA 4OIRF 1TNSA 4EJWA 3KLNA 2Q8KA 3IBRA 1J2XA 2LB9A 4Q4ZF 2J5OA 1E2XA 2YX7A 4FX4A 5LBRA 2DLLA 2ZNZA 1XMAA 2XAQA 2IA1A 5ICCA 3KP5A 2FE3A 1OR7A 4EM0B 1SD4A 3QPHA 4O6JA 3FM3A 3BY6A 2ZMFA 1LEBA 2GA1A 4LRZE 2O8XA 3M9AA 3HOSA 3ROUA 2ISZA 4Q0HA 3TDUC 4WXHA 3SZPA 3KE2A 3J81K 2DQLA 2FQ3A 2QVOA 2M1BA 2VT3A 2W25A 3WGHA 1BJAA 3FM5A 2V1UA 4LRYC 4KMUX 4MCWA 1DPRA 3RPQA 1HBXG 2W3EA 1IN7A 1QPMA 5FO5A 2QM3A 3PQJA 4ZZLA 2VBWA 1GXPA 3BPVA 2EFOA 1WKMA 1O3RA 2HYGD 3NRVA 5D4RA 4RB2C 2XHKA 4LFUA 3QU6A 2HTJA 2VBXA 3S2WA 2M87A 3T1BA 3RJPA 1ZLKA 1MDMA 3E6DA 3HRUA 4IHSA 2GZWA 4GCVA 3C18A 1TD5A 1P4WA 1D5VA 3U2RA 3T0YA 5F1RA 3NHQA 2B18A 1P2FA 4AVPA 3IHUA 4GXOA 3O2PE 1QZYA 3T8TA 2Y8HA 4AIKA 3ZMZA 3KZZA 4A0ZA 3WGIA 1YSQA 2QQBA 1HSJA 1I5ZA 1OYWA 5LHGA 1RUOA 2P4WA 5KVRA 2Z33A 4K2EA 1T38A 2C6YA 3FMRA 5I5LA 1LNWA 4BHCA 5LEKA 1FLIA 2ESHA 2HFHA 3WODF 4M9ZA 1YS6A 4WF2A 2VKSA 5CVVA 1TQMA 1YYVA 2FSWA 1XDUA 2CW0F 4BHBA 4MQ9F 1BI2A 2PMHA 4PDKA 4Y5FA 4FT8A 1BIBA 2FNPA 1S7OA 2EFWA 2XIGA 2W3GA 1B6AA 2PLYA 4LLNA 1J75A 3GEZA 4UNOA 2DPDA 3E5XA 4M6XA 1D3YA 2NNYA 1HKSA 4Q5SF 2OA4A 5CLSA 3KP7A 3V4GA 2H6CA 1BIAA 5D4SA 3E98A 4L9TA 2P6TA 2OQRA 4UXNA 1K78B 3BJ6A 5HLGA 4HYEA 2ETHA 3KFWX 5DYMA 3KETA 3GFJA 5K5RA 2BE5F 4ETZA 5HDNA 5DD4A 2GIVA 3KEQA 4HLYA 2QENA 1BC7C 2Y48A 3IC7A 4P9FA 2PEXA 3REOA 1CF7B 3TGNA 1FSHA 4A5NA 3O3KA 2W3FA 5LGNA 3FXUA 2IRFG 1LDDA 3C1DA 3LWFA 1H9TA 5ICEA 4BH9A 3S7PA 1MD0A 4P5OA 2M30A
chains in the Genus database with same CATH superfamily
2PX9A 3CUQB 3GO5A 2ZO4A 3K4KA 4BE2A 1ON2A 4L9EA 5HPIA 3SH7A 4CZZA 3ZN1A 2CV1A 2VGJA 4PMAA 3ZN0A 2B02A 1R4MB 1TZLA 3GMEA 4HZFA 4KT5C 4JK1X 4LRXC 2TCTA 1FCOA 5HDGA 3N05A 3SDBA 4DYCA 3KEYA 4S2MA 1AKHA 4KZ7A 4KZ3A 1JTYA 2G2UA 1MPLA 2XF6A 1NWZA 4EEFG 1E3UA 4B09A 5HDSA 2VPLA 2NXNB 1IEMA 3L2VA 5CX7A 2MBFA 2RREA 2HU9A 4QY5A 3VOLA 4F3QA 3IH4A 1XJ6A 1UMQA 2X01A 1LL5A 4A93J 1HW1A 3WS5A 4EV4A 2OTLI 1XGSA 1P9RA 3OMYA 1OLTA 3NOUC 3ABMH 2CGPA 3PO3J 2KMUA 5J3LA 4M6VA 4B3AA 3WG7H 1FZPB 1LSVA 3K3CA 1VTNC 3IF6C 4RGUA 4PGHA 4QIWN 4BBTA 1JUPA 4BUPA 3QNCA 1RR7A 1N9LA 1L0GA 2CMNA 4Z9QA 5CQEA 2JA8J 2L01A 4Y3IA 3UR3C 2FF4A 3B02A 4B1RA 2DW4A 3L1PA 3LIBA 1S67L 5D3OA 1Y8RB 4GHIB 1ETYA 1T56A 5ICGA 4DOZA 1FOXA 4M71A 1N75A 5DM6F 1J7KA 1MH4A 2FFFB 2W0NA 1YTYA 5M5YJ 4OWRB 1RGYA 4YFMA 2DMTA 3MZHA 4F3LA 4EETB 4DDYA 5HDCA 3LUQA 2KL4A 5L3DA 4BDYA 1TWHJ 1YOVB 3LR0A 3M3YJ 3FBNB 3ESWB 2R7TA 5KNLA 4ZYEA 4OOMA 2ELHA 3EOIA 2FA5A 4JGOA 3V3RA 1G3WA 3SFIA 4IJGA 2A49A 4IRIA 1ZG4A 2LMDA 2CC1A 3IKVA 2B0LA 2WZXA 2Z6CA 3O87A 4KQQA 2UXXA 2JVHA 4JX4A 5FDHA 1BA5A 3Q1FA 3J80Z 3CZDA 4FCYA 5TJJA 3HOWJ 1IXRC 4GCZA 4MN6A 3H7WB 1XD7A 3PBOA 2HYJA 3ZG0A 2DDAA 1PI4A 3TG9A 2XPWA 2HQAA 2WB1N 5BQTA 1K4TA 2M8EA 2IVMA 3RIRA 1IKGA 4FHTA 3PHYA 4NC8A 4M72A 4HLXA 2XKOA 3GTOJ 2W1TB 1SHVA 1TDGA 3ISPA 4LIVA 4U0YA 4MLOA 1XMKA 3GFLA 1WSUA 2HXIA 3IH8A 1W7PA 2VKVA 1QGPA 1U5TB 2KRFA 5ILSA 1P0ZA 1I3AA 4KZ6A 2IA2A 3BPXA 2AS5F 1ETQA 2OV5A 1O4XA 1ZG5A 1JTDA 3JAMK 2QJ7A 3HJKA 4N92A 2LF7A 2W57A 4GN2A 2EILH 3SS4A 1XP4A 3W6JB 2F5DA 1FNNA 3LQQA 4CO8A 3OYNA 2QEXI 3H9WA 2YX4A 1IV6A 4HJ3A 3FKWA 2RGVA 1FJLA 2WZZA 5G4YA 1LHYA 2JN6A 3QP4A 3VFHA 4G6TB 4U88A 1Y6IA 2EJRA 2J9PA 4GS9A 3PSIA 3KO6A 1SVLA 2PR6A 2X02A 1YAXA 3RKXA 1RCJA 3PIPF 1JKRC 2NVTJ 4PCQA 5HARA 2QUFA 2NVUB 4XN3A 3RKYA 3BFGA 4DE0A 3H0DA 3OPRA 4HBLA 4E70A 3E4QA 2OZ6A 3IAM2 3WE3A 5ERIA 1E3UD 3DV8A 5HD5A 1FBUA 4R8HA 1O3SA 2XF3A 4CGZA 4LV2A 3PFYA 4Y0OA 3V3SA 2CUFA 5K7FA 4JF4A 1IO2A 3CPTA 3S93A 1ZRCA 1LKXA 2NOJB 3BR0A 3E1SA 1BOAA 5FL3A 4PKYA 2I9VA 4V2GA 4PK4A 3CMEI 4QJGA 1VQ6I 2IWBA 1L0DA 3CUEC 3BDDA 4E6WA 4EXOA 2PJRA 3ZCZA 3RZOJ 1TS6A 2VBYA 4XKCA 4KUOA 1YE9A 3LNQA 3MMHA 3FHNA 4RM3A 4N9HA 1FYMA 4M3FA 2LRDA 4O3MA 5F1GA 1WGXA 5J7EA 4A6DA 2EBIA 1MH3A 5JI6A 1KE4A 2HKXA 1U8BA 2IP2A 2GBYA 1T0FA 3I64A 4II2A 4DIQA 3KSGA 1F9NA 1XFQA 4G7OF 3K2ZA 3ZG9B 2DYRH 2DMPA 2EV0A 5ILUA 5IT9K 4O7DA 2JTVA 3E0JB 2Y79A 3CF2A 1IELA 3CUQC 2ZJRF 1VB6A 1QO0D 1LFBA 5D5UB 4M3DA 1ZN2A 5EFWA 3BCBA 4HQEA 3GRJA 5EVIB 1ZKGA 1USSA 2Z5UA 1M1EB 1MJBA 1ZREA 3S1YA 4ABZA 5TGTA 2MYSA 2GQQA 1G5UA 3B47A 2D01A 3K7AJ 3T5XA 1LFUP 3OR2C 4IPAA 5IS1A 2X6YA 2PBYA 4XICA 2XR0A 4B8XA 3K4JA 2G0EA 2Q9MA 5DCMB 1YSPA 4R70A 2I8DA 1BSGA 4UHUA 3D4FA 4DNCA 3E0YA 2LP0A 3CCYA 3D0SA 3MAJA 1UB9A 3ZGKA 3HJEA 5BS6A 3L9KA 3GF2A 4XLNF 4HA8A 1X2MA 2K7SA 3DW0A 3LR4A 4BHPA 3Q9VA 4LOCA 1Z3XA 4P85A 3BECA 4DBQA 4A3JJ 1W7PD 5IP6A 3EYIA 3FF5A 1R1TA 3V5MA 3M8FA 4BJ5C 5HNHA 4EWFA 4X68A 3ZMDA 2V6CA 3P7NA 4LIUA 2DPUA 2H1KA 1GHPA 4S0HB 4UQIM 5JHFA 3ZNTA 1QBJA 2BYVE 3MKWB 1X1AA 3COAC 3ABUA 1JHFA 1BULA 3EQUA 3P9KA 2VC0A 3ZMSA 2ZXWH 1J09A 2VX8A 1QQIA 3M2JA 1X3ZB 2OU2A 2O5RA 2VL8A 5CERA 3B6AA 2CUJA 2KJBA 4Y17A 1NRJA 2XC7A 2B95A 3OCLA 3LSHA 1VQ5I 4HEFA 4OPYA 3FISA 3WE2A 2OC6A 4BEHA 4A3GJ 4WLAA 3BT9A 1NY0A 4HSTA 2EX8A 2ZC2A 3WHBA 2ZQ8A 4HOIA 2XB5A 1QMFA 3LEQA 5FKLA 4PHTA 3SOIA 1TWFJ 2ID6A 3SDGA 2K4JA 2Y0SN 1GT0C 1ETKA 3MKEA 2W27A 3H3ZA 1ZGJA 2K2NA 2COMA 4LPZA 4AIDA 1SEUA 3BLSA 4Y52J 5CEDA 2O9AA 1LDKB 2UWMA 2V6EA 2QJ5A 4KICA 5DDGA 1S7AA 2IGOA 4UUSB 3G30A 2Y2IA 5KAFC 2DTZA 2HPIA 3EETA 3TO9A 2K02A 4Z6YA 3HUGB 1QVTA 5M5WJ 4EGZA 3HKZN 1IRGA 4KQOA 3DU5A 1IN6A 3W4OA 1TNTA 3L09A 4YIFA 4E3JA 1DP6A 1KYWA 4Q47A 5DTDA 2ZQCA 3D9YA 3ZG7B 1OT9A 2PBIA 3F72A 4CSWA 2JCHA 2OWJA 1U5TC 2R9XA 2OZUA 1OISA 3QPTA 4XLFA 2Y2KA 5FKKA 4BBRJ 3F8BA 2B5RA 3LSPA 2VXZA 3TOAA 1K25A 3HSFA 1SDNA 2GJ3A 3GVBA 3BWGA 5IP7J 4QD4A 4RB0A 1VETB 1WPKA 5BOHA 3R0AA 4RGRA 2DOFA 2X6XA 1XGNA 2EFPA 2MC3A 1RKTA 2CQKA 3BTLA 2MLGA 4A3IJ 1F1ZA 1FCNA 5LEJA 3A03A 3MEXA 2F4OB 1Q1VA 4RS8A 5EF6A 1ONHA 1SKOA 4A3DJ 4S2IA 1K6YA 2JA2A 4HNUA 2H0YA 4ZZDA 2KX6A 2AXLA 2Y2ZA 3C30A 4X56A 4P6ZM 5GL9A 2P7VB 1VEUA 1DJBA 2ID3A 3G6OA 2DA7A 5F68A 2DT5A 2W24A 4EU0A 2W48A 4OU0A 1KA8A 1CGPA 4ITVA 1IZ1A 3E6BA 2K9NA 1JWZA 2XK1A 5M1AA 4WELA 4EJVA 5HZHA 5FFXA 3K0LA 1BT5A 4KG5A 3M8EA 1R36A 1QMEA 3LYXA 3GTPJ 5E2FA 1YQSA 3KYDB 2HDQA 4ZYGA 1ERMA 4JP0A 5E8GA 2WV1A 1IN5A 1JGSA 1NJ4A 2ZC4B 4G6DA 3IF6A 1Z0XA 1FMVA 4P1WA 3UMEA 3LL7A 2ZSHB 3HOYJ 1ETXA 4NXFA 5CHMA 2NYXA 2VPRA 1UFMA 2JPBA 3VDXA 5K5QA 5FLXK 1KU2A 3P9CA 4XN0A 1OCTC 1W8YA 2XDMA 2EXAA 2BY3A 4KQRA 3QYEA 3DTKA 3F1OA 4AD9A 3W6VA 1O3QA 3Q0WA 3NECA 3VE3A 3H0GJ 1GSWA 2VV8A 3VP3A 4H6JA 4PZJA 2DODA 3EUKL 5E1WA 4ARZB 4AYBN 2LTPA 2VJIA 4OLDA 5HAQA 2ESNA 2KFDA 4MHGA 2E71A 2R7DA 4S04A 4AM3A 3MCZA 4PJ0C 4ZYDA 1K38A 2OOLA 2ZJ9A 3BCAA 4PM6A 1ZHFA 4IHYA 2HGVA 2WAFA 3V50A 1MC0A 3E5QA 4J00A 3ZPLA 1LSXA 1OKRA 1WJEA 3H82B 3KYQA 2E2HJ 3GMWA 4ZC3A 3L2WA 3A3JA 5EVIC 1V9ZA 2MH2A 5LHHA 4HG2A 1S0WA 1FSEA 1KU3A 5AQ9A 3HEFA 1LSWA 2JE5A 2NUTC 2CMPA 3TKYA 2YU9J 2ZXJA 3PTEA 3LICA 1SD5A 2YS9A 4OIQF 1D1AA 3GLXA 2IGNA 4JOMA 1UWPX 4X1LA 3LA7A 2PMUA 2MD0A 3HGGA 4Y15A 1E3PA 2V8FA 4I5SA 1OYIA 4LB6B 2DTRA 3RSNA 4DW6A 1L0EA 3U2AA 3A01A 1HKQA 4GOGA 3I4MJ 1DDNA 1FIPA 2FMLA 1R22A 2GXBA 5FRMA 2PU2A 1EH6A 3G6EI 3TO7A 5IP9J 1P97A 1KOUA 3KSFA 3WS4A 1X4PA 2D02A 5FASA 3RKWA 5JVGF 4FSFA 3JRGA 1KQ8A 1R9TJ 2VE9A 2VXDA 1LVKA 2VIXA 2CH0A 4GDBA 3TBIA 3BY9A 3JVVA 3T4LA 3BR2A 4WF0A 1K57C 1SAXA 2DJNA 5CRFA 3NCKA 2GA2A 3PO2J 3K4BA 3VYSB 3T4OA 2M0MA 1I6HJ 2VV6A 1JI8A 1FR6A 4MEXF 4KDPA 3S7OA 2QQ8A 5LGUA 1N9BA 2XB0X 5DD8A 1IN4A 4I0BA 1X1CA 3K1MA 1K78A 3OR1C 4OVDA 1S1ZA 4IOCF 2W7NA 5C3EJ 3LAJA 5DTSA 4HF2A 5JVTA 3V39A 4BL3A 1KGEA 3VODA 3ZVTA 3CDHA 1S6LA 3M07A 4N1XA 4LGWA 1CQAA 4JYKA 1VQLI 4R0QA 1ONVA 2KZGA 1YHQI 2IS2A 2BG1A 3AG2H 5IOYA 3T1QB 4FX0A 3BG3A 4IHWA 3C4PA 4EUZA 4HAMA 4RA2A 4CCLA 2VOPA 1YLWA 3FPVA 2JSCA 4GKUA 1OYYA 4N1HA 1J0RA 1V55H 1AA7A 3CUEA 5J3WA 4F92B 2VLGA 4X69A 2ZCWA 1JWPA 4IJAA 2L9RA 1K55C 1U9OA 4PFPA 4WCGA 5EEHA 2NS0A 4C2MJ 3BLMA 3DBRB 4F94A 1F4KA 4M73A 2VJ5A 4DN0A 3JRIA 4MBFA 4U3TA 4MO7A 2F2EA 4IZZA 4GYGA 1A0KA 4U87A 2M5WA 2Q2EB 3H35A 3NJAA 3Q7VB 4MBKA 5EV0A 1U8RA 4YELA 2ZL1B 2FX0A 1J3WA 3TMOA 1N9OA 4OPZA 1OCZH 1IJWC 5EGOA 1W0UA 2R3SA 1P92A 3F6OA 1WH7A 3HRTA 1WJDA 3M1EA 2GAUA 3G34A 2PQ8A 1PDNC 5CXWA 1T19A 4MFDA 3CG5A 3JRAA 3VOZA 4Q8IA 3CUQA 1HDDC 1O7EA 4NKPA 1QHGA 4O5VA 3F8NA 2BW3B 2KPMA 4ID4A 3EQLF 3K1NA 5FAPA 4G7ZF 2JKRM 2M9HA 2YSRA 1T2KA 2HKOA 4K91A 3DKYA 4XRSA 3FWLA 4U0TA 4QTRA 2NS7A 1QZZA 2O3FA 3J7YJ 3Q81A 1K83J 1FEXA 3T12B 1Y0UA 3HSRA 2G9WA 3WHCA 4UUVA 2VJJA 3BQAA 1XTAA 2PFBA 2KISA 3HLEA 3V7SA 3VB2A 3S2HJ 3IHAA 3AGDA 4FOFA 2K27A 2A61A 1ZGAA 3GW2A 1CK3A 5DJTA 1K6RA 1RR8C 3NI9A 2EWNA 3RDIA 4A3FJ 1OTEA 5CHUA 5EECA 4HNVA 1OT6A 4UEYA 2EINH 2L7ZA 2WKIA 4EESA 3KIOA 1J5YA 1SFXA 1Y8QB 3S8PA 5L3FA 2M7AA 4CYDA 3F22A 4E7SA 3DLLF 2Y2HA 1FWZA 2R5YB 4MTDA 2E60A 5GLDA 5FD6A 2IWCA 4JX5A 4DE3A 3I5UA 5A93A 4OQ0A 4XUZA 4B47A 2FEZA 3ICYA 1DJCA 5GLBA 1IYOA 2HS5A 3KLOA 4N0BA 3CD6I 4LLGF 3ZRGA 5A2QZ 4DE1A 3WWXA 1D0ZA 1UHMA 2F48A 2R5ZB 4XKWA 5LBQA 1Z77A 1HLUP 3V7CA 3IAS2 2A6EF 4GHIA 1XCVA 4L5EA 1OQYA 1HC8A 3GQZA 2A24B 5DFYA 4MLLA 5L07A 2NUPC 4EBNA 3MBZA 4S2PA 4ETSA 2BHYA 3K4NA 1X3UA 1XGOA 1W5SA 3DKWA 3CO7C 5HWWA 4ENMA 2PR5A 3QQAA 3BFCA 3T1SA 4PGGA 2KRCA 2WTEA 2EIKH 3OYDA 3ZP5A 3CLOA 3HPGA 4BY7J 2Z6DA 2QKMB 3OPHA 4OQGA 4PM9A 1Z91A 4C3IJ 3ZXSA 2C5WB 3OCNA 2X6OA 2XAGA 1SCWA 5KIZA 5LHIA 3TOBA 3BJOA 2XAHA 3SJMA 2UWXA 1ERQA 5F5YA 3K10A 4ENNA 4HQMA 2CQ7A 2HOTA 2WC2A 3S32A 2V9VA 2DFFA 2EIJH 4KIBA 4L9JA 4DJ2A 3NARA 3IH9A 4R4RA 1E25A 3F21A 3H7WA 3ZG5A 4HEA2 1KU7A 3TRCA 1Q2QA 2QQ9A 1FQGA 3UDIA 2WKHA 2ACGA 2Z9OA 2LY1A 3E5UA 3EWKA 4IRGA 2JHEA 5IU1A 2H09A 2WAQA 3CMMA 4LMYA 3ZQ5A 4I01A 3ULFA 3PBQA 2BXZA 2QZ8A 3BR5A 3RXXA 3CMZA 1SFKA 5F64A 1G6OA 5FAOA 3WU0A 2IEKA 4CCMA 5ILVA 4QY6A 2V1DA 3W4PA 3DBHB 4FCFA 2VQHA 1U5TA 2DFEA 3IBJA 3HREA 4R4SA 1B8IB 5L3CA 1EH8A 4A0XA 4EGYA 2IGKA 3OC2A 4R3AA 3GECA 2L7FP 5H6QA 1K56D 3ZFZA 1K61A 4CLCB 1Z1DA 4A3MJ 4CICA 4IHQA 1FILA 5D6FA 4XRMA 2H27A 1S8NA 4OOYA 3CO6C 4DDSA 3ZYTA 2QPNA 5K7ZA 2ECCA 2CJJA 3FKIJ 4C2UA 2LF8A 1K54C 3C7JA 3BR1A 4GGGA 3KCCA 5F6FA 3PNVA 1QPIA 1XDSA 1YW9A 5E17F 1E3HA 4RAGA 1BLCA 2DMQA 3C2GA 2R7QA 5FEFA 5GAEJ 2AO9A 3I9V2 3H92A 2O9CA 2KIMA 4MEZA 3OYCA 1R49A 4DXBA 1JGGA 4I2OA 4GDNA 2ADUA 4FASD 1FOFA 3NIAA 3NDGA 1JUSA 2JKTM 2E1CA 3JSPA 4YNRA 5GHZA 2MW8A 4JPMA 3N4MA 1P6RA 2HDDA 4FUWA 3IWOA 2EWWA 1MJAA 5B3SH 1PFLA 2Y30A 3JRHA 2VOOA 2EV5A 4YFNF 4Z2YA 4RB1A 3ABKH 2R4GA 3C2BA 3GTKJ 2OAQ1 3PR6A 2K9MA 3TOIA 3ERMA 4NC6A 5EG0B 3PM1A 3M6BA 3DXJF 1G6NA 3FMSA 4BL0B 5FKOA 2KT0A 1ZG1A 2V2FF 1P4AA 2NAZA 4KN4X 1RZ4A 5CTMA 2Z1DA 1ZH5A 2QSGX 3D5RC 4JLFA 4O01A 3IWFA 3E4PA 2RL3A 1YLJA 1S4SA 3E2LA 5CJ9A 2ZC6B 5FFZA 1IRZA 4UVCA 4LG0B 1ZHHB 4UV8A 2FU4A 2EH3A 1H9GA 2OCCH 2STWA 1MMSA 5AQBA 1CI8A 1APLC 3HLBA 3ASOH 1B72B 1F36A 3R60A 4ON0A 2BBYA 2OUMA 4NUBA 4OQIA 1DP8A 4HOBA 2DCFA 2VA0A 5IT5A 4A12A 2IAIA 1Z09A 4U0VA 4XMYA 2E2IJ 5EVIA 3VYTB 1H88C 2D5VA 3BTJA 1A31A 4XM3A 3HDDA 4IVNA 1PWCA 2M3AA 2M7UA 5KZHA 1N77A 2KRHA 1G28A 3BFEA 1MGTA 1SD7A 1GUUA 1MMDA 2PRFA 4D9JA 4Q0IA 1YMXA 4MTEA 3LSRA 3C38A 4R6LA 1TTYA 1K0KA 2P9VB 1MJ9A 3SEZA 1TDLA 2E5ZA 3K4LA 5FQKA 3E3VA 1VHMA 4HF0A 1JTXA 1TT0A 5KCMA 1BYWA 1MWSA 3BROA 5HDKA 3OYFA 1L0OC 2V9PA 2VE8A 3IWZA 2V7FA 3G73A 1YIJI 1E0EA 2OSUA 5EZGA 5J4VA 4S2JA 4L9GA 2V9KA 4KZAA 2KLOA 4EUVA 1GHIA 1KZHA 5FQMA 3A3DA 2F4IA 4B93A 5DVAA 1P4XA 1S5LC 1K57A 1SFEA 3H5RA 2HVSA 3VMAA 3OYEA 1PNEA 2ME6A 4C9YA 3UDFA 4B9OA 4UHTA 4XLEA 4BAYA 3LFVA 2WKQA 5E2HA 5F0FA 5FJ8J 2HPMA 2FQ4A 4LCMA 3CCLI 1GHCA 2W1OA 2R9WA 1NRFA 1WRJA 2IPQX 1ESUA 2HZDA 4JXWA 2HGCA 4L5IA 4NQWB 2YU3A 2ZQ9A 2H8WA 3IS2B 2ZOIA 3N8LA 2PDRA 3HPHA 2PT7A 1YT4A 3J81Z 3VFFA 4ANJA 2EK5A 3ZQFA 3OS0A 2VI6A 1FP2A 4HIAA 2Y0MA 1MSFC 3UE1A 2Y69H 2Z16A 2EFQA 2K86A 4NC7A 5JFRA 1R58A 1IFQA 2MSYA 3F8FA 4ZTJA 2MLKA 3NQOA 4XL9A 2IS1A 1G8XA 3F6VA 1ESIA 1FIKA 3IT9A 3OBFA 4OINF 3T4JA 4N9LA 3UNWA 2A68F 1TC3C 1Y54A 2V79A 1BBYA 4S2KA 4KZ9A 1BC8C 3SZTA 1PJRA 1K55A 5D5WB 4YIRX 1IF1A 1NXYA 2X9DA 3QOPA 3WS1A 3PUFA 2Y2QA 1MDMB 2I5UA 3VP1A 2KOIA 4CH7A 2XGNA 2WAEA 3S3NA 4HH3A 1U6GA 1NYMA 2GNXA 4AIJA 1OTDA 3HUGA 3KEOA 2HV1A 3CHWP 1SFUA 2JZYA 4EQ1A 2IXSA 2JK3A 2DMNA 4P9UA 4Y0UA 5JYPA 4NEED 3G31A 4XLAA 1SAUA 4CXFA 5B1AH 5HDDA 4A5RA 4BL2A 1D1CA 4IHTA 2HDCA 1OFCX 1W4MA 5AQ7A 4ETXA 3UN7A 3GZ5A 2PHYA 5M19A 4GYIA 1FPQA 3JREA 4GO1A 4IQ4A 4CLCC 1IOUA 1VETA 1SVMA 1WI3A 4L9VA 2HOAA 4M3GA 1M40A 5DUIA 2A69F 4KUKA 5GAGJ 1KGSA 2N8GA 3PAGA 2STTA 4KISA 1KQ9A 5EVID 4ZBEA 1GV2A 2P0WA 5D5XB 3W6KB 2Z2SB 2QKLB 3D1NI 3NBLA 3CF5F 3HGYA 1EW0A 2X71A 5F1JA 5EEGA 1XJ4A 2EA2A 2F5VA 4WK8F 5F08A 3OPPA 4HX4A 4X6TA 1MNMC 5LRRA 3BW6A 2J80A 1KGFA 2P04A 1MKMA 2K9QA 3OS2A 3CCJI 1TF1A 2ZFUA 2DFIA 4HNTA 4D0PA 1HVBA 3LIFA 3ZMTA 1K7AA 2CV0A 4MGRA 3R61A 3F1PA 2CWEA 3CP8A 1HW2A 2GDNA 3ZQIA 3GFIA 3IH2A 4EJUA 3CESA 3DKXA 3G71I 1S6RA 1LL8A 2JVGA 1Z7UA 2VQCA 1RKWA 1KDSA 4HP9A 2LKXA 3M7GA 4CDGA 4M74A 5F83A 4OAZA 2LH9A 3Q3SA 1QZEA 2J9OA 2ZM0A 3P09A 2HTSA 1XSXA 3JTGA 3NWSA 5FB2A 2BY2A 4II3A 5ICFA 4G9YA 1JT0A 4EQIA 4UQIS 1MWUA 3DPTA 3W4QA 1XKZA 1TS0A 4HBTA 2GZAA 3F1NB 1HD8A 2O99A 1CJFA 4ARZA 2CG4A 2R78A 1QRYA 4M9SA 3WTYC 4I09A 4HDVA 1XC5A 1PUEE 4XORA 3HL9A 5CGXA 2R93J 2F6CA 1I5QA 5FA7A 2RKHA 3WGGA 2ZC7A 3ZG8B 3D5SC 1D0YA 3ZMUA 3H82A 1YPRA 3BJNA 4Y7PA 6PAXA 5HD3A 5ED4A 1NLZA 5J40A 3SFZA 3RQ4A 3PNYA 4EM1A 1YMSA 4QU3A 3VSKA 3LY3A 2JKRI 4HJ6A 5FI2A 1H0MA 1VZ0A 1D1BA 3PSFA 2QMIA 1BI0A 3SEQA 4ZDPA 3V8JA 3N4IA 1JT6A 4I7HA 3MQ0A 3SQNA 1FYKA 4QWQA 4JBFA 2ZMEB 3BJAA 1DP7P 3FKVA 1FC3A 2EV6A 4M3KA 3QODA 4ESJA 5E1XA 1HSTA 3U1DA 2LREA 1USTA 1Z6RA 5E79C 5HLTA 2QF7A 4HDUA 4BE1A 3UB5P 1V4RA 1IG7A 3W8KA 1W63Q 4CQHA 1FBQA 3BG9A 1T1AA 2Y91A 2D2WA 1YX3A 1S29A 3GTQJ 4S2NA 3LOCA 5H20A 2MGQA 3BG5A 1XX2A 3HUNA 2DOEA 2VN2A 3MXRA 5DS9A 1UAAA 4BU2A 5DV5A 3M6HA 2C6WB 3OS1A 1BLSA 4PM7A 1ZELA 3IRQA 3JPUA 3O5YA 3F8CA 3LMMA 3A0BC 4NXGA 4ZYHA 5C4XJ 5EUAA 3P9IA 2YKHA 3O3VA 4I98B 5DTTA 1DU6A 1S3JA 1Y0NA 4R38A 3I59B 2OD5A 4I3JA 5TFQA 1LJ9A 1K54A 3IXBA 2KJCA 1B59A 3HHHA 4II7A 3FMQA 2QGUA 3GFMA 4IO9F 1D06A 3Q07A 1WVRA 3QPSA 3GLLA 1XN7A 1IV8A 1LEAA 2EZIA 3AGFA 3QP1A 2Y31A 1VQQA 3HJIA 3VOEA 4BKXA 4NXBA 1Y1VJ 2CYYA 2F5FA 2JPCA 1I1GA 1TLHB 5EDNA 4P6ZS 1KU9A 2KZVA 2ZFWA 1SVOA 3LSIA 2PD7A 4YFXF 3WTUC 1E17A 4IKFA 2WGWB 5IHVA 3R7WB 4HW0A 4DZPA 2WK0A 4AIHA 4H8RA 2Z99A 5FI7A 2NS8A 2MJ6A 1OMIA 3RXWA 3LSKA 3VEPA 4TV7A 4P55A 4D5CA 3U4LP 4RB3C 2PN6A 1MBGA 1DJAA 2PD8A 3FYZA 4FH2A 4OAYA 1S9HA 2UUZA 2WV0A 3H1CA 2M0CA 4PJNA 3KYEA 5H6RA 1ES4A 2Y75A 2V1XA 1ETOA 3Q7VA 2MG4A 4UVBA 5K1YA 3KSIA 4XT2A 3CC2I 3KPHA 1V3FA 2EWVA 1OCPA 4XOPA 5E18F 2TDXA 3C2WA 1R7JA 2XVCA 3NDEA 2ZJQF 3OV8A 1HF0A 5KMWA 2V1AA 2YR2A 4E6KG 1RETA 1XA7A 5A8BA 1MBHA 2DJIA 4DGWB 2EA4A 2Y2OA 5B1BH 2NVYJ 2FH5A 3SZGA 3OL4A 5E1ZB 5EEAA 4JKTA 2Z3YA 1T98A 5H2FC 3HL2A 1WZ2A 2Q9NA 3ZNYA 1IRFA 3QPLA 4XONA 4BS9A 4OMYA 3I0TA 2DA3A 3IP4B 2BW3A 2IBDA 4XNFA 2JWTA 4D60A 1R5GA 3RYRA 4RAYA 1YRNB 2DO7A 2XDVA 3KZIC 2K31A 4PM5A 2HWVA 4RAFA 2QLZA 2XAFA 2Y2LA 3QRFF 3CJRB 1IUFA 4F55A 1X19A 3C5AA 5FRNA 1ALQA 3FXJA 1KQ0A 1VQNI 1X1DA 3ABTA 1HOMA 2KDOA 1RRJA 1KGGA 2QKPA 4BENA 1X1PA 5F1FA 1B9NA 3RYPA 1Q2PA 5F6AA 3HRSA 2BVLA 3BQYA 4UAAA 2M2EA 1D8KA 1XGIA 3ELKA 1S1YA 4LK0F 3UNGC 3K70C 2WB1A 2KHMA 3G1MA 2ZNYA 3WTWC 1L3LA 3MZEA 4Y13A 4BY1J 3C4OA 1I39A 1W5TA 2QYBA 4UB6C 2JKTI 5M3MJ 5GLAA 4B48A 2R5YA 2D45A 5AJGA 5CYVA 2XROA 2GXAA 3S4XA 2QWSA 2LKPA 4U7BA 2L4RA 5HX9A 2L4MA 2YUSA 5HAIA 2WKPA 3ZQLA 3ZGAB 3BC8A 3DWLE 2CFXA 1NK2P 5A92A 2ZKZA 2EX6A 3HUMA 1RNLA 1XJ2A 2R5ZA 1DU0A 2V26A 2AHQA 2VUMJ 4BBVA 4BACA 1ETWA 2IW5A 3KSHA 2QBYB 3I7JA 3KX2A 1JKPC 2A07F 4KYWA 1SZVA 2A24A 4PKYG 4EEUA 3CZ6A 2O8KA 2F5CA 1O07A 2GWRA 2HI3A 3HRMA 2BHZA 3FG8A 3G35A 3JRBA 2CUEA 3A1YA 1YS7A 3JW4A 5IYCJ 1YKDA 2XFSA 3D3OA 3WRTA 2B9SA 3FX3A 4CA0A 1F9IA 4P6BA 1SMTA 3DF8A 2V4JC 1Z21A 1PWGA 1W8QA 1AXBA 2VEAA 3ZDJA 1SMYF 2E34A 5D8LB 4BLMA 3TP3A 1T18A 5GADJ 2EX2A 1Z7LA 3VSLA 3CTAA 3H5AA 2AXTC 3RQIA 3MFKA 1V9YA 5A90A 2BGCA 1ZG3A 1Z9CA 2KIUA 1TS8A 2HZ5A 3TQNA 5F69A 2XRNA 2ZMEC 1RI7A 2FD5A 1HXDA 5FROA 1TBXA 1OJLA 1JKOC 4A3LJ 2EX9A 2VKDA 2O0YA 3H9GA 3P5JA 1GXQA 3S16J 3HCYA 2XPUA 4D2OA 3ZMVA 2HP5A 1VQKI 1IXSB 2OLVA 3PBRA 3LAPA 3A2KA 2DMUA 2RC4A 4XIDA 4Y7NJ 3QYFA 2VONA 3C7VA 2Y9ZA 3BZKA 4CHUA 2L0KA 4LK1F 4PFOA 5GTHC 2DK8A 4IVKA 4S05A 4N9IA 2PU4A 4IXAA 3H5NA 3ZOBA 3DBAA 2BVMA 3HBLA 1VM1A 2XH9A 4WZ5C 1B8IA 2KDZA 4X1EA 4Q48A 3OIOA 4BQMA 4CLCA 4GRIA 1J9IA 1SC7A 1GVJA 2B7EA 1WE4A 2MABA 4E7HA 1ZARA 2E7WA 1PUFB 2K85A 4GLQA 3JAMZ 3HOUJ 2L1MA 2FNAA 2INWA 4PSWA 2HOSA 4MN7A 3RFBA 4MDZA 2RV8A 3GWZA 1U9NA 2L9VA 3HBRA 4Q0JA 4LB5A 2WGVA 4GB7A 3MN2A 3EYYA 5L3GA 1ES3A 1ZQ3P 1BN5A 1V5GA 3S2DJ 3T8RA 3QOEA 5GTIC 3MMYB 3PUBA 3IH3A 2XPVA 2A3SA 3CCEI 4J19A 1BJZA 3M2KA 2MD5A 2WAQN 3A02A 1YLFA 4A2UA 3TDZC 3QNBA 4DBRA 2KIFA 2FOKA 1FX7A 5CVJA 4E4HA 4NETA 4BJPA 3PXPA 3MS6A 3GSGA 5F0CA 2YKFA 3IL2A 1REPC 4KNYA 4WYYA 5TBMB 2G7HA 5HOOA 1X3WB 3WS2A 2LVSA 2XUBA 5HS8A 2IT0A 5EG0A 1JHHA 4LJZF 3BZCA 3ITBA 1BI1A 4CCOA 3OYMA 4G6QA 3P01A 1FMWA 2VC1A 1K4SA 2Y2MA 4PAUA 5HL1A 1A6IA 4XBFA 2HR3A 3E7LA 1FBSA 1NH3A 4FQGA 1AWIA 4BXXJ 1LDJA 2E1NA 4I02A 1ZKJA 3N97A 3NEUA 4PUSA 1Y39A 1W36C 1KONA 2JMWA 4YWZA 3OYKA 4HHDA 4LG0A 2K7LA 4BE0A 1WFXA 5FATA 2P5LC 2LLKA 3B73A 3RKQA 1DPUA 1YLZA 2LK2A 3S22A 1B72A 4DQ2A 4E7LA 2Z2LB 3K4MA 4NHJA 3CQZJ 2UV1A 5IT9Z 1SDEA 3N7WA 1EI5A 5IT3A 2M7VA 2QSFX 1CF7A 4RM2A 4OH0A 1EJ9A 2RNJA 4X25A 2XGCA 3HG9A 1YW8A 1JE8A 2HVRA 4FE4A 3KP3A 2AVXA 2ZXHA 1PP8F 2R7FA 5DCFA 2LD5A 1OCCH 5C4JJ 1DRMA 1MMNA 2ZBBA 3HOVJ 1AWCA 1GHMA 3I54A 1L2SA 2P9VA 4E3KA 4RLFA 2CS3A 2KLIA 1WYBA 1R4NB 1F5MA 3V7RA 3I71A 4E3LA 4B3XA 4BQAA 4QPOA 3FXMA 4M4XA 1P9QC 3HZJA 1JNUA 2XRLA 4UB8C 1V5FA 4EQQA 3FIWA 1LI0A 3MVPA 2ZQDA 2FXAA 5GPCA 2W1RA 3DU6A 1H3QA 3MJQA 3FDYA 5DFXA 4HNBA 4EW7A 3JCUC 3FC7A 1RC9A 2HYFA 3HLWA 4XUXA 3KP4A 4G94A 3GTMJ 4EV0A 4CLCD 3V42A 2WY7Q 2AQEA 1OJ5A 2ZC3B 1RUNA 4GD8A 3VV4A 3CC7I 2LYCA 2V20A 5J8XA 3HOTA 5BOXA 2O9BA 2CO5A 1DQUA 3WU2C 2WBMA 3HOXJ 1FOWA 4I6ZA 3P98A 2UXNA 2XQZA 3L7WA 4NQWA 1BR1A 4YFKF 5EOOA 1L0FA 3IS2A 3HTSB 3W2AA 1MZBA 1JKQC 4XQFA 1CQTA 1YLYA 3KX0X 2KQRA 1BZAA 1OTIA 2ZM8A 4UA9A 2W4SA 2XV4S 2A6HF 3W2WA 4IUKA 1X58A 2XF5A 3KP6A 4KFCA 3GVAA 2FZ0A 1TWGJ 2P5KA 4JQFA 5LLQA 2QWWA 2DA2A 1AOYA 4I38A 1MWTA 3QP6A 5EM1A 1FTZA 1VQ7I 5DF8A 1EWZA 1IKIA 5DF7A 3BY8A 1G3TA 3MKFA 3WU1B 1UHWA 4G3KA 3JRCA 2CQQA 3PFIA 4F7ZA 2RNGA 1YJWI 3E97A 3EUAA 4BQNA 3MKZA 2P08A 2RDPA 1T95A 3J80K 1XJ3A 3HLGA 2ELJA 1R23A 4GJ4A 1VNDA 4EMSA 3NWTA 3BWLA 2H10A 3UE0A 3G4PA 1ON1A 3HVFA 2A5YB 2OBPA 3CLQA 2L9NA 2R7WA 2K9LA 2VGLM 3GR2A 3EEHA 2XSDC 2J8YA 4BJTA 4FTXA 4FISA 4AYBA 1ERDA 2DYSH 1EA3A 2P7CB 2BV6A 2W00A 2FUG2 1KYZA 2CQXA 3BG7A 1QA6A 2A05A 1SANA 1XSVA 3CJQB 1BM9A 3M1CA 4HV6A 2M4KA 3VFZA 4E7ZA 5JHUA 5LFAA 2JQ7A 4W97A 2L4AA 2L54A 3BOQA 2JA6J 4OONA 2IJLA 1SD6A 2W82A 4NBQA 3CJMA 1LQ1A 5K5OA 1JJ8C 1XPBA 2CSOA 4HP4A 5HW3A 2DI3A 2DK5A 4I99C 5M18A 3RTRA 2VK3A 3OYBA 4RVAA 1J59A 1UCRA 1WJ5A 4B88A 3BQ8A 2Y4AA 3DQVC 5LD2C 1D8JA 3F3XA 3HOZJ 3A3FA 3O88A 2EZHA 4L0YB 2Y55A 4RQ9A 4S2NC 3GTCA 2QSHX 2W1TA 4BNCA 3W3CA 1UJ8A 1YFHA 2EQRA 5E3MA 1ITYA 2KIQA 3VP2A 1NK3P 3D72A 3HHGA 4BYYA 5IPAA 5MC7A 4KMFA 3UPPA 2O6GE 2R7UA 3OIPA 3DTIA 4IBXA 2HQNA 3QP5A 4CCJA 3L2CA 2X1DA 5KK1A 4H6JB 4G3WA 1QHHD 2X0LA 2XLNA 5CTNA 3K6GA 3QAHA 1MMGA 5JR3A 1LE8B 3EPZA 4FETA 3O86A 4HSRA 1BR4A 2IA0A 3J7AY 2KDKA 2G7UA 2TRTA 1K4FA 3JYIA 4JF5A 2WY8Q 3R6SA 1U3EM 4I3IA 2W3HA 4RYEA 4WMCA 3IF5A 2P8TA 2XASA 3OYHA 4JGQA 2WADA 3BTIA 3BFDA 2NNNA 2XGXA 1VFCA 2HJEA 3F8MA 5FLXZ 2R7VA 3IKTA 2HDRA 3L9FA 3CITA 3RTYA 3TJZC 2LFBA 4WEJA 4EEPA 5KSHA 1FP1D 2H94A 2M34A 2VJ4A 3F1NA 4DRTA 2LKSA 4HV5A 4A5MA 2L2OA 1MMAA 2OF7A 4XLHA 2HPBA 3H3UA 4LLLA 4KN7X 3H9QA 3K9TA 4L9FA 3SHFA 3A3IA 2PJPA 2DCEA 3V8KA 2EPFA 2PMZA 4XSZF 3SS5A 5D5VB 2MA3A 2PG4A 4DKIA 5J1UA 5L09A 5U47A 2ZM2A 3K1PA 3AAFA 4XRFA 2LNBA 4RLQA 3HYIA 3GX4X 3CCMI 1JJ6C 4UY8I 2IS4A 3HUOA 2DT6A 4WXCA 4XSXF 2I10A 4JBAA 4DYRA 1LVAA 3GTGJ 4LV0A 2QQAA 4BDZA 1LT0A 5E2GA 3JTHA 1PYVA 1BL0A 4RDUA 3VYUB 5TRDA 3F0CA 3ABLH 3SS3A 3O6BB 5AIPA 4E04A 2J3TC 4LV3A 2ZMEA 3ECHA 3M4OJ 2H5SA 3GDIA 4G3VA 1V5EA 4Y2FA 1M6KA 1ZTUA 1XMXA 5HNFA 3IRRA 1A5JA 4OPQA 4WZ4A 3TW6A 3M8JA 4IEJA 2JT1A 4JF6A 3S7QA 2QA4I 3OY9A 4HX8A 1RGZA 1VQ8I 5E20A 1CEFA 1RESA 2RVCA 5FQ9A 1G59A 5TGFA 4WEKA 4G8XA 1WCMJ 4E7KA 3ONQA 1PZPA 1P7JA 1WH5A 2X4HA 1QVUA 3DPLC 1HA8A 2L0WA 3T4TA 1IUYA 2D1VA 2E36A 1JXSA 4K08A 4PPRA 4O0PA 4R1GA 2FBHA 3QU3A 4F52A 4WZ5A 3TW8A 2VQLA 3UB6A 1N9NA 4HH2A 1TQPA 2AQFA 2ICWG 1X2NA 3FXRA 4UV9A 1J9MA 4OIPF 1FOKA 1WJFA 4R23A 1T33A 1AHDP 2LDUA 4U7DA 2VLAA 2X51A 1O3TA 3LSJA 3MQQA 5DCMA 4ZTFA 3L00A 3I59A 4IF4A 3FXQA 4ENKA 2VKHA 2XA7S 3FXLA 4UA6A 1U78A 2HZTA 3SH8A 1C0WA 5DM7F 3GYHX 4IOAF 2XSSA 4S2OA 1BLPA 4XRSG 4D7NA 1S7EA 1YJNI 4EVIA 1IDYA 4E3MA 1IN8A 1ACFA 4HQAA 2L02A 2OTJI 2EIMH 2O61A 4G7HF 5CKTA 2LBFB 4ZJ1A 3K70D 2WGWA 3R7WA 5LGTA 1ZYRF 1G6AA 5G4ZA 3UB8A 4WXDA 5IOZA 5HL6A 5EGOB 1QNTA 3S14J 1NZOA 2A5WA 1XGJA 3BFFA 3UDXA 3JRDA 1YJ9I 3HTUA 3DP7A 1I27A 1A04A 2FRHA 1BUEA 5CPRB 2W84A 5J6XA 1MBLA 3ITAA 2HJ9C 2L7KA 2X1EA 3QYBA 1PW8A 2A3UA 3WTZA 3H3VK 2ZC5B 3EUHC 2E7XA 4WMCD 1WJCA 3DEWA 2F5EA 3G1LA 1IDZA 5I94A 2CFOA 4HX7A 3O8HA 4E3IA 2DFHA 3OL3A 1SFOJ 3OPLA 4V19K 3FKJA 1B4AA 2Q1ZB 2DA6A 3AL0B 2DOAA 3FHZA 2GM4A 1FTTA 2HEOA 1PRQA 5FGMA 1BI3A 4WUJA 1XSDA 3MR0A 5CVRA 4KIFA 5L3BA 1T8IA 5FD5A 1B9MA 3AG4H 1BW5A 4MQVA 5BMZA 3QP2A 4OOIA 3Q0VA 3BR6A 3VWBA 2JKFA 4L18B 3C8CA 4XLPF 1T1CA 4KG6A 4QLCU 1DGWY 4DMZA 4CYCB 1YRNA 2NVQJ 2DAOA 5L8MA 3PQKA 4UUSA 3EGDC 4EBPA 3GXOA 4KZ8A 3ZQQA 3TL4X 1JVJA 3DCFA 3SXYA 2ACJA 2CQNA 3FK7A 3QWLA 4ZDLA 5FQJA 4YG2F 5M3FJ 3OYIA 1XGMA 3IX3A 1MBKA 1VQMI 4A0YA 1K4EA 3J7AO 5AIQA 4EBLA 3PBTA 2JJ7A 4KENB 1IAWA 3TP0A 3DPUA 1GDTA 3VP0A 5J4EA 2X85A 3OLOA 3LSMA 1TP4A 4D7MA 5L3EA 4I0AA 3KYLA 2UZKA 5BPDA 3WTTC 2OWHA 3IQAA 1R1VA 1FIAA 1ODDA 3L2UA 1XA1A 2O03A 3UB9A 2L5QA 1XCBA 2R7OA 2VT2A 3KP2A 4BWIA 3CAXA 3CCQI 3EEAA 3DLAA 3MZYA 2XA7M 2X6WA 4NXEA 4M6YA 4PM8A 1GV5A 5CECA 5DJUA 2W3DA 4B44A 1PIOA 1TWAJ 5HPFA 1MXOA 4OLGA 4LG3A 3TE8A 1X4OA 2EZLA 3OOVA 3G4SI 1UG2A 4KT6A 2PYRA 4Y3OA 4A6EA 4LV1A 3R0JA 1GA9A 2VBZA 1X0OA 2A6TA 2FBKA 4IRHA 4LENA 5E8IA 1ZC2A 4BXUA 3V8LA 3ZQ7A 4KA4A 3U9GA 2EFXA 5IY5H 4YOFA 1KE0A 1O57A 2QBYA 3B3XA 4IX7A 3E2KA 1NG6A 3Q5FA 2RCXA 1KVLA 1IRXA 3KYCB 2YPRA 3MD2A 4L0ZB 1G3SA 3ASNH 4S2LA 1YW7A 1ES5A 1O7FA 1H89C 4A3CJ 2Y2NA 4A3KJ 3ISGA 4CLCE 4OIOF 3ZQCA 3S1NJ 4E3OA 4GNUA 5K5BA 4MMNA 3UB7A 2ECBA 3AKZA 1R5HA 1WQ2A 2H1LA 1ZRDA 3ULQB 2JA7J 3EQVA 4M9XA 3NAUA 5C44J 3FV7A 5C5KA 2A2LA 4E7JA 2GXGA 5CVIA 4R3JA 1W0TA 4X6AJ 3BEBA 3LIAA 4P87A 3GUDA 4U0WA 2WWYA 1FT9A 2PAVP 2XEPA 5AVFA 1MSEC 3NOTC 4AWXB 4X1MA 1EH7A 1BLHA 1IYPA 1ES2A 4XKVA 5HWVA 1EV7A 2ZQ7A 5M5XJ 5J1RA 1OR7C 3TEDA 5AONA 3KYZA 4K0XA 4N9KA 1NTCA 2E1OA 3KZYA 5DEQA 3N8RA 4GW9A 3PL8A 1W36D 1HQCA 3A0HC 1ODVA 3DFGA 3K69A 2PI0A 5HWTA 4KG2A 1MBEA 3BP8A 1QU3A 3GBGA 3ZQHA 2P6SA 3G3ZA 3CI6A 3PYPA 3CWFA 1B1BA 2QZ6A 5G18A 1S66L 3OSGA 3ERED 2OPTA 1T1BA 4LLOB 2ZSIB 2GX5A 1PUFA 1NG7A 4RGSA 3LA3A 2JRTA 2HQRA 3LGOA 2K4BA 2RQPA 2DQRA 5FEGA 2ZXIA 2K40A 4IVIA 3I53A 4QSHA 4GFBA 5TISC 1RIOH 1VQ4I 2JA5J 2CUZA 5IYDJ 1VF9A 2OCEA 2FMYA 2H0TA 2W85A 1XFNA 5DUKA 4XKBA 1Z05A 4ZJZA 4NNJA 2R7ZJ 2ELKA 4ESBA 3NOPC 2G2WA 4HF1A 4ZH4F 1OTAA 5FKNA 1BOBA 3LFKA 4E7IA 4DJ3A 2MFZA 3CJNA 2OAZA 1K6SA 3LI8A 1XS9A 4DE2A 2M7BA 1EROA 1PYYA 2V1ZA 2XKPA 4IBRA 4Z1WA 3S1QJ 2COBA 2QYOA 2UV0E 1MZUA 3MZDA 2P5VA 2XAUA 4FTHA 4IHVA 2KKOA 3DWKA 5TBMA 3FWEA 1I6XA 4MNRA 2BASA 4CCKA 3S7NA 1JTGA 3BZ6A 3T50A 4ME4A 1YIOA 1RPWA 4L9NA 4ASNA 4R79A 3OZHA 4JXVA 2H6BA 1ACIA 5E3NA 4NG2A 2Q0OA 1U2WA 2EFNA 5DKLA 2OLUA 3E4OA 5DTKA 2D1HA 3W2VA 1YLPA 2LOOA 1MBFA 3AL0C 2VJWA 4N4NB 2WA0A 5J8FA 2BXYA 4ZRRA 4ESFA 1R00A 5HSQA 3Q7ZA 5E43A 3PBSA 4KZBA 5CQGA 2V0UA 3MFDA 3RPUA 2V8CA 2L3DA 4PSXA 1K79A 3C3WA 3OYAA 1DUXC 2VODA 1BTLA 5HVQC 3LI9A 4BQOA 2HVQA 3X2QH 3LSTA 2O7OA 5GAHJ 2NRAC 2LB5A 3JVUA 2RQQA 1OCOH 1LLBA 2K3FA 4E6XA 2Q2EA 1I1SA 2L9SA 4KIGA 3CDLA 5B5EC 3BLYA 1YG2A 2ZL1A 4BBUA 4OQHA 4ZDXA 4C3JJ 5HS9A 3CCRI 1XX5A 3GZ6A 2X48A 3N6IA 2FBIA 1G4DA 5D6EA 4YINA 1IYQA 1H8YA 3IXDA 1VI0A 1UGUA 4RAZA 4ENJA 1AKHB 4WM9A 2HQ5A 2OV7A 2LG4A 2OQGA 2BOLA 2WYXA 4GDFA 5LRSA 1TW3A 2XSJC 2DA1A 4YRVA 3I4PA 3ECOA 3LQRA 4L5JA 4RBOA 3WTVC 1XG1A 1R5ID 1BW6A 1MBJA 1TQIA 3IUOA 1MWRA 3T1RA 2CRGA 4HBUA 1ZLJA 3ZCOA 1Z6FA 4EERA 3T1XA 2DA4A 1HKTA 1I3QJ 3BQZA 2M45A 1G68A 2V1NA 1KE3A 2EA9A 1YX5A 5CVUA 1U60A 1HW5A 3DTMA 4J01A 4RA7A 5J4YA 4WWCA 5A2QK 1XXMA 2HP9A 5GP9A 2NVXJ 3MWMA 3JRFA 1GVDA 2DRWA 2Y9YA 3D5LA 3OOPA 4XXRA 4CCNA 2BLSA 1NHAA 1Y56A 3TO6A 4I76A 2IS6A 1GA0A 4OMZA 2ZJ2A 4B4XA 2E19A 2E8JA 1O7LA 3HSEA 3F23A 4H4KC 4BJ6C 2ISYA 4F3LB 1Q1HA 1ZAOA 1F5TA 3BR3A 4KZ5A 4YIIA 4MEYF 2IGMA 3EDPA 2GOMA 5BPIA 3ML6A 3PIOF 2VZWA 4QHCA 3BM6A 1LB2A 1ETVA 1R1UA 3MZFA 4MNUA 1DP3A 1ZR2A 3FZVA 1WJBA 4LCLA 1ULYA 2XAJA 3WG9A 3K2NA 4BD0A 4EATA 2BEOA 3BYDA 3OIQA 4HESA 4IEDA 2JKGA 2DBBA 4JXSA 1CEGA 5EVLA 3ZHHA 5KHDA 3WTSC 1Z6TA 4BQQA 3SYTA 1OPXA 2Y59A 3LA2A 2GLOA 3DAVA 3GCMA 1UWNX 1G3YA 1YI2I 3EUHA 1OPCA 3BRMA 1N78A 3S3OA 1T39A 3GTJJ 5E3LA 1UZCA 1K6OA 2R7RA 2JUCA 4BBSJ 5CEBA 3WTXC 4ESPA 4E3NA 3OYGA 1HDPA 5BNGA 2EXBA 2K9SA 3HIFA 2CU7A 4BXFA 3R4KA 5HLIA 4P96A 5HFOA 2ZQAA 3H36A 3LSGA 4EJOA 3IXHA 3OSFA 3G2BA 3FPWA 3EGXC 1YQAA 2M8GX 4KUMA 2P7JA 1IXCA 1MNEA 1W7PB 3RI4A 2WUQA 1S72I 2HOEA 1DP9A 2H8RA 3MFXA 4HI4A 4DJAA 5DKKA 1IC8A 5TR7A 1LUJB 3E6MA 1F98A 1TS7A 3I58A 1FSYA 3RPUD 3F1PB 4A3BJ 1WWXA 1RP5A 1XB4A 2DMWA 3CCVI 4L0LA 4UVAA 3RJUA 4LD5A 2BZTA 1IYSA 2RN7A 2OAP1 2R7XA 3OWTA 2JSPA 2ZMAA 2ZBKA 1YO5C 3QP8A 4QB8A 4X53A 2JBFA 1IW7F 2J3TD 4JX6A 1ZRFA 1FYLA 3UE6A 4GS9B 4KITB 1I2SA 5HLHA 4H0EA 2E1MB 4KJZA 4D5FA 3RZDJ 2KP6A 1LL9A 3AFHA 3I3LA 1W1WE 2HXOA 4MFEA 3CC4I 3A0SA 2RAEA 1TW2A 2V9AA 4O8GA 2VB6A 1IGNA 3ZVWA 5E3OA 1WI9A 3JSOA 2EB7A 3HLFA 3K4CA 4IUHA 5HS7A 3CUOA 3MF0A 1A6QA 5JLXA 4WX9A 5FAQA 3Q82A 1W79A 5D8KB 4NB5A 1TT5B 1PP7U 5J1YA 2ZJPF 1LE8A 4AUXA 3Q9SA 3CPTB 5CGSA 4KZ4A 1H8AC 1VQ9I 2L7MP 2MH9A 1ZR4A 1FCMA 3VOYA 4QPRA 4AU7A 4ZTKA 4F93B 1F43A 2JN7A 4RGXA 2J5PA 4EM2A 1H8ZA 4PJLA 4CJNA 3HB9A 3E6CC 2PJRB 4D1QA 2BY1A 5GPAA 1T6SA 2JC7A 3L7HA 3LY4A 4ZJ2A 3G32A 4R1HA 3K3DA 3DEUA 1FY7A 4XR6A 1Y28A 2HDUA 4HJ4A 2X1CA 3OYLA 1MW7A 3FXOA 3UKGA 4ZYAA 4CPKA 2DU9A 3NY4A 4UA7A 3A4CA 5GLCA 5J8CA 1STZA 2LSOA 4DXCA 2CW8A 4OIRF 4A3EJ 4M3BA 1TNSA 5CHJA 3I55I 5FLMJ 3A0RA 3B6CA 4XOTA 4EJWA 1H5XA 1OJGA 4X55A 3KLNA 2Q8KA 1Y1WJ 2Y2PA 3IBRA 1J2XA 2LB9A 4Q4ZF 3SH9A 2J5OA 5IYBJ 3DEEA 2Z2MB 1E2XA 2YX7A 4P0MA 3AG3H 4FX4A 4C6YA 2FJ1A 4BGDA 3FBIB 1XPXA 3UPNA 4XK4A 5LBRA 2DLLA 4X0GA 2ZNZA 1XMAA 5F27A 1E3OC 5JYOA 3LIEA 2R7SA 3S17J 5EPHA 1D1JA 2XAQA 5FKMA 2IA1A 3DBLB 5ICCA 3B33A 5A91A 3HXLA 4CUGA 3KP5A 2FE3A 4RX2A 2DDBA 3WS0A 3TW7A 5KAIC 2I72A 1OR7A 3ZQGA 4EM0B 3LR3A 1SD4A 3QPHA 2VGLS 3CDIA 4O6JA 4QPQA 1ONGA 2Y2JA 4HY8A 3HC7A 4DYQA 1WA9A 3FM3A 3BY6A 2ZMFA 2Y0SA 2PMZN 2EFUA 5L10A 4FH4A 1ENHA 1LEBA 2GA1A 1V54H 2HP6A 3IX8A 5FQIA 3ZR8X 3L2RA 4NDLA 4LRZE 1OCRH 2O8XA 3OOUA 1CF0A 2E2JJ 5EOEA 5L2FA 3MXSA 4Y0TA 3M9AA 3HOSA 2DN0A 2M4GA 4C75A 3ROUA 3IXGA 3DTEA 3HKZA 3Q0UA 2DNSA 1UELB 4OKPA 2ISZA 4Q0HA 3TDUC 3MZ8A 4WXHA 3SZPA 3KE2A 4R3BA 3FZCA 3J81K 2J3WA 2OJED 2LBFA 3B42A 1A36A 2DA5A 2DQLA 2FQ3A 2QVOA 3C2HA 2M1BA 4BEHB 1TL8A 2J7VA 4XT2B 2VT3A 2H28A 1EF4A 2XFTA 2W25A 3WGHA 2CV2A 1BJAA 3FM5A 2V1UA 3IX4A 5J47A 4LRYC 5FSRA 4KMUX 3I4NJ 3VYRB 3LCEA 5F04A 3AG1H 4MCWA 1U0JA 2XGEA 1DPRA 4M3EA 1CI9A 2VV7A 4JGRA 3RPQA 1HBXG 2W3EA 1K56A 3G2YA 1IN7A 2MC4A 5CGWA 1QPMA 2FOWA 5FO5A 1ZTRA 1TVFA 1DGRM 3RH8B 4UUTA 2QM3A 3PQJA 1GCEA 3O8GA 4ZZLA 2VBWA 1X1BA 1VQPI 1GXPA 2Y2GA 3RCOA 2NOGA 1HCRA 1PVEA 3BPVA 1MNDA 1WKMA 2EFOA 1O3RA 3TSGA 2HYGD 4C2TA 3NRVA 5D4RA 9ANTA 4ZDOA 2VGKA 2K5CA 3A0VA 4BD1A 2VKEA 1W5CC 1EKEA 2XHKA 4V2FA 4Y4RA 4LFUA 4RB2C 2DXIA 3QU6A 3CCUI 3MKLA 3IWIA 4GD6A 2HNHA 2E8IA 2DT7B 2HTJA 2VBXA 2XD5A 1NZUA 3S2WA 3MQOA 2P81A 3MSHA 4CYCA 2M87A 1YLTA 3T1BA 1G2HA 3RJPA 2XD1A 1ZLKA 3GV9A 1MDMA 3E6DA 3HRUA 4IHSA 2GZWA 1N25A 2R0QC 4GCVA 1WHUA 1ZGWA 1DY6A 4RX3A 3C18A 4AVZA 3CP2A 2B63J 1GLNA 2XF7A 2GIZA 3HLCA 3OYJA 1TD5A 5B66C 4KQDA 1P4WA 4NK3A 1D5VA 1JUMA 4GZBA 3U2RA 5FI6A 3T0YA 5F1RA 3NHQA 1SKOB 2B18A 1YITI 1P2FA 4AVPA 2E1MC 3IHUA 4DZJA 4GXOA 3IWQA 2WKRA 3U1KA 3O2PE 1Z3YA 3LFUA 1QZYA 1S4RA 3UMDA 3GZNB 2K3PA 1VEUB 4C3QA 1HLVA 2FFYA 3T4QA 3T8TA 2XGDA 1D5YA 2Y8HA 1TEMA 1YM1A 4AIKA 3C7UA 1BR2A 4IQJA 3ZMZA 2R92J 3G2ZA 5F82A 5KSCA 4WL9A 1LPQA 1A35A 4PJJA 4EJTA 3KZZA 1NYYA 3U21A 4A0ZA 3WGIA 1YSQA 2QQBA 4IL6C 1HZOA 3CCSI 1NLYA 2ME0A 2P74A 1N4OA 1HSJA 3IF6B 1I5ZA 3LIDA 3FK6A 2ZMVA 3WRZA 1OYWA 5LHGA 1W7FA 2V1BA 2HDWA 2CW7A 3NC8A 2WGIA 3BG6A 1RUOA 1R6RA 4C30A 3K2AA 1I50J 3PBNA 2P4WA 3A3EA 5KVRA 5EZHA 2Z33A 4K2EA 5HODA 1LI9A 3F1OB 3QHYA 3GTLJ 1OTBA 3UY6A 1T0FC 3I56I 4FE7A 1T38A 2C6YA 4I3AA 2M1CA 1W5DA 1ZK8A 3FMRA 5I5LA 3PNTA 1LNWA 1VQOI 4BHCA 5LEKA 1FLIA 3LR5A 4QWOA 1WJAA 1Y4OA 1LFPA 1Z67A 4K0WA 2HDSA 1SKFA 4WBGA 3MKYB 2O9LA 3MXQA 3N8SA 3NULA 2ESHA 4Y33A 5EVEA 2HFHA 3CJTB 3WODF 4OP5A 4M9ZA 1P9WA 1YS6A 1C3BA 3HM5A 4WF2A 2VKSA 5CVVA 1TQMA 4F91B 1PW1A 5EM0A 2QCOA 1YYVA 4MN5A 2E35A 3BTCA 1OMEA 2FSWA 2F4MB 4HRIA 1XDUA 1PWDA 5EJCA 4OPRA 3FXKA 3VPRA 2ZLYA 2CW0F 4BHBA 4MQ9F 1BI2A 4BMWA 3SW1A 1UG0A 4U0XA 5AQAA 2JUGA 2E5NA 2PMHA 2EZKA 4PDKA 4Y5FA 4FT8A 1BIBA 2LY2A 2FNPA 3T4KA 3T4SA 5GHXA 3W2ZA 5FQQA 1S7OA 1UHSA 3A01B 2EFWA 2XIGA 1FR1A 1H8MA 2W3GA 4OP8A 3UPOA 1B6AA 1POGA 2PLYA 4LLNA 4OOLA 1J75A 3GEZA 4UNOA 1GSVA 3LEZA 2DPDA 3V67A 2ZOHA 1WYCA 1PI5A 3E5XA 4M6XA 1F2KA 1D3YA 5FLVA 2JRMA 5FDSA 3PJRA 1TWCJ 2NNYA 4I39A 1E4DA 1HKSA 4Q5SF 2OA4A 5CLSA 4DF6A 4ZAMA 1MY8A 4MIMA 5F0HA 3PAEA 1FSWA 4HPQA 1JWVA 4FD8A 2PYPA 4AC0A 3KP7A 3V4GA 4B4CA 1ZG6A 2H6CA 1BIAA 5K7HA 5D4SA 4LITA 2VASA 1KDWA 3E98A 2LR8A 4MBHA 3CMYA 4L9TA 3S3MA 3G1OA 5EE8A 4B43A 1R71A 1PZOA 2P6TA 5AVEA 2BY0A 1P7IA 3JR9A 2LY9A 1D0XA 5JLWA 2OQRA 2IWDA 4UXNA 2PBDP 1K78B 2ZD8A 3BJ6A 3J7ZI 4N4OB 5HLGA 4G12A 2ETHA 1MIJA 4HYEA 3S1MJ 3KFWX 5DYMA 3KETA 5HAPA 1GSXA 3GFJA 5K5RA 3L2QA 2BE5F 4ETZA 2WKEA 5HDNA 4JXGA 3F9KA 2GIVA 5DD4A 4PJMA 3CMAI 4IHXA 1W63M 3KEQA 1D7EA 3UO9A 4WN5A 4HLYA 4JGPA 4W1UA 2QENA 1BC7C 1KVMA 2ZB9A 2Y48A 3IC7A 4YEJA 2LC2A 2VQGA 3VP4A 3LO7A 4P9FA 4XLCA 2PEXA 3REOA 1CF7B 3TGNA 3AGEA 1FOYA 2GOXB 1HTZA 3H9JA 1FSHA 4A5NA 3IHBA 4C3HJ 4CZCA 5EYRA 3O3KA 1I2WA 3DWZA 2QHKA 2HF6A 4AFIA 5DF9A 2W3FA 2V0WA 1MKIA 1ORKA 5LGNA 3UE3A 3FXUA 2IRFG 3IV5A 5E2EA 4ZJ3A 1LDDA 3C1DA 3S15J 2BTFP 3HLDA 4B4ZA 1T08B 3LWFA 4A69C 5ICEA 1H9TA 4BH9A 1AU7A 5GHYA 3S7PA 3VE4A 1MD0A 4P5OA 3S1RJ 4RMNA 2M30A
chains in the Genus database with same CATH topology
3CUQB 3GO5A 2ZO4A 1ON2A 4L9EA 5HPIA 4CZZA 3ZN1A 3ZN0A 2B02A 4HZFA 4KT5C 4JK1X 4LRXC 5HDGA 1NWZA 4B09A 5HDSA 5CX7A 2MBFA 3VOLA 1XJ6A 1HW1A 1XGSA 1P9RA 3NOUC 2CGPA 1FZPB 1LSVA 3K3CA 1VTNC 4RGUA 4PGHA 4BBTA 1N9LA 2CMNA 2L01A 4Y3IA 2FF4A 3B02A 3LIBA 2DW4A 1S67L 4GHIB 5ICGA 4M71A 1J7KA 2W0NA 1YTYA 3MZHA 4F3LA 4EETB 5HDCA 3LUQA 5L3DA 3LR0A 4ZYEA 2ELHA 3EOIA 2FA5A 4JGOA 1G3WA 4IJGA 4IRIA 3IKVA 2B0LA 2Z6CA 2UXXA 3J80Z 4GCZA 5TJJA 1IXRC 4MN6A 3H7WB 1XD7A 3PBOA 5BQTA 2M8EA 2IVMA 3RIRA 4FHTA 3PHYA 4M72A 4HLXA 2XKOA 2W1TB 3ISPA 1WSUA 4U0YA 1XMKA 3GFLA 1W7PA 1QGPA 1U5TB 2KRFA 5ILSA 1P0ZA 2IA2A 3BPXA 2AS5F 1ZG5A 3JAMK 2QJ7A 3HJKA 2LF7A 2W57A 3W6JB 2F5DA 1FNNA 3LQQA 4CO8A 3H9WA 4PKYA 2YX4A 4HJ3A 2RGVA 5G4YA 4U88A 2EJRA 4GS9A 3KO6A 2PR6A 1YAXA 3RKXA 4PCQA 2QUFA 3RKYA 4HBLA 4E70A 3E4QA 2OZ6A 3WE3A 5ERIA 3DV8A 5HD5A 1FBUA 4R8HA 1O3SA 4CGZA 1ZRCA 1BOAA 5FL3A 2I9VA 3CUEC 3BDDA 4EXOA 1TS6A 2VBYA 4KUOA 3MMHA 1FYMA 4N9HA 4O3MA 5J7EA 4A6DA 5JI6A 2HKXA 2IP2A 3I64A 1T0FA 3KSGA 1F9NA 1XFQA 4G7OF 3K2ZA 2EV0A 5ILUA 5IT9K 2JTVA 2Y79A 3CUQC 1VB6A 1QO0D 5D5UB 1ZN2A 5EFWA 4HQEA 1USSA 2Z5UA 1MJBA 1ZREA 3B47A 2GQQA 2D01A 3T5XA 4IPAA 5IS1A 4B8XA 5DCMB 1YSPA 4R70A 4DNCA 3E0YA 3D0SA 3MAJA 1UB9A 5BS6A 3GF2A 4XLNF 4HA8A 2K7SA 3LR4A 4BHPA 3Q9VA 1W7PD 3EYIA 3FF5A 1R1TA 3M8FA 3ZMDA 2V6CA 3P7NA 2DPUA 4UQIM 1QBJA 2BYVE 3COAC 3ABUA