3MQ0A

Crystal structure of agobacterium tumefaciens repressor blcr
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
251
structure length
243
Chain Sequence
SQISDTVPALRRAVRILDLVAGSPRDLTAAELTRFLDLPSAHGLLAVMTELDLLARSADGTLRIGPHSLRWANGFLSHLDIVSTFNDHLAQRHDLDPYTVTLTVREGGEVVYIGCRNHTFRIGMRLPAPFTATGKILLSDLGPGELRMLFSQFPQPLTSRSVAGLSQLEEELALTRARGYSIDDGQIREGMLCIGAAIRDYSGAASAGIAISLIRSEASDEKIAYLGEELRTTANALSEKLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Agrobacterium tumefaciens Transcription Factor BlcR Is Regulated via Oligomerization.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Transcription repressor
molecule keywords Transcriptional repressor of the blcABC operon
total genus 76
structure length 243
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
A PF09339 HTH_IclR IclR helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mq0A01
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mq0A02
2HKXA 1K78A 1O57A 3BP8A 2Y79A 4KFCA 5E1XA 4L5IA 4XSZF 1LDDA 1MGTA 2E1CA 1SFEA 3ZP5A 2RN7A 1KQ0A 1I6XA 4P55A 4AIHA 3J81Z 4RAYA 2W1TB 4WWCA 1B4AA 4EQQA 4YIFA 2K31A 4IF4A 3E6DA 3RTRA 3K9TA 4WXHA 3H92A 3DPTA 2QYOA 5AIQA 2YX7A 5D6FA 1ON2A 3FX3A 2VBXA 5LBRA 2F2EA 4G94A 3WU0A 1V4RA 1LEAA 3FMQA 1BI1A 4G9YA 4HF1A 3V7CA 4I98B 4WXCA 4S04A 3F8FA 3CLOA 4L18B 2JPCA 5CVJA 4Y15A 2QVOA 2O9CA 3ZN1A 2O9AA 4R79A 5LBQA 1S7AA 2V6CA 1TD5A 2J5PA 2G9WA 4DNCA 1K78B 1U5TB 4LRXC 3T8RA 5IT9Z 3FXQA 1HKSA 2QENA 1XD7A 3O2PE 3OOPA 1LEBA 3W6JB 3V7SA 2XASA 3RYRA 3F8MA 4KIGA 2PG4A 3M8FA 1T2KA 4Q4ZF 5DCMA 4RB1A 3MFKA 1JHHA 3IBJA 2MH2A 2XGXA 1OYIA 3E3VA 5KVRA 4Q5SF 1MDMA 3I54A 4Z1WA 4OMZA 3QRFF 4IHSA 2D2WA 3CO6C 4CQHA 4LFUA 4A5NA 4YIIA 2DO7A 4EMSA 3V8JA 3GVAA 4L9NA 1PUEE 4M71A 2ESNA 4FT8A 1YW9A 2LB5A 1H9GA 1TTYA 1P6RA 5I5LA 3K2ZA 5DUKA 2NAZA 4Q47A 3EYYA 4GLQA 5H6QA 2DW4A 3HSRA 1RI7A 3TOBA 2RDPA 1IRGA 4R1HA 5EEHA 2ZO4A 4ZYGA 3LSTA 3LWFA 4U88A 2O6GE 1DPRA 1U2WA 1O7FA 2NNYA 1KQ9A 3CTAA 3AAFA 4KICA 3G73A 2P5KA 2EV6A 4NB5A 5E20A 4K2EA 3TOAA 3TRCA 4OMYA 1DUXC 3RKXA 1ZHFA 3KEQA 1UB9A 2C6YA 1W7PD 2Z5UA 5HPIA 4A6EA 2GA2A 1R36A 3ZMSA 2JTVA 1OMIA 3SZTA 3GYHX 3RPQA 3WTZA 1XGNA 3S2WA 1XDUA 4M9SA 3D5LA 5LEJA 4D0PA 1T0FA 3EDPA 1R1TA 5L3EA 3KCCA 3W2ZA 2K4BA 3M1EA 4MTEA 4O5VA 2WV0A 4HOBA 3FHZA 1MJAA 2ETHA 2JSCA 5L3FA 4XLPF 5LRRA 2DPDA 5D8KB 2R3SA 2STWA 2HZTA 3HOTA 4MGRA 3Q5FA 4L0YB 2VN2A 5FFXA 4BHPA 5K1YA 2A5YB 1Z7UA 4G6DA 5ICCA 1ON1A 1IN8A 5LHGA 3V8KA 3Q9VA 4ETZA 1D5VA 2MA3A 3F8BA 2K2NA 3L09A 1WRJA 4R8HA 2H6BA 5A2QK 5AONA 3RFBA 1O7LA 3J80Z 3LAPA 4UNOA 1H0MA 2Z33A 4TV7A 1K7AA 5DV5A 3WE2A 2VC0A 5HDGA 4QLCU 5F1RA 2VZWA 3I58A 5DEQA 2EA4A 1MKMA 4M74A 2RQPA 2MH9A 1UFMA 2V1DA 1J7KA 3ECOA 4IPAA 4RGRA 5TJJA 4HYEA 5ERIA 5LGUA 4DMZA 5D5WB 1R00A 2V79A 3ZMZA 3QP6A 2H94A 3ZQ5A 2LSOA 3BOQA 4WF2A 2XHKA 5F6FA 2IP2A 3VV4A 1J2XA 1IW7F 1W7PA 3IWFA 2W84A 4EJUA 1YW8A 2O0YA 1ZAOA 4OU0A 4OINF 2Q8KA 4IUKA 4MEXF 3MZYA 2K4JA 1ZGAA 1B9NA 2DPUA 5F64A 3I64A 4G3KA 5FB2A 3F3XA 4MCWA 1FSHA 2RVCA 2IVMA 1ZN2A 3ZMTA 4B8XA 3E5UA 1B6AA 3BPXA 5DD4A 2A07F 1ZG1A 4MQVA 2O99A 2CFXA 4E04A 4EM0B 1Z1DA 4DN0A 2M1BA 5D4RA 3B02A 1WSUA 3O5YA 4JBAA 1G3TA 3R4KA 4ZRRA 3O6BB 5K5RA 2XKOA 4ZZLA 5E1WA 1IXRC 1PP8F 4LRZE 3F6VA 4HV5A 2EFOA 2BBYA 2W1RA 2F5CA 1FYLA 5L3GA 1TF1A 4I02A 1ZYRF 2CWEA 5LGTA 1JHFA 2M5WA 4NQWA 2FQ3A 3R0AA 4I0BA 2L54A 1R5GA 2IA2A 2KJBA 4A6DA 2XVCA 1HW2A 1J0RA 2DT5A 5D5VB 5E18F 3IC7A 1XDSA 1YG2A 2ZXJA 4A0XA 2J5OA 2QQBA 1G3YA 5IT3A 2GX5A 4EGZA 4PGGA 2K7LA 3MWMA 3R6SA 2IW5A 3GF2A 4HDUA 1FC3A 3MF0A 3WTVC 5IT9K 2IT0A 4CXFA 1IF1A 4ZZDA 4G6QA 2EK5A 4IRIA 4MNUA 2TDXA 5HDKA 3KSIA 1TNSA 4Y5FA 5K5OA 2V9VA 2HWVA 3P7NA 5DFYA 1E2XA 4CHUA 3QP5A 4FX4A 2MD5A 2VONA 1LDJA 2DLLA 3K1PA 2D1VA 2P4WA 5HS7A 3RKWA 5HS8A 4R70A 5AIPA 4EU0A 2LDUA 3RI4A 4PAUA 3CUOA 3ABTA 4Q0JA 4KN7X 1YTYA 1KU9A 3QPTA 1BIBA 2KRFA 3H3ZA 4IXAA 3G3ZA 4LG0A 2Q2EA 3KP3A 2VC1A 4LK1F 2X0LA 4AD9A 2HTJA 1DP7P 4YG2F 4U7BA 4L9VA 4UVAA 1XN7A 4MMNA 2H09A 3IL2A 1QBJA 2M30A 2GXBA 1FX7A 2ZJ2A 3TO6A 2QLZA 2Z3YA 1ZH5A 4A12A 2E7XA 1XGOA 1SMTA 3N97A 1MD0A 2O61A 2O3FA 5BPDA 1OYWA 1KQ8A 4WXDA 4LMYA 5LRSA 4F7ZA 4AIJA 4B09A 2XAGA 1HW1A 1G3SA 4IJGA 3HRTA 3K69A 1B9MA 2HOEA 1NHAA 3REOA 4ME4A 5C5KA 5EEGA 2GA1A 2E1NA 1TBXA 4YFKF 2YPRA 3LA2A 2W25A 5FO5A 2MC3A 2XAQA 2W1TA 5J8FA 3QU3A 3E0YA 4U0WA 3ERED 2O03A 1TQIA 2MLGA 5D8LB 3EETA 4HQMA 1YLFA 2DQRA 3NQOA 5E8GA 2MBFA 4KMFA 4I09A 3FWEA 1Y0UA 1U78A 1F5MA 3R60A 2PMUA 2P5LC 1IXSB 4EVIA 3JTHA 2OZUA 1XSXA 2R7DA 1ONVA 4Y17A 3V7RA 2LKPA 4LRYC 1ZLKA 4MEYF 2FBHA 4LLGF 4LLNA 1ZARA 2ZNYA 3I5UA 3HRMA 3FMSA 4G3VA 1W5SA 3L9FA 5FLXZ 1JE8A 2ZMFA 1XGMA 1CGPA 4O0PA 1FPQA 4KA4A 1BOAA 2XV4S 2PJPA 1XGSA 1U6GA 2A68F 5L3BA 3IRRA 1MC0A 2Y8HA 4CDGA 3D3OA 1GXPA 2VOOA 3NOUC 1XB4A 2PMHA 1LNWA 3DXJF 3HRUA 3I59B 1SD4A 2FNPA 1LDKB 4ZYDA 4HA8A 3VODA 1MZBA 3GFJA 2CSOA 4FX0A 2PEXA 2L02A 3TGNA 4XBFA 2IPQX 1IRFA 2PQ8A 3MQ0A 3PFIA 2P7VB 3F23A 4CICA 2EFWA 4RQ9A 2LF7A 3BY6A 2ZMEB 2ZNZA 2DBBA 3BJNA 1QZYA 2F5DA 2LB9A 1QNTA 1ZG3A 3E5XA 2M45A 1BM9A 2D45A 4LLLA 2RC4A 5FD5A 5ICEA 3LFVA 2W57A 1YO5C 2JPBA 4GGGA 2EFQA 1EH6A 3GFIA 2HFHA 3VFZA 4PDKA 2COMA 4PZJA 2ISZA 3K2NA 5LEKA 1T6SA 4UHTA 3HOSA 3U2RA 1BJAA 2FU4A 1YW7A 1WKMA 3H3UA 2DK5A 2IA1A 1ZLJA 3EUHA 1J5YA 3OOVA 3ISPA 3ML6A 4N9IA 2HGCA 4R6LA 1KU2A 4BNCA 3O3KA 1J9IA 3GO5A 3W6KB 1HKQA 1S29A 2O8XA 1R7JA 3JAMZ 1FBQA 3K1MA 3L00A 3ECHA 3I71A 2QBYA 2JRTA 5CLSA 2ACJA 2K27A 2P6SA 4E70A 4HAMA 2VODA 4HZFA 3IKTA 6PAXA 4M9ZA 4O6JA 5E1ZB 5HSQA 3KLNA 1T38A 3KZYA 2XAFA 1D8JA 2AS5F 4P9FA 1BC8C 4EJOA 1Z91A 1SFUA 4A5MA 4HDVA 3BWGA 5BPIA 3JAMK 4GCVA 5FD6A 1IUYA 2OU2A 1Q1HA 1P4XA 2RGVA 1E17A 3SXYA 4YFXF 5H6RA 1OPCA 1FP2A 1Z9CA 3KSHA 2W3HA 1SFXA 2CQKA 2W3GA 3TO7A 3C7JA 3WU1B 2QQ9A 1A04A 1O3SA 3D0SA 3TO9A 3HTSB 3RPUA 1R23A 5K5QA 2HTSA 5E8IA 1XMAA 1YS6A 1R1UA 3SQNA 3S7PA 3FMRA 3NEUA 1RZ4A 2DK8A 3K1NA 1ZRCA 3NHQA 2ZCWA 4IRGA 3M7GA 3GXOA 5JVTA 3S7OA 1S7OA 3BJ6A 2EV0A 5DD8A 2ZBKA 2YSRA 2W24A 1EH7A 3HCYA 1FZPB 3QOPA 1ODDA 2L01A 3FM5A 1GHCA 3C2WA 2D1HA 5ILUA 1MDMB 1P92A 4XRFA 3U9GA 2XUBA 3M9AA 4G3WA 1IXCA 2B18A 5BMZA 1VHMA 2QQAA 3T0YA 2FEZA 1O3QA 2HEOA 3ZPLA 3LFKA 1ZRDA 2Z99A 2AXLA 1BI3A 2P7CB 1I1SA 3HSFA 2OQGA 5LGNA 2ELHA 1TQPA 3SZPA 3RKYA 1KYZA 4EUVA 4IUHA 2HQNA 4CYDA 4NHJA 2G7HA 3VEPA 1BC7C 1ULYA 4KIFA 1BBYA 1KA8A 4G7ZF 4HF0A 3KO6A 1MJ9A 2UXXA 5D4SA 1EV7A 4EJVA 5HLGA 2WC2A 1RUOA 5DUIA 2XKPA 2VBYA 4JK1X 4ETSA 3J80K 4GO1A 1W4MA 2RKHA 3KP5A 2QM3A 3ULQB 5KK1A 1AOYA 4BAYA 1TW3A 4ENNA 5BS6A 2Y75A 1YYVA 4MQ9F 1D8KA 2CGPA 4Q0IA 5J8CA 2OAZA 3I59A 3E6CC 2B0LA 2EFNA 4UV9A 2VT3A 3QPHA 1FSEA 5J6XA 2EA2A 3NOPC 1UCRA 3R0JA 3GFMA 2EWNA 3N4MA 3CO7C 1ZREA 3JSOA 4BYYA 1IN4A 1RIOH 4BHBA 2UXNA 1R22A 1Z05A 2UWMA 5TRDA 3KETA 4ETXA 4I2OA 2OZ6A 1B1BA 4ON0A 4LG0B 1R5HA 4GYGA 2CW0F 4RGXA 1QPMA 4WK8F 4HBLA 1T39A 2DTRA 1CF7A 2EFPA 2BGCA 1O3TA 1GVJA 2YR2A 3JSPA 3S7NA 1TLHB 2L3DA 1RNLA 1F5TA 3IHUA 4OIPF 3G6OA 4MTDA 3KSGA 2QUFA 4OIQF 1YKDA 1IZ1A 4Q48A 3GWZA 4BHCA 3GUDA 3GW2A 4EJTA 2KIUA 2UZKA 4WX9A 4HF2A 4IVNA 1XSVA 4L5JA 3KP4A 1REPC 4HLYA 1B59A 3WGHA 2P8TA 1G4DA 2HS5A 3E6MA 3LAJA 4N9HA 5HLHA 4KIBA 2OA4A 1DPUA 2RV8A 3IBRA 1T98A 2ISYA 2DU9A 3C1DA 1FBSA 4LGWA 3T1BA 3HIFA 3ELKA 1YIOA 4M73A 4OOIA 2FE3A 3U1DA 3LA7A 2XRNA 2XROA 3BPVA 4OIOF 1X3UA 3NOTC 5JHUA 3E97A 2VEAA 3M8EA 2WWYA 1KGSA 4XSXF 5ILSA 4RB2C 2VBZA 3GEZA 3F72A 4A2UA 4ZYEA 4QWQA 1JGSA 1G6NA 1P2FA 1K79A 2M7UA 4P5OA 4CZZA 2HKOA 1S3JA 2W3DA 5CVUA 5HL6A 4HW0A 4M72A 2QZ8A 4EM1A 4IRHA 4M6XA 2EJRA 2QBYB 2A6EF 4BWIA 5H20A 1SD5A 3HTUA 5ICFA 3WGGA 5BQTA 1LQ1A 5HLIA 3KP2A 2M7VA 2R7FA 3ROUA 2FXAA 1P4WA 4LB5A 5HPFA 4ENKA 2M8EA 3ZMUA 2JT1A 2KKOA 1L0OC 4JQFA 3ZMVA 1SMYF 2DI3A 3P9KA 1U5TA 3MZHA 1KYWA 3J81K 4EV0A 5HOOA 2NS0A 2V1UA 2ESHA 5ILVA 2IRFG 2K02A 1S8NA 2M87A 2RNJA 3E98A 5DCFA 2NNNA 5CVVA 4EJWA 3BDDA 4G7OF 3I4PA 1U3EM 2ZFWA 3ZN0A 1QO0D 4O8GA 2HYGD 4LJZF 2GZWA 4LK0F 2EB7A 4ESJA 2GXGA 4PCQA 4KN4X 5LHHA 3DEUA 2LF8A 4EM2A 2FMYA 1PDNC 2H27A 1BIAA 3IWZA 3CITA 4P9UA 4CGZA 1V3FA 1L3LA 2O9BA 1YFHA 4UV8A 2W3EA 5DCMB 5AJGA 3BJAA 4UVCA 2A3SA 2FOKA 4KT5C 1SD6A 3SFZA 2P6TA 5DFXA 3I0TA 5D5UB 5FLXK 3BROA 3F21A 3LA3A 2HDCA 3JTGA 2YX4A 4Q0HA 4YNRA 2FA5A 4I01A 2STTA 2A6HF 3LQRA 4S05A 1IN5A 1FBUA 4HX8A 3JW4A 1YSPA 1HSTA 5D5XB 4MN7A 4DQ2A 1R58A 1EH8A 4O01A 2KOIA 4ENMA 4ENJA 1BI0A 3MMHA 2FMLA 2QWWA 1U8RA 3FXRA 4L9JA 1FWZA 4MHGA 2HYFA 5CVRA 3IKVA 3TDZC 5CVIA 4UVBA 1USSA 2BE5F 2GIVA 5LLQA 2ADUA 3WTWC 5E17F 3T8TA 2OOLA 3HHGA 1KU3A 5K5BA 5CJ9A 5A2QZ 4KUMA 5L3CA 3GZ6A 3WTSC 3NRVA 1IN7A 4HX4A 1ZGJA 5JFRA 1Z6RA 3HHHA 1FYMA 3WGIA 1TQMA 3PQJA 2OQRA 1U5TC 1HBXG 4Y3IA 2FBKA 2K86A 1FYKA 3HYIA 4G8XA 2IJLA 2FSWA 4YFNF 3WTUC 3COAC 3WTTC 1I27A 2DQLA 2HR3A 3WODF 3CJNA 2V1XA 4HLXA 3TDUC 3DF8A 5DDGA 1ZG5A 3RIRA 3F8NA 3L7WA 1FOKA 4Y2FA 3GLXA 3KP6A 1ZRFA 1TNTA 3CUQC 4GW9A 4HX7A 2GWRA 3J7AO 4I7HA 2MLKA 1C0WA 1GXQA 1AWCA 4IJAA 5L8MA 1STZA 3V8LA 4YOFA 4OIRF 1QQIA 2VKSA 2E7WA 3C3WA 5HS9A 4L9TA 5ED4A 2HQRA 4ZYHA 2GQQA 2F5FA 1CF7B 4U0VA 4QPRA 2VBWA 3FZVA 4MDZA 3FXUA 1D3YA 2VE9A 2VT2A 1HW5A 3E5QA 4RB3C 4EGYA 2PFBA 1W5TA 5HVQC 2VJWA 2ZKZA 3FF5A 4RS8A 2PN6A 2W3FA 4G7HF 1YSQA 3CI6A 4N0BA 1Z6TA 3P9IA 1F1ZA 2A61A 4AIKA 3VOEA 2X4HA 2LNBA 2L4AA 1IN6A 3KP7A 2XIGA 4HV6A 1W7PB 3Q9SA 5ICGA 4XLNF 1FNNA 1J75A 2FBIA 4LB6B 2XAJA 1J59A 3C18A 1OKRA 2L4MA 4IHTA 2FF4A 5JI6A 4Z2YA 2A69F 3RYPA 2CO5A 4H0EA 3DPLC 5LHIA 1F4KA 2HGVA 4AWXB 4GYIA 1OYYA 3ABUA 3TKYA 1TW2A 2Y0MA 1WI9A 3HUGA 1DDNA 3IRQA 4AVPA 2XSSA 3F22A 2GAUA 1P4AA 3EYIA 2OD5A 3WTYC 2PLYA 3I53A 1PP7U 3DQVC 4U0YA 3R61A 3DBAA 3F6OA 2PBIA 4GXOA 3EQLF 4ESBA 2XAHA 3MEXA 2P5VA 3TQNA 5CYVA 4RGSA 4M9XA 1KU7A 4FHTA 1FP1D 1I1GA 4BH9A 1YS7A 3P9CA 1BN5A 2KJCA 3KZZA 3ZMDA 5HDNA 4RB0A 4O3MA 3RJPA 1I5ZA 2WTEA 3SHFA 4ZH4F 3HSEA 2BV6A 1S6LA 1H9TA 4I0AA 2KIFA 2IA0A 1O3RA 4KDPA 3WG9A 2G7UA 3MAJA 3DKWA 5FFZA 1QGPA 1K6OA 3CDHA 1LJ9A 4UUVA 4RGUA 1OR7A 1R1VA 3B73A 1MJBA 3S7QA 2FRHA 1WWXA 1USTA 2NYXA 4ASNA 4PGHA 3KSFA 3OBFA 1WQ2A 3VB2A 1FT9A 2EV5A 2FNAA 3KLOA 1G3WA 1ZTUA 1HQCA 2CYYA 2DFIA 3BZ6A 1UHWA 4BXUA 2KIMA 2Z9OA 1SD7A 3MCZA 4P96A 3WE3A 4Y13A 3KE2A 1VTNC 5L3DA 2DAOA 3DV8A 3LQQA 4BQAA 3DP7A 1HXDA 3CUQA 5DYMA 3L2CA 3E6BA 3GX4X 2BEOA 3DFGA 4UXNA 1QZZA 3HRSA 1RUNA 4WCGA 2F5EA 2W85A 3F8CA 3PQKA 5D6EA 2NRAC 2QYBA 3RDIA 1BI2A 3GZ5A 3K0LA 4FOFA 4A0ZA 1FLIA 4M6YA 5JR3A 2VE8A 2VXZA 2KLIA 5BOXA 1XCBA 2Y48A 1XMKA 5FGMA 1SAXA 4CO8A 1UHMA 3OV8A 4LD5A 4L0ZB 3ZQ7A 2YU3A 4U7DA 1LVAA 2ZMEA 3V4GA 3QAHA 4RAZA 1JXSA 3QU6A 3EEAA 2CG4A 4ESFA 1F9NA 1FY7A 4KMUX 3WTXC 2BYVE 1HSJA 3CUQB 2Q0OA 4A0YA 1YQAA 3KEOA 3T5XA 2PI0A 4HQEA 2OBPA 3BJOA 3KFWX 1LB2A 1XSDA 2JZYA 3GFLA 2VOPA 1XCVA 1HKTA 3FM3A 2H6CA 1IAWA 4KYWA 4KNYA
chains in the Genus database with same CATH superfamily
2HKXA 1K78A 4KZ6A 1O57A 4BJ6C 3CESA 3BP8A 1T1AA 3LSHA 2O7OA 2Y79A 1T95A 3G31A 3K7AJ 4KFCA 5HARA 1OTAA 2HDWA 1D1BA 4L5IA 5E1XA 3CJQB 4XSZF 1LDDA 1MGTA 4DYQA 1PWCA 2E1CA 3A3FA 1SFEA 1QRYA 3ZP5A 1RGZA 1VNDA 2XF6A 4NC6A 3DWLE 1K55C 2RN7A 1KQ0A 3ZG9B 1I6XA 5DKKA 3L2RA 1OTEA 3ZCZA 4P55A 4XICA 2GDNA 4AIHA 3IXBA 3J81Z 2HZDA 3GTGJ 3D5SC 2INWA 3EUAA 1XP4A 1KE4A 3U4LP 3FIWA 3ERMA 1FR1A 4RAYA 2W1TB 5IPAA 2DMPA 2KQRA 4WWCA 1B4AA 4EQQA 4YIFA 3CLQA 4WL9A 3T1XA 1CJFA 2Y2KA 2KZGA 1JKQC 1E25A 1K25A 2K31A 4OP8A 5GLDA 4IF4A 3E6DA 2XF5A 3RTRA 4CYCB 5FA7A 3K9TA 1X1DA 3H92A 4WXHA 1PUFA 5J3LA 5F5YA 3AFHA 1UGUA 3DPTA 2QYOA 3LR5A 2M7AA 5AIQA 1UHSA 1W63M 2YX7A 3S17J 3NARA 4PFPA 1WJEA 1ON2A 5D6FA 1OCCH 3DW0A 3FX3A 2VBXA 4G6TB 2LREA 4OQHA 1I3AA 1TS0A 2R9WA 1RCJA 1TS6A 4N9KA 5LBRA 4UUSA 2F2EA 4G94A 4M3DA 4C75A 3IUOA 1ETWA 3WU0A 5CGXA 1V4RA 5JYPA 1LEAA 3FMQA 1BI1A 4G9YA 4HF1A 2IS4A 3H9WA 3V7CA 3MFXA 4I98B 4WXCA 2QZ6A 3VP0A 4S04A 3F8FA 1K6RA 3PO2J 5F08A 3CLOA 4L18B 2Y59A 3I3LA 3QODA 2JPCA 1P9RA 4IL6C 5CVJA 2WAQN 2O9LA 3SH7A 2V8CA 1E4DA 2HI3A 3UPOA 1JI8A 1QMEA 4Y15A 1TDLA 2QVOA 2O9CA 2P04A 3ZN1A 2O9AA 3N8LA 4QU3A 4EV4A 1OLTA 3WG7H 4R79A 2HQAA 1YX3A 5LBQA 1A0KA 1S7AA 1D1CA 2IGNA 1FSYA 2V6CA 3NDGA 1TD5A 5DTKA 4DXBA 2A49A 3LSIA 2J5PA 3JVUA 3JRIA 2G9WA 1P97A 1X3WB 4V2FA 4DNCA 3HB9A 1CI8A 2VI6A 2M4GA 2CV2A 1K78B 1ALQA 1WYBA 1U5TB 5D3OA 4LRXC 2LY2A 3T8RA 3ITBA 5IT9Z 3FXQA 1HKSA 2QENA 1XD7A 3O2PE 3OOPA 4CUGA 1LEBA 1W8QA 2ZLYA 1BJZA 3W6JB 3V7SA 3WS4A 2XASA 3UO9A 3RYRA 1PW1A 3H5AA 2VB6A 3F8MA 3EUHC 4KIGA 1X0OA 3KYZA 2PG4A 3MN2A 2WKIA 3M8FA 5FDSA 3CMYA 3BQAA 1J3WA 3SDGA 4X1LA 1T2KA 4Q4ZF 2JKFA 5DCMA 4RB1A 2A05A 3HDDA 4CCJA 3ZG7B 3MFKA 2WZZA 5IYCJ 1FTZA 2VK3A 1JHHA 3IBJA 2MH2A 1TWAJ 3FC7A 4NK3A 1OYIA 2P81A 1B72B 2YKFA 3OCLA 4NXEA 5DF9A 3E3VA 3ICYA 4WZ4A 3C30A 3A01B 3IF6B 3TEDA 1FOYA 4BE0A 2VUMJ 5KVRA 4Q5SF 3S1YA 1MDMA 1IYPA 3I54A 1VEUA 4Z1WA 3SJMA 4OMZA 3QRFF 4IHSA 1A31A 4KISA 1KGGA 1V5EA 4XLFA 1H8YA 2WB1A 2D2WA 3MSHA 1QMFA 3CO6C 4CQHA 5C4JJ 4LFUA 4A5NA 4YIIA 2DO7A 4EMSA 1MXOA 3A01A 1LSXA 1XFNA 4EBNA 3IXDA 3HLEA 4JX5A 1YIJI 3F9KA 3V8JA 4D1QA 3UB7A 2Q9MA 2OTJI 3GVAA 3HLGA 2MGQA 4L9NA 3D1NI 3LIAA 1PUEE 4M71A 3SH9A 2KL4A 2D02A 2ESNA 4FT8A 1YW9A 3EGDC 4K08A 2RREA 1UWNX 5FJ8J 2LB5A 1H9GA 3WS2A 1TTYA 1P6RA 1X2NA 3K2ZA 3FK7A 5DUKA 2ZQ9A 2NAZA 5GLAA 3HC7A 5I5LA 4Q47A 3RCOA 2GIZA 3EYYA 4J19A 3UMDA 2DA4A 1YPRA 4GLQA 2DOAA 5H6QA 2KX6A 2DW4A 3HSRA 1RI7A 4LOCA 4RAFA 4B47A 1HVBA 3IAS2 3UB9A 3TOBA 3CCSI 1VQ7I 5TBMB 2H10A 2RDPA 1RR7A 1FOFA 4U87A 4R1HA 5EEHA 1IRGA 2ZO4A 4HNVA 4E7HA 4KZ3A 3CP8A 4NBQA 4ZYGA 5HODA 3JRFA 3BWLA 3LSTA 2Y31A 1X3ZB 3LWFA 4ANJA 4U88A 2O6GE 1DPRA 3W2AA 1U2WA 4KUKA 1NXYA 1O7FA 2NNYA 4NXFA 1KQ9A 2KDZA 3CTAA 2J8YA 3AAFA 5KSHA 3WHCA 4KICA 2KMUA 4YWZA 2JCHA 2K9LA 2LH9A 3G73A 4M3KA 5EE8A 2P5KA 2EV6A 4NB5A 5E20A 4YINA 4K2EA 3TOAA 2ZC3B 3TRCA 4UA7A 3OYFA 5EFWA 4OMYA 1DUXC 3RKXA 1VQQA 1ZHFA 1XTAA 1K56A 1NWZA 1GV5A 3KEQA 1UB9A 1BT5A 4R23A 3Q0WA 5KAFC 2C6YA 1W7PD 2XQZA 2R7WA 3LL7A 2Z5UA 2HXOA 3H7WB 1N25A 5HPIA 1Z3YA 4A6EA 1PUFB 2GA2A 1R36A 1WZ2A 1PYYA 2A2LA 3PBSA 3ZMSA 4CPKA 1XJ4A 2JTVA 4F94A 1SFOJ 2O5RA 1BLPA 5FKKA 1OMIA 3BLMA 3SZTA 2CMNA 1XKZA 3GV9A 4X1MA 4NDLA 4S0HB 3GYHX 3RPQA 3RQ4A 3H5RA 3WTZA 1XGNA 3T4QA 3S2WA 3MKLA 2K3PA 2R5ZA 3IS2B 3MKEA 1XDUA 2CH0A 4P87A 5HNHA 2LBFA 1HF0A 1LL5A 3VDXA 4M9SA 3D5LA 1BSGA 5LEJA 4D0PA 1T0FA 1IO2A 4R3BA 4RAGA 3EDPA 3QP1A 4E7LA 4BMWA 1R1TA 5L3EA 1YM1A 3Q1FA 3KCCA 3W2ZA 1J9MA 2IGMA 2OSUA 5M3FJ 2K4BA 4HQAA 3M1EA 4MTEA 5IHVA 1RETA 4PJNA 4N1HA 4O5VA 3SS5A 2WV0A 1OQYA 3PJRA 5L10A 4HOBA 2R7UA 2VQCA 4D9JA 2WADA 2ZB9A 3FHZA 2FH5A 1MJAA 4NQWB 2ETHA 2JSCA 1MWTA 4H8RA 5L3FA 4XLPF 2DFHA 3BY8A 3RTYA 3HUMA 5LRRA 2DPDA 5FROA 4F55A 1UG2A 3K2AA 1S9HA 2R3SA 5D8KB 1VFCA 2ZM8A 3DBHB 3S1RJ 2STWA 5EVIA 1YI2I 2HZTA 1HLVA 3HOTA 3CG5A 3LR0A 4MGRA 3Q5FA 4L0YB 5E43A 2VN2A 3V39A 5FFXA 1H8ZA 4U0XA 5EPHA 2E19A 2OV7A 4BHPA 2A5YB 3RPUD 3ZRGA 5K1YA 3OWTA 1ZR2A 1E3UD 3BW6A 1Z7UA 4G6DA 5ICCA 4EERA 2Y2NA 1Z6FA 1ON1A 1IN8A 2BY0A 4XQFA 2ECBA 5LHGA 1ZR4A 2KLOA 1XFQA 3HREA 2PR6A 3A03A 1P0ZA 4MNRA 3V8KA 2V9AA 4GFBA 4OQIA 2ZOIA 2DMNA 3Q9VA 1B8IB 1WJBA 5F6AA 4ETZA 1Q1VA 1TWHJ 1EWZA 4KG2A 1VB6A 1B72A 1D5VA 2MA3A 3F8BA 4XONA 2K2NA 2XF3A 2UUZA 3L09A 3BLSA 1WRJA 3LSGA 4FSFA 4BBVA 2KISA 3C2GA 4R8HA 2L0KA 1LI0A 2H6BA 5A2QK 2X6YA 4Y0TA 3E0JB 2XPVA 1WJ5A 5AONA 5GHZA 3RFBA 3ZQLA 1Q2QA 1O7LA 3J80Z 4I3AA 3LAPA 3AG1H 4UNOA 4HNBA 2BHZA 1L0EA 4Y3OA 4N4NB 1H0MA 2Z33A 3I4NJ 3G32A 2VIXA 4TV7A 1LE8A 1K7AA 5DV5A 3WE2A 3VE3A 1IRZA 1SAUA 1K55A 2VC0A 3M3YJ 3H82A 5HDGA 4QLCU 5F1RA 2VZWA 5CEDA 2K85A 2HZ5A 1OTIA 3ZHHA 3I58A 3TP0A 3S3NA 3A3IA 5DEQA 1IUFA 2E8IA 2ZOHA 2EA4A 2JVGA 4OVDA 4LIVA 4ZYAA 1MKMA 4M74A 1ORKA 1Y39A 2RQPA 5J8XA 3C2BA 5FL3A 1RC9A 2MH9A 4WYYA 1YLWA 4NNJA 1UFMA 2L9VA 3EPZA 2V1DA 5JLWA 3MKWB 1RR8C 3HLBA 4A3IJ 1J7KA 3ECOA 4IPAA 1OTBA 3FXMA 2EZKA 4RGRA 1E3PA 3PBQA 4HH3A 3V5MA 3ONQA 5TJJA 1IDZA 5FLVA 5MC7A 2R7RA 4OOYA 1D1AA 4HYEA 5ERIA 5LGUA 1IFQA 2QJ7A 4DMZA 2JVHA 5D5WB 1VEUB 1R00A 1X1AA 2V79A 3ZMZA 3JPUA 3QP6A 2H94A 1MH4A 5F1GA 5CPRB 3ZQ5A 4CYCA 2JKTI 3AGDA 5FATA 2LSOA 3OPRA 3BOQA 4WF2A 5EVIC 2PMZA 2XHKA 5F6FA 4D2OA 1SDNA 4JF4A 1OCPA 2IP2A 3OYAA 1I2WA 5IP6A 3CCLI 1G68A 2HP5A 1J2XA 1HLUP 4KZ9A 1IW7F 3ZR8X 1W7PA 3IWFA 3G1LA 1KOUA 2KHMA 2W84A 3GRJA 4EJUA 1YW8A 4QTRA 2O0YA 1WJAA 1ZAOA 4XIDA 5K5BA 5GAHJ 1N9BA 4OU0A 2F48A 4B44A 2LR8A 3OYEA 3RZOJ 4OINF 1D0XA 1JWVA 2CC1A 4PKYA 4P0MA 1KDSA 2Q8KA 4IUKA 4MEXF 1Z77A 1PZPA 3IWQA 2ZFUA 3MZYA 2K4JA 4I3JA 5FEGA 2GOXB 3E7LA 1QHHD 4B3AA 4A3MJ 1ERDA 1ZGAA 1B9NA 3I56I 3GVBA 2DPUA 5F64A 3MMYB 3I64A 1VQ4I 4LV1A 2WKHA 3QHYA 1E3UA 5FB2A 1LL9A 3DWZA 4G3KA 3O3VA 3F3XA 2OLVA 4MCWA 2R5YA 2QCOA 2RVCA 1FSHA 5HNFA 2IVMA 1ZN2A 3ZMTA 3S1MJ 3Q7ZA 4B8XA 4IBRA 3E5UA 4JXGA 1B6AA 2M3AA 2DDBA 2AVXA 3BPXA 1G28A 5DD4A 2IBDA 3MZEA 2A07F 5HL1A 5DS9A 1ZG1A 2BLSA 2VX8A 4MQVA 4BBRJ 3KZIC 5IYDJ 2O99A 3S14J 1CI9A 2BTFP 2CFXA 1APLC 4E04A 2L9RA 5FI7A 5EZGA 2DA7A 2E5ZA 4EM0B 5F1FA 1Z1DA 4IVKA 2W1OA 4HSTA 4BDZA 4DN0A 2M1BA 4FTHA 3OYIA 1K0KA 2PDRA 1XX5A 4FQGA 3HLDA 1DJBA 1NRJA 5D4RA 3B02A 4AUXA 1WSUA 4AC0A 2NVXJ 5HX9A 3O5YA 1Y54A 4JBAA 1G3TA 3R4KA 1B8IA 3HPGA 4LITA 3KYDB 4ZRRA 3FPWA 5CKTA 3ZNYA 3K6GA 4B3XA 3O6BB 1FOWA 2AQFA 1QA6A 5K5RA 2XKOA 4ZZLA 5E1WA 4EQIA 3OS2A 3SS3A 1IXRC 3FBIB 3TP3A 1PP8F 2KFDA 4LRZE 3F6VA 3MZ8A 3CMAI 5BNGA 4HV5A 2EFOA 4UY8I 4IVIA 2HJEA 1XGIA 2BBYA 4GOGA 1CF0A 2W1RA 3ZGKA 2F5CA 3MZDA 4D5CA 1FYLA 2Q1ZB 2CV0A 1UAAA 5L3GA 1TF1A 2RNGA 4FTXA 4I02A 3IH8A 1ES5A 1ZYRF 2CWEA 5LGTA 3PM1A 4BD1A 1T33A 3OIQA 1XGJA 1JHFA 3M6BA 1XXMA 1CK3A 3I4MJ 4HBTA 4J00A 1D1JA 1JWZA 5F27A 2WYXA 3PAGA 2M5WA 3N05A 3OYKA 4NQWA 2FQ3A 2P9VA 1YITI 3R0AA 4I0BA 2V0WA 2QMIA 3AKZA 3BT9A 2L54A 1YJNI 1T1CA 3N8RA 4U0TA 5B3SH 3UE0A 1R5GA 2IA2A 3VFHA 2KJBA 3ZXSA 4A6DA 2L0WA 2XVCA 4DGWB 1HW2A 2ELJA 1IC8A 2L7ZA 2BVMA 2L9NA 1J0RA 4L5EA 4B4XA 1K6SA 2DT5A 5D5VB 2IS6A 4II3A 1L2SA 3LIEA 5E18F 2ZD8A 3IC7A 1XDSA 1YG2A 2ZXJA 3NBLA 2HXIA 3LUQA 1I2SA 3SOIA 1HDDC 2XF7A 3SZGA 4C3HJ 1I6HJ 1K4EA 2DOEA 2LBFB 4A0XA 3KYCB 2J5OA 2QQBA 4CCKA 1G3YA 1ERQA 5L07A 4UB8C 3T1RA 1Z21A 3PBOA 5IT3A 4X0GA 1S0WA 1HDPA 3DU5A 2GX5A 1LFBA 1MBJA 2CUEA 4EGZA 3F1OA 1NTCA 3NDEA 5I94A 4KZ5A 2L7FP 4PGGA 2JA5J 4NC7A 2NUTC 2K7LA 3MWMA 3R6SA 4B43A 2IW5A 3T1SA 1H8AC 3GF2A 4HDUA 2A24B 5EDNA 1FC3A 5KNLA 4B93A 2OUMA 4Y7NJ 4XM3A 3S15J 1YJ9I 1M6KA 3MF0A 5E2GA 3T4KA 3WTVC 5IT9K 1F43A 3ULFA 2IT0A 2DXIA 4AM3A 4GKUA 2WV1A 2E1MB 1W63Q 4EEUA 4CXFA 2XD5A 1IF1A 4ZZDA 1VETB 4G6QA 2HJ9C 2EK5A 3V3SA 4IRIA 4MNUA 4GCZA 1MBGA 2TDXA 4IO9F 5HDKA 3KSIA 1TNSA 4R3AA 4Y5FA 1TP4A 3FXLA 2LG4A 4JKTA 1HCRA 4RMNA 4JLFA 3IWOA 5CECA 1V9YA 3HKZA 5K5OA 1OT9A 2V9VA 3QYFA 4IZZA 2HWVA 1QHGA 4CJNA 1DGWY 2EBIA 3H5NA 3P7NA 3GTMJ 5DFYA 1P9WA 3RXWA 1E2XA 1Z7LA 5JVGF 4CHUA 2PR5A 3ISGA 1VQPI 4BENA 4DDSA 2CW8A 5CTMA 2K40A 2CUZA 3QP5A 2MD5A 4FX4A 3BYDA 4Z9QA 2VONA 1LDJA 4A3CJ 2DLLA 3K1PA 1X1PA 4NXGA 2D1VA 3A1YA 2P4WA 4RVAA 5HS7A 3RKWA 5C44J 5IT5A 2WB1N 5HS8A 4R70A 2X1DA 5AIPA 2ZC2A 4CCNA 4RM3A 3JRAA 1YJWI 1DP8A 2WKRA 2Z2LB 4CLCA 4EU0A 5L2FA 4E3KA 2R78A 2LDUA 1QVTA 3RI4A 2ACGA 3G30A 4LLOB 4PAUA 4S2IA 3P98A 5K7HA 1IKIA 4I3IA 3CUOA 3ABTA 1NLYA 4Q0JA 1WFXA 2EA9A 3S2DJ 5CHMA 2DT6A 1R4NB 1X1BA 4KN7X 3PUBA 4GD8A 2ME6A 1YTYA 1H8MA 1KU9A 3QPTA 4Q8IA 1BIBA 2KRFA 1U60A 1WH7A 4ZC3A 1LKXA 3H3ZA 3BFGA 4IEJA 4IXAA 2A6TA 5H2FC 1JKOC 2ZQCA 3BRMA 2VQLA 3G3ZA 3Q81A 4LG0A 3VPRA 3BQZA 4IHVA 3DKYA 2Q2EA 3KP3A 3U1KA 4X25A 4F91B 2VC1A 4LK1F 2PJRA 2X0LA 4AD9A 2HTJA 3OIOA 3OYLA 1HZOA 1DP7P 4WN5A 4YG2F 4HHDA 5F04A 4U7BA 4L9VA 4P1WA 4QY5A 4UVAA 1XN7A 4Y0UA 4MMNA 2H09A 4JGOA 2LTPA 3WS1A 4DE2A 2OWHA 4R4RA 5J3WA 3IL2A 1R9TJ 1QBJA 2R93J 5FQQA 2LK2A 2M30A 2GXBA 1NZOA 4AYBN 3Q7VA 2VKHA 1OJLA 5G4YA 4L0LA 1FX7A 4PJLA 1JUMA 3C4PA 2L2OA 1RP5A 3PHYA 2ZJ2A 3TO6A 5DTSA 4OOLA 2QLZA 2Z3YA 1ZH5A 3UDXA 2Y2MA 4ZTJA 3K4NA 4A12A 2E7XA 1XGOA 2OTLI 3Q7VB 2K9NA 1N77A 2R7QA 1Q2PA 4S2LA 3HUGB 4Y52J 3V50A 2M7BA 1E3HA 2F5VA 3BCBA 3TW6A 1SMTA 1ZG4A 4S2NA 3N97A 2FUG2 1MD0A 2ZL1B 4HRIA 3DTMA 2O61A 1LUJB 1K54C 1GSXA 2HYJA 2O3FA 5BPDA 1OYWA 2RQQA 2HP9A 3CUEC 3FZCA 1KZHA 3TSGA 1W36D 3ZNTA 3Q82A 1KQ8A 4WMCD 3HBRA 4WXDA 5FLMJ 3PBNA 4LMYA 2KDOA 2LLKA 5LRSA 4F7ZA 3F0CA 4AIJA 4B09A 2XAGA 1HW1A 3BG3A 4PM9A 5E2EA 5E2HA 5F82A 2N8GA 1G3SA 2BW3B 3N6IA 3HRTA 3K69A 4IJGA 1B9MA 2HOEA 1NHAA 2WAFA 4KJZA 2VGLM 1S5LC 1DP9A 2HPIA 4DF6A 3REOA 3H36A 4ME4A 1DRMA 5E3LA 3IF6A 5C5KA 4HH2A 3OYDA 3QQAA 3QOEA 5EEGA 2GA1A 5F1JA 3DEEA 2E1NA 4C9YA 1TBXA 4YFKF 2ZQ7A 2RCXA 2YPRA 2E36A 3FYZA 3IXGA 3LA2A 1F9IA 2W25A 4M3BA 2MC3A 2XAQA 5FO5A 2W1TA 5J8FA 1P7JA 3C2HA 3QU3A 3E0YA 4U0WA 2X1EA 3FXOA 4XRSG 5E3OA 3ERED 2O03A 1TQIA 2R7XA 1JNUA 4QJGA 2CQQA 2MLGA 4LIUA 1MWRA 5F83A 1BW6A 5D8LB 1ETXA 2W7NA 1S72I 3EETA 2ZMAA 2HOSA 4HQMA 1ZKJA 1QVUA 2LYCA 4YFMA 3N4IA 1YLFA 2DQRA 3NQOA 4GNUA 4P6ZS 1DJCA 1I5QA 3OIPA 3UMEA 5HDSA 2KRHA 5E8GA 2WGIA 2MBFA 4KMFA 4I09A 1R49A 2J80A 4ZDOA 3FWEA 2HVRA 1Y0UA 2K9QA 1U78A 2QSFX 1F5MA 3KX2A 5GAGJ 4GD6A 2ZC5B 1YOVB 4MLLA 3OC2A 3R60A 3TW8A 5HDDA 2PMUA 3PIOF 2P5LC 1IXSB 4EVIA 2Y2GA 3OLOA 2M4KA 1ETQA 2WY8Q 2H8WA 3J7YJ 4ZDPA 3L2QA 3LYXA 3JTHA 2OZUA 4JXVA 1A5JA 1XSXA 5KSCA 2R7DA 1ONVA 4Y17A 3V7RA 2WAQA 4BXXJ 2BY1A 2LKPA 2ZJ9A 4GDBA 4LRYC 5DKLA 4PM8A 1VF9A 1ZLKA 1K4SA 1PZOA 4K0XA 3H9QA 4AU7A 3CPTB 4MEYF 3MKYB 1TL8A 1I3QJ 2FBHA 4LLGF 2I72A 2HPBA 4JOMA 1GUUA 4PJ0C 4LENA 1OMEA 4LLNA 5IOYA 2XFSA 3G2ZA 5EECA 5AQ9A 5HAPA 1ZARA 2ZNYA 3I5UA 3LIDA 2X1CA 3HRMA 3BQ8A 2PBYA 3QPLA 5TBMA 1N75A 3FMSA 4HJ4A 5FEFA 4UA6A 4G3VA 1W5SA 3I9V2 1K4FA 4A5RA 2ZMEC 4ZDXA 4FETA 4C30A 2EIKH 3SH8A 4UQIS 1ENHA 3IT9A 3T1QB 3W4OA 3L9FA 5EOEA 3A2KA 3PBTA 2OAQ1 1MMAA 1VQ6I 3MR0A 3CMEI 5FLXZ 3PTEA 2V9PA 1JE8A 3BR0A 2ZMFA 1XGMA 1QPIA 3W8KA 1CGPA 3J7AY 4IHXA 4RA7A 1FCOA 4O0PA 1FPQA 3LSJA 4IHYA 4QB8A 5DM7F 4KA4A 1S1YA 4M3FA 1WYCA 1BOAA 3UKGA 2XV4S 3S32A 1NYMA 5G4ZA 3QP2A 2PJPA 1XGSA 1U6GA 2A68F 5L3BA 3IRRA 1FILA 3NAUA 1WHUA 4CDGA 1MC0A 2Y8HA 3D3OA 1GXPA 2VOOA 3EWKA 3NOUC 1AHDP 5CXWA 3EGXC 4BBUA 2EIMH 1XB4A 2X51A 4GRIA 2DMWA 2PMHA 2DA6A 5GTIC 3OZHA 1LNWA 2CQ7A 3DXJF 5AVFA 3HRUA 3PL8A 3I59B 2IS2A 3QNCA 4R3JA 4M6VA 1QU3A 1SD4A 2FNPA 1JTDA 3LY4A 1LDKB 4ZYDA 2PBDP 4XR6A 3WWXA 4HA8A 2DCEA 1ZC2A 2NVUB 4XXRA 3VODA 3ZQHA 3GTJJ 2XH9A 2MW8A 1MZBA 2J7VA 3OYHA 3GFJA 3S1NJ 4BQNA 3OPPA 5EVID 3V67A 2CSOA 2W4SA 3FBNB 2ZC6B 2E35A 4CZCA 3GTLJ 4FX0A 1VQOI 2E2HJ 2R92J 2PEXA 4KQDA 1G8XA 2L02A 1CEGA 1MNDA 2W00A 4IOCF 4C6YA 1SKOB 3TGNA 4XBFA 4KZBA 2IPQX 4MN5A 3PNVA 2A5WA 2TRTA 3K10A 3M2KA 5FRMA 5GLCA 5AQBA 3IH3A 1IRFA 1RPWA 2PQ8A 4BY7J 3MQ0A 4DIQA 1BUEA 4NXBA 4ABZA 3PFIA 2P7VB 3F23A 1SVOA 4BE1A 3A3EA 1GCEA 2H5SA 2XLNA 4CICA 2P74A 2EFWA 4R0QA 4RQ9A 2LF7A 3BY6A 1PFLA 4JX6A 2R9XA 1WA9A 4N92A 4NEED 1K57C 4GB7A 4A3GJ 2ZMEB 1VQ9I 5GHYA 4X6AJ 3HJIA 1ESUA 3C7UA 1LL8A 2ZNZA 2FFFB 4CA0A 2DBBA 3BJNA 3GSGA 1QZYA 2F5DA 4IQ4A 2LB9A 3M2JA 1QNTA 1ZG3A 1T8IA 3E5XA 2M45A 1BM9A 2I9VA 1WCMJ 2D45A 4LLLA 2RC4A 5FD5A 4ZDLA 3FG8A 2LY1A 5ICEA 3LFVA 1H89C 2W57A 4XKBA 5B5EC 1YO5C 3DAVA 2JPBA 4GGGA 2EFQA 3VOLA 1EH6A 3CP2A 3PSIA 3GFIA 2HFHA 4XLHA 3VFZA 4L9EA 4PDKA 2COMA 4PZJA 3BCAA 3W2VA 2XSDC 2ISZA 3K2NA 2L1MA 3A3DA 5LEKA 4BJPA 2JKRI 1T6SA 3MFDA 4UHTA 3HOSA 3U2RA 1BJAA 2FU4A 1YW7A 1ES3A 2JWTA 3H3UA 1MIJA 1WKMA 4E3NA 2DK5A 2IA1A 3PIPF 5E3MA 1ZLJA 3EUHA 1SKFA 4I99C 1TS8A 2WA0A 1J5YA 3M4OJ 1MY8A 2X48A 3OOVA 3ISPA 3SEQA 2F4IA 2EX6A 2BY2A 2ZXHA 3VOZA 3ML6A 4N9IA 3E2KA 2HGCA 4R6LA 1KU2A 5TFQA 3GLLA 3M1CA 4BNCA 5HZHA 3O3KA 2B02A 4MEZA 4XN0A 1J9IA 3GO5A 3SFIA 3W6KB 1HKQA 1S29A 1YE9A 2F4MB 2O8XA 3HOYJ 4A93J 1XA7A 3I55I 1R7JA 2FZ0A 1BOBA 3JAMZ 4BQMA 4JGPA 5A93A 5FI6A 1FBQA 2DODA 3K1MA 1NK3P 4CCOA 3L00A 2JKGA 3ECHA 3I71A 4RYEA 3VMAA 1Y8RB 2QBYA 3HUNA 2JRTA 3FXJA 3A4CA 5CLSA 3OYBA 2ACJA 1ACFA 2DRWA 4KQRA 2K27A 2P6SA 3LOCA 4RDUA 1XS9A 1MWUA 3JYIA 1OTDA 4E70A 4HAMA 2CUFA 4CCLA 2VODA 5IOZA 4HZFA 2VV6A 3IKTA 2Y2JA 3C4OA 2O8KA 4HEFA 3NIAA 2I10A 3JRGA 6PAXA 5AQ7A 4JGQA 2XDMA 1GSVA 3FK6A 4M9ZA 4O6JA 3GBGA 1U8BA 5E1ZB 4KQQA 4WLAA 3VE4A 5HSQA 5IU1A 2AO9A 3FKVA 2CS3A 2XSJC 5TGTA 3S93A 2DJIA 2PD8A 2E1OA 3BG6A 3KLNA 1T38A 2Y2QA 3IH2A 1SHVA 4H6JB 3KZYA 4BL3A 3T50A 3EOIA 2XAFA 1D8JA 2VJJA 2XGCA 4P9FA 1BC8C 2AS5F 3MJQA 4AFIA 4JF6A 4EJOA 4UAAA 3TJZC 1Z91A 1K57A 1SFUA 4A5MA 4HDVA 3BWGA 5BPIA 2E71A 4B9OA 2FFYA 1R4MB 4YIRX 4UA9A 2FX0A 2X02A 1Y6IA 3JAMK 4GCVA 5FD6A 2GOMA 1IUYA 2JBFA 2Y69H 2DOFA 2OU2A 2LY9A 3G1MA 3MKZA 2Y30A 1JJ6C 1Q1HA 1DU0A 2OCCH 2K3FA 3OYGA 2GLOA 3T4OA 2ECCA 1GA9A 2ZM0A 4IHQA 1P4XA 2RGVA 3F1PA 3W6VA 1E17A 2Q2EB 3SXYA 4YFXF 1W5CC 1XMXA 4WZ5A 3OR2C 3U2AA 2ELKA 2EZHA 3B3XA 5H6RA 1OPCA 1EKEA 1FP2A 3T4SA 3CWFA 1Z9CA 3UPPA 3KSHA 2W3HA 1SFXA 1BR4A 1ONGA 5EG0B 2BW3A 3F1PB 2PYRA 5AQAA 2CQKA 2W3GA 3TO7A 3BG5A 3C7JA 4AIDA 3WU1B 3K4MA 2XC7A 4QY6A 4WELA 1AKHB 1VQ5I 3DU6A 1IYOA 2GM4A 4WMCA 3UB5P 2QQ9A 1A04A 3S3OA 3IWIA 1O3SA 3D0SA 3TO9A 1Y1WJ 2M0MA 2XEPA 5FDHA 1L0DA 3PO3J 1JT0A 2ZXIA 4XL9A 3HTSB 4A3JJ 3IQAA 1TWFJ 3RPUA 3NULA 1R23A 1POGA 5K5QA 4RM2A 4J01A 2W0NA 3VV4A 3BTJA 1G2HA 2HTSA 5E8IA 2XRLA 2YU9J 3VSLA 3BEBA 4XUXA 1XMAA 1YS6A 2DMTA 2BHYA 2ZSHB 1IV6A 4GZBA 2FJ1A 1R1UA 2MG4A 4F52A 3SQNA 2V8FA 1A36A 3L7HA 3Q07A 4A3FJ 4EUZA 2Y2LA 3S7PA 1F36A 3FMRA 2J3TD 3NEUA 1RZ4A 1UMQA 1OT6A 2H28A 2DK8A 1LFUP 4F92B 3K1NA 1ZRCA 3NHQA 1D7EA 3R7WB 3I7JA 3TBIA 1FCMA 3SW1A 2ZCWA 4OPQA 2P9VB 4IRGA 4HNUA 3ZQIA 4C2MJ 3M7GA 3GXOA 5JVTA 1LSWA 3G4PA 3S7OA 1S7OA 5EZHA 2MC4A 5KMWA 1Y56A 2H1LA 5F0HA 5KIZA 3BJ6A 4DZJA 3GCMA 1BLCA 2V7FA 1GHPA 1HD8A 3WS0A 2EV0A 1MSEC 5DD8A 1PI4A 2ZBKA 2JHEA 3DPUA 1Z09A 2YSRA 5CQGA 2W24A 3K3CA 3LO7A 1EH7A 3LGOA 4BBTA 1IJWC 2L9SA 3IP4B 2YUSA 2OV5A 3HCYA 1YQSA 1FZPB 5GP9A 3P01A 4UUSB 1S1ZA 3GTCA 3QOPA 1ODDA 5K7FA 3GECA 1NRFA 4I5SA 2L01A 3E4QA 4LV3A 3FM5A 5EG0A 1GHCA 3ZQFA 4WEKA 3CCRI 3C2WA 2D1HA 5ILUA 1MDMB 3QPSA 4E7KA 1OPXA 1OCTC 1P92A 3KPHA 4LCMA 4XRFA 2R4GA 4C2UA 5A91A 2HOTA 3U9GA 2XUBA 3M9AA 3KYLA 4MO7A 4G3WA 1IXCA 2B18A 1V9ZA 4BJTA 2RAEA 5BMZA 4UUTA 1VHMA 1Y8QB 2QQAA 1MW7A 3DKXA 3T0YA 2FEZA 4GN2A 4ZAMA 1O3QA 3HM5A 4II2A 2HEOA 3ZPLA 3G1OA 2BVLA 3W4PA 2JA6J 5E2FA 2ZL1A 4DJAA 4S2KA 5EVEA 2HDUA 3HEFA 3LFKA 1ZRDA 2Z99A 2CFOA 2AXLA 5CQEA 1BI3A 3HL2A 2P7CB 1LVKA 3T4JA 4XKVA 1YLPA 1I1SA 4P85A 3HSFA 5JLXA 2OQGA 5J4VA 2KP6A 4JYKA 3IHAA 2Z16A 4PMAA 5LGNA 2WKEA 5IP7J 4K91A 4OPRA 1TQPA 2ELHA 4G12A 4XNFA 3SZPA 3CJRB 3H35A 3BFCA 4XUZA 2TCTA 3RKYA 1EW0A 1KYZA 1WJCA 1GHMA 1AA7A 3O8HA 3CD6I 4EUVA 4IUHA 3NC8A 2UWXA 1BLHA 1GLNA 4RX2A 4ZJ2A 2HQNA 4CYDA 4NHJA 2G7HA 1OCRH 3VEPA 1ULYA 2NS7A 3AG4H 4KIFA 1BBYA 4DYRA 1JKRC 1KA8A 3HXLA 4G7ZF 4HF0A 4A3DJ 1TDGA 3LSKA 4RX3A 4I39A 3KO6A 1MJ9A 3K4LA 3M07A 2PJRB 2UXXA 2WGWA 5D4SA 1EV7A 4EJVA 5HLGA 2WC2A 3O87A 4AVZA 1N78A 4E4HA 4HOIA 1RUOA 4ZJ3A 2Z2SB 2HVSA 1OJGA 1ZG6A 3ZDJA 4YRVA 4DW6A 3KYEA 4IBXA 5DUIA 3NECA 5CHJA 1T18A 2XKPA 3PFYA 2VBYA 3ZCOA 4JK1X 4ETSA 3J80K 4GO1A 1W4MA 1X2MA 2EPFA 2RKHA 2R7OA 3CMMA 5M5YJ 3KP5A 2QM3A 1IG7A 3ULQB 1KE3A 2ZJQF 3LCEA 5KK1A 1BA5A 4OP5A 2PRFA 1AOYA 1F98A 2ZJPF 3G4SI 4BDYA 5HWWA 3T4TA 4OAZA 2WK0A 4BAYA 3E1SA 1E0EA 2XA7M 4WF0A 1TW3A 3CJMA 4ENNA 1SCWA 3N7WA 2VA0A 5BS6A 5FSRA 5J7EA 2Y75A 1YYVA 1PYVA 4MQ9F 1NLZA 5CRFA 4HP4A 3W4QA 3HPHA 5A92A 1ETYA 2HDRA 5EUAA 1SEUA 4CSWA 4E7IA 2G2UA 1D8KA 2CGPA 4Q0IA 5J8CA 4C2TA 1YLYA 2VKDA 2PYPA 3B47A 3LR4A 4X1EA 2KDKA 1IKGA 1MSFC 2OAZA 3MQQA 5F69A 3G6EI 2OF7A 3I59A 1MNEA 3E6CC 2B0LA 3EUKL 3OOUA 4HSRA 3R7WA 2KRCA 2W48A 2EFNA 2A3UA 3C5AA 4UV9A 2VT3A 3QPHA 1FSEA 2XB0X 5J6XA 1K4TA 3EQVA 4D7MA 2EA2A 4E7ZA 3NOPC 1UCRA 3ASNH 5FASA 3R0JA 3GFMA 2EWNA 3H0GJ 3N4MA 3CO7C 1YLJA 5E79C 2EH3A 1LLBA 2C6WB 1ZREA 3JSOA 4BYYA 5HWVA 1IN4A 4QPQA 2HP6A 4LCLA 1X19A 4FCYA 4E6KG 1RIOH 2YS9A 4BHBA 4NG2A 3ABLH 3TOIA 2R5ZB 3IS2A 2UXNA 5HW3A 4S2MA 1R22A 1Z05A 3BZCA 2Y0SA 3N8SA 2UWMA 1S4RA 5LD2C 1WJFA 5TRDA 4JPMA 3CZ6A 1V54H 2HDQA 2L4RA 3KETA 4PFOA 4ETXA 5B66C 1AWIA 2G0EA 1RESA 4I2OA 3J7ZI 3S22A 2OZ6A 2Y2IA 1B1BA 4ON0A 2VV8A 4KUOA 4B88A 4MLOA 4CLCE 5M1AA 5CTNA 1IV8A 2HPMA 2M34A 3DTKA 4LG0B 2JA7J 1ETVA 1R5HA 2CW0F 4GYGA 4RGXA 1QPMA 4WK8F 3CCEI 4EEPA 4C3IJ 4B48A 4HBLA 1T39A 5DJTA 4JX4A 2DTRA 5EGOB 1CF7A 2VKVA 2EFPA 3O86A 2BGCA 1A6QA 1T08B 1FSWA 3CCUI 2V1BA 3H7WA 4X53A 1O3TA 2JUGA 3UY6A 2HOAA 4GJ4A 1OISA 1GVJA 3F1OB 3CPTA 2YR2A 3JSPA 1MPLA 2V0UA 4WBGA 3S7NA 2VPLA 4EBPA 1TLHB 1VQMI 3FV7A 3S8PA 1XJ3A 3KX0X 1GVDA 3O8GA 1C3BA 1CEFA 4JXWA 3FKJA 2L3DA 3T4LA 1RNLA 2EILH 1F5TA 2E2IJ 1DGRM 3BR1A 1MKIA 2EZIA 1FR6A 4QHCA 2QPNA 4EBLA 3IHUA 3UE6A 3TG9A 2EQRA 4ZTFA 4OIPF 2JSPA 1AU7A 3G6OA 3G2YA 3CCJI 1IELA 2X6OA 4MTDA 4HY8A 3IH4A 5K7ZA 1TS7A 3Q0UA 2DT7B 3GR2A 4LG3A 3KSGA 1ETOA 2AQEA 1EI5A 2MJ6A 2E8JA 3QP8A 2QUFA 3KEYA 4H6JA 2R7VA 3LI9A 4OIQF 1YKDA 3UB6A 3D72A 1CQAA 2F6CA 4PUSA 4QIWN 1TVFA 1IZ1A 2GNXA 4Q48A 3GWZA 2VJIA 4BHCA 3A0BC 1DP6A 3QNBA 3GUDA 2IXSA 3SEZA 1EJ9A 2ZC7A 1QZEA 5M18A 5EVLA 5HD5A 2E1MC 3HG9A 4GHIB 3GW2A 3HOVJ 3H3VK 3V3RA 2BASA 4CH7A 4EJTA 2EZLA 1S7EA 2KIUA 2UZKA 5CHUA 4WX9A 4HF2A 3UE1A 3DWKA 4IVNA 2X6XA 3VP3A 1W0UA 4LV2A 1XSVA 4L5JA 3KP4A 2V4JC 4HLYA 1YHQI 1REPC 5A90A 4OQGA 1B59A 2IWDA 3RQIA 4HESA 3WGHA 2P8TA 1FQGA 2K7SA 2ICWG 2H0TA 1G4DA 3BR3A 2HS5A 3E6MA 4MBHA 3LAJA 3UN7A 2NS8A 1TWGJ 1FIKA 1V55H 1VQ8I 3LIFA 1WI3A 4N9HA 5HLHA 3KIOA 3F1NB 4KIBA 4F3LA 2OA4A 1DPUA 1MBEA 1LI9A 2RV8A 2V1NA 3NJAA 2JKRM 4HJ3A 2FD5A 2IEKA 3IXHA 2HF6A 3IBRA 1T98A 2ISYA 2DU9A 3LEZA 3MXRA 5DM6F 2LOOA 1FBSA 3C1DA 3Q3SA 4LGWA 3T1BA 3HIFA 4A3EJ 2M0CA 3ELKA 4N9LA 1YIOA 2CQXA 1KGFA 4BS9A 3E4PA 3PXPA 4F3QA 5GLBA 3A0HC 1G6OA 4M73A 4OOIA 2FE3A 5DJUA 3U1DA 2WY7Q 2PMZN 3LA7A 2XRNA 2XROA 2XFTA 3BPVA 1VQKI 1LPQA 4OIOF 2DYRH 2VXDA 1DY6A 1X3UA 4PJJA 1WVRA 4AYBA 3NOTC 1MNMC 1PRQA 5JHUA 2CUJA 3E97A 3QP4A 2WZXA 1RKWA 1RGYA 1H5XA 5EOOA 2VEAA 4ARZB 4EEFG 1MMGA 3DEWA 4BU2A 5IS1A 3WS5A 5GTHC 3M8EA 2WWYA 2D5VA 2L7MP 1KGSA 3BC8A 4XSXF 4DYCA 2JC7A 1PW8A 5ILSA 4F93B 5J47A 4RB2C 3AGEA 3H82B 3MQOA 4CLCD 2VBZA 4RLFA 4FCFA 4FUWA 3GEZA 3F72A 4A2UA 2XR0A 3ZG5A 1J09A 4ZYEA 4HJ6A 4QWQA 5JYOA 3LSMA 1JGSA 4HNTA 1Y28A 4DE3A 3NWSA 4B1RA 1G6NA 5B1AH 1PWGA 1P2FA 3IAM2 1K79A 3BECA 1SVMA 1XJ6A 4OOMA 3CZDA 2M7UA 1N9NA 1TZLA 2DMUA 4P5OA 4CZZA 4P6BA 2HKOA 2WGVA 1S3JA 1UELB 3CJTB 5CVUA 2W3DA 5HL6A 4HW0A 5GPCA 4Y0OA 4M72A 5M5XJ 2VGKA 5J4YA 2QZ8A 4EM1A 1K61A 1YAXA 2XDVA 2MYSA 2ID3A 1HTZA 4IRHA 4M6XA 1BL0A 2EJRA 1GDTA 2QBYB 2A6EF 1AXBA 4BWIA 1PJRA 3VYUB 3H9GA 5FAQA 5H20A 1IEMA 1JWPA 1SD5A 3HTUA 1SVLA 3T12B 5J1YA 5ICFA 3OYMA 3WGGA 1E3OC 3GMWA 3PNYA 5BQTA 2JMWA 3DCFA 5KHDA 3JREA 1LQ1A 4RLQA 1G59A 4V19K 3OPLA 5HLIA 4F3LB 2OCEA 3KP2A 1MMSA 3ITAA 2R7FA 1JVJA 2M7VA 2NOJB 3ROUA 2HV1A 2FXAA 1P4WA 1WE4A 1DJAA 2X6WA 3AL0C 1GT0C 1LT0A 2QWSA 1ZTRA 3ZVWA 2IS1A 4LB5A 5HPFA 1UJ8A 4ENKA 2M8EA 3CUEA 4OLGA 3ZMUA 3RXXA 2JT1A 2KKOA 4H4KC 4DRTA 3W2WA 5J1UA 3V42A 3SDBA 4MN6A 2QHKA 2CQNA 4JXSA 3RH8B 1YMSA 1L0OC 4JQFA 2QKLB 4R38A 4BD0A 5F68A 3HZJA 3ZMVA 3HGGA 1SMYF 2DI3A 5L09A 4JGRA 3P9KA 4S2PA 3HOUJ 1U5TA 3MZHA 4D7NA 4DDYA 1KYWA 2E5NA 3FWLA 3DLAA 2UV1A 3J81K 4EV0A 2MFZA 2XPUA 2WKPA 3E2LA 4I76A 1ZHHB 3IF6C 2DA3A 3QWLA 2M9HA 5HOOA 2NS0A 2V1UA 2ESHA 1A6IA 1NG7A 2JJ7A 3ASOH 5ILVA 2IRFG 4MBFA 3IX8A 4Y7PA 3S3MA 2K02A 4PJMA 4E7SA 1Y0NA 1S8NA 1VM1A 5FRNA 2IWCA 2M87A 2B95A 1PNEA 2RNJA 3CDLA 4BL0B 4DBRA 3E98A 5DCFA 1PWDA 2NNNA 4ESPA 4BXFA 5F0CA 2ZQDA 2Z6DA 2GBYA 5CVVA 4XOTA 4EJWA 3OY9A 1DP3A 3C7VA 3UDFA 3ZG0A 3BDDA 1TT0A 1IRXA 4G7OF 3I4PA 1U3EM 4ZTKA 4K0WA 5GPAA 2ZFWA 2JA2A 1QO0D 2L7KA 3ZN0A 1K54A 2Z2MB 4O8GA 3K3DA 4S2JA 2HYGD 4LJZF 2GZWA 2ME0A 2EB7A 3M8JA 4LK0F 4ESJA 2GXGA 1H88C 2H1KA 2B5RA 4KQOA 2V2FF 3M6HA 4NETA 3BTLA 2ZQ8A 2XGEA 3MVPA 4OLDA 4N1XA 3WRZA 4PCQA 5JHFA 4KN4X 1HC8A 5LHHA 2K5CA 2V6EA 3DEUA 4XT2A 2LF8A 3OSGA 4EM2A 4OONA 4HIAA 4HEA2 2FMYA 1PDNC 3A0RA 2H27A 3LFUA 1FMWA 1BIAA 3IWZA 3BR2A 1IDYA 3UB8A 3CITA 4MBKA 4P9UA 1RRJA 1L0GA 4CGZA 1V3FA 4PK4A 1L3LA 5FKLA 1JJ8C 2O9BA 3UE3A 2KT0A 4B4CA 4KZ8A 1YFHA 1OR7C 3B6CA 2WBMA 4Y4RA 1P9QC 1YT4A 1Y4OA 2X01A 4E6WA 4UV8A 1GV2A 2W3EA 5DCMB 5AJGA 3BJAA 4ITVA 2VPRA 2R7TA 4UVCA 2B63J 4BUPA 2R7SA 1GHIA 2A3SA 5EVIB 4ZBEA 2LKXA 1BW5A 1GSWA 2NOGA 1S6RA 2FOKA 4KT5C 3HLFA 1IYSA 4PSXA 4O7DA 4RBOA 4KENB 4KZ4A 1SD6A 2JUCA 3SFZA 2P6TA 3PAEA 4IEDA 5DFXA 4MFEA 5GHXA 4CLCC 3DBLB 3IF5A 4GDFA 3JRCA 1ERMA 3I0TA 4KZAA 5B1BH 4NKPA 4UEYA 2FQ4A 5D5UB 5FLXK 3VSKA 3BROA 3WU2C 3CC7I 3UPNA 2COBA 1EF4A 4WM9A 3F21A 5KZHA 1D0YA 1ESIA 5C3EJ 4PM7A 3LA3A 1JKPC 4HPQA 2CW7A 1FTTA 2HDCA 3GTPJ 1O7EA 3L2UA 2R0QC 3JTGA 2YX4A 4Q0HA 4YNRA 2FA5A 5EV0A 2ZJRF 1N9LA 1S67L 4I01A 2EXAA 4IKFA 2STTA 2A6HF 3CF5F 1HA8A 2JQ7A 2QSGX 3OPHA 3HGYA 3TL4X 1MMDA 3LQRA 4S05A 3G34A 5U47A 1IN5A 4XRSA 1FBUA 2LMDA 4FH4A 4HX8A 5HAQA 4GS9A 3JW4A 2P08A 2X9DA 3MXQA 4FH2A 1OCZH 1YSPA 4XT2B 1HSTA 1YRNB 5F0FA 5D5XB 4MN7A 4DQ2A 1R58A 1R71A 3HVFA 4PM6A 4EXOA 3C8CA 1EH8A 3UDIA 4O01A 2XA7S 2KOIA 2M1CA 4BL2A 4ENMA 4DE0A 4ENJA 2D01A 1BI0A 1SFKA 5J40A 4BQOA 2ZM2A 1T1BA 4N4OB 2ZQAA 1LSVA 3MMHA 1X4PA 4DKIA 2FMLA 2QWWA 3B6AA 2J9OA 2Y0SN 1D06A 1U8RA 1BZAA 3FXRA 4L9JA 1FMVA 1FWZA 4MHGA 2HYFA 5CVRA 1K56D 4C3QA 3PYPA 3IKVA 1U9NA 2VL8A 1K38A 1M40A 5M19A 2R5YB 1DQUA 3TDZC 5CVIA 3K4BA 4UVBA 2XGNA 1USSA 2BE5F 2GIVA 1M1EB 4BEHA 3LIBA 4E6XA 1S66L 5LLQA 4U3TA 4XLAA 1ONHA 2WUQA 3B42A 2ADUA 3WTWC 5E17F 3T8TA 3ZOBA 3BG7A 2OOLA 1I39A 1KU3A 3GMEA 3HHGA 5CJ9A 5A2QZ 1SZVA 2Y9ZA 5CERA 4KUMA 5L3CA 3HKZN 3GZ6A 4EATA 1U9OA 1MBLA 3WTSC 4EESA 4QWOA 4E3MA 3NRVA 2Y2ZA 1IN7A 4XLCA 2NVQJ 1NJ4A 3MXSA 4HX4A 2AXTC 1ZGJA 1R5ID 1Z6RA 5IP9J 5JFRA 1EROA 3HHHA 4I38A 4KG5A 2VJ4A 3WGIA 1FYMA 1ODVA 2EWWA 1TQMA 3ZQQA 3PQJA 1MBFA 5M3MJ 4BKXA 3G35A 2OQRA 2DCFA 5BOHA 4WZ5C 1ZGWA 3HOZJ 1U5TC 3ZVTA 1HBXG 4XKWA 2VGJA 4Y3IA 5TISC 2FBKA 3MZFA 2K86A 5HAIA 4II7A 1FYKA 1MBHA 1K6YA 3HYIA 1W0TA 3RKQA 3NCKA 1I50J 4G8XA 1NYYA 3BR6A 2M8GX 1YLTA 3O88A 1OJ5A 2IJLA 4FE7A 2YKHA 2FSWA 4YFNF 3WTUC 3K70D 3COAC 3P09A 3WTTC 1I27A 3EEHA 2DQLA 2DYSH 3W3CA 3BG9A 2HR3A 2J9PA 1JTGA 3WODF 2PT7A 3VYRB 3DLLF 5CEBA 3CJNA 2J3WA 4E7JA 1W36C 2OPTA 2V1XA 4FISA 3BFEA 4HLXA 4XN3A 3GDIA 1S4SA 2V9KA 3TDUC 2GXAA 3UR3C 5AVEA 3DF8A 1ZELA 4PSWA 5DDGA 2OLUA 4V2GA 2ZBBA 3BZKA 3CHWP 1KGEA 4XLEA 4PPRA 4EWFA 4OKPA 1ZG5A 2PHYA 3K4KA 3OYNA 1LFPA 3RIRA 4QD4A 3GTOJ 3BQYA 3CDIA 3K4CA 3F8NA 3L7WA 4XRMA 1FOKA 3CC2I 3CC4I 4FD8A 4Y2FA 2QEXI 1H3QA 3GLXA 1TEMA 3SYTA 3KP6A 1KVLA 2JN7A 4LV0A 1Y1VJ 1ZRFA 4R1GA 3JRHA 3CCVI 3GZNB 1LE8B 3AG3H 1N9OA 4UQIM 4OQ0A 1OFCX 1TNTA 1WPKA 3CUQC 1TWCJ 3DBRB 2WKQA 4GW9A 4HX7A 1LHYA 2DDAA 2GWRA 3J7AO 4I7HA 2MLKA 2W82A 2QSHX 1JUSA 1KE0A 3LY3A 1C0WA 2L5QA 5FQKA 1GXQA 1XX2A 4IHWA 4ARZA 1AWCA 1FOXA 1T19A 4IJAA 5L8MA 1X4OA 2XGDA 2B7EA 1STZA 3D4FA 3WRTA 3V8LA 4YOFA 3VP1A 4OIRF 1JTXA 1QQIA 2VKSA 3A3JA 2Q9NA 4XKCA 3H9JA 5A8BA 2E7WA 3C3WA 2EWVA 3X2QH 5HS9A 3WHBA 4L9TA 4JBFA 3QYEA 1VZ0A 3CQZJ 5ED4A 2R7ZJ 1X1CA 2HQRA 4ZYHA 1IOUA 1YX5A 1IYQA 3MKFA 4M4XA 4A3BJ 2CMPA 4GDNA 5FAOA 4DBQA 2CJJA 2GQQA 4RA2A 4R4SA 2Y55A 2QF7A 3LNQA 2F5FA 1JGGA 4L9GA 3KYQA 5DF7A 5EGOA 1CF7B 2DNSA 4U0VA 4BQQA 4QPRA 1ES4A 2V26A 3H0DA 2VBWA 4QSHA 4Z6YA 3FZVA 3DTEA 1D5YA 4MDZA 2EX2A 3FXUA 4ID4A 4WUJA 1D3YA 2VE9A 5DF8A 4XOPA 2VT2A 1HW5A 1Z67A 3VYSB 5CGWA 3E5QA 2VKEA 4RB3C 3K4JA 4EGYA 1CQTA 4E3OA 2PFBA 1W5DA 2NXNB 1BLSA 1W5TA 3L1PA 2WGWB 5G18A 5HVQC 3JR9A 5IYBJ 2RL3A 2VJWA 3MS6A 4GHIA 2ZKZA 3FF5A 5FQIA 3LI8A 2F4OB 4RS8A 5FAPA 2PN6A 3ABKH 2IWBA 5EF6A 3VOYA 1TT5B 4G7HF 2W3FA 2KPMA 2DJNA 2ZSIB 3ZQGA 2M2EA 3BTCA 3G2BA 3TMOA 5E3NA 1YSQA 1NG6A 3CI6A 4N0BA 2EX8A 2EXBA 4A69C 2P7JA 2B9SA 2Y4AA 1Z6TA 4X68A 3E4OA 3P9IA 5TGFA 3AGFA 1F1ZA 2A61A 2HQ5A 3OR1C 4YEJA 3LSRA 1NZUA 4AIKA 3AL0B 3BLYA 1MH3A 2QKMB 2PD7A 3VOEA 2X4HA 2LNBA 2L4AA 1IN6A 3KP7A 1MWSA 2XIGA 1NY0A 4HV6A 4BEHB 1KDWA 1W7PB 2OC6A 3FHNA 3Q9SA 5ICGA 5J4EA 3NI9A 5FKNA 2BY3A 4XLNF 1FNNA 1J75A 3CCYA 1G5UA 5GAEJ 2FBIA 4LB6B 1V5GA 3C38A 2XAJA 3CCMI 1J59A 3C18A 5C4XJ 3PUFA 1ZQ3P 1FEXA 1OKRA 2EFUA 2X85A 3ZGAB 2L4MA 4IHTA 2IGKA 3K70C 2W27A 2FF4A 2Z1DA 5JI6A 4DOZA 5M5WJ 3GTKJ 5FQMA 4EQ1A 4Z2YA 3VWBA 2Y2PA 3TE8A 3EQUA 2IGOA 3L9KA 2GZAA 3S4XA 1JUPA 2A69F 3RYPA 3CMZA 2CO5A 4H0EA 3HLWA 3DPLC 3A02A 5LHIA 1F4KA 4BE2A 3F1NA 2PU4A 2HGVA 1A35A 4A3LJ 4AWXB 2E60A 4GYIA 4L9FA 4FE4A 5EEAA 2P0WA 5GL9A 1OYYA 1ITYA 3ABUA 3TKYA 4XMYA 3BFFA 4JF5A 2VV7A 2IAIA 2XPWA 1TW2A 3CAXA 5HD3A 4JP0A 2VLGA 2Y0MA 4PHTA 3PSFA 4UB6C 4X69A 2CV1A 1WI9A 3HUGA 3NY4A 3G71I 1VQNI 1DDNA 3IRQA 3AG2H 4AVPA 5HLTA 2XSSA 3F22A 2GAUA 1P4AA 4QPOA 3EYIA 2OD5A 3NWTA 3WTYC 1BYWA 2PLYA 5DTDA 3I53A 4NC8A 1NH3A 3BY9A 1PP7U 3DQVC 2V20A 4HI4A 2H8RA 4BBSJ 2Y2HA 4U0YA 2LD5A 3R61A 2XB5A 4C3JJ 4DJ2A 2BZTA 3DBAA 3HOWJ 3F6OA 2PBIA 4ZJZA 4GXOA 4DE1A 4DJ3A 2K9SA 4KITB 4I6ZA 3EQLF 4ESBA 2ZMVA 5HWTA 1ES2A 2NVYJ 2XAHA 2WAEA 1UZCA 3MEXA 4X56A 3UNWA 4FASD 2P5VA 3TQNA 2BXZA 5CYVA 3IHBA 2PU2A 3BFDA 4RGSA 4M9XA 2J3TC 1KU7A 4FHTA 2LKSA 2EINH 2G2WA 1FP1D 1I1GA 4M3EA 1BR1A 4BH9A 1YS7A 3P9CA 1XPXA 5FKMA 3GTQJ 1BN5A 9ANTA 3SS4A 2KJCA 3LMMA 3OYCA 3L2WA 3KZZA 3ZMDA 5CX7A 5DVAA 5HDNA 4KNYA 1JT6A 4RB0A 4O3MA 3RJPA 3IH9A 1I5ZA 2WTEA 2H0YA 2V1AA 3MD2A 5TR7A 3SHFA 4XORA 4ZH4F 2CU7A 3HSEA 4IOAF 4KG6A 4D5FA 2BV6A 3OS1A 2DFEA 1S6LA 1FIAA 5IY5H 2JN6A 3QYBA 2QJ5A 3VP2A 3ZFZA 1SKOA 3Q0VA 3OL4A 1U0JA 2LFBA 3UNGC 3RZDJ 1MZUA 3A0SA 1BULA 4W1UA 4D60A 2JE5A 3ZQCA 4BY1J 1W1WE 1H9TA 4I0AA 1IGNA 1XC5A 3S2HJ 4HG2A 2KIFA 2CRGA 5EJCA 1R6RA 2PX9A 3D9YA 3OCNA 2IA0A 2HNHA 1O3RA 1O07A 4KDPA 3IX4A 5LFAA 1HOMA 4BACA 2G7UA 1EA3A 3DKWA 3MAJA 3WG9A 2C5WB 1MMNA 5FFZA 1UWPX 4DZPA 3ZYTA 2EX9A 1QGPA 5EM1A 1K6OA 3CDHA 1LJ9A 1RKTA 4UUVA 1GA0A 4RGUA 1Z0XA 3OSFA 1OR7A 1VI0A 5DTTA 2Z6CA 3B33A 2EIJH 3GQZA 4E3LA 3LSPA 1R1VA 3B73A 2OJED 1MJBA 1SANA 1OCOH 1UG0A 2I8DA 2JK3A 1YMXA 3LEQA 3S7QA 2FRHA 1WWXA 1O4XA 1USTA 4IQJA 2NYXA 2EFXA 3FXKA 4ASNA 4PGHA 3VP4A 1W79A 1D0ZA 1X58A 1BR2A 4KT6A 1K83J 1V5FA 5J1RA 1BTLA 3KSFA 1BC7C 3OBFA 2JKTM 2LRDA 5FQ9A 1FIPA 1W8YA 3FPVA 3TW7A 1WQ2A 3VB2A 3IX3A 1FT9A 2EV5A 2FNAA 3KLOA 4EW7A 1KONA 5KAIC 2LC2A 2E34A 1WGXA 2VQGA 3HBLA 1G3WA 1ZTUA 1HQCA 2CYYA 2DFIA 3BZ6A 3JCUC 3IV5A 3FISA 2HDSA 2NUPC 2VLAA 4HP9A 3RJUA 1UHWA 4BLMA 4BXUA 2KIMA 2ZXWH 2QA4I 1TC3C 3FDYA 1SD7A 2ID6A 1FJLA 2Z9OA 2DA1A 3MCZA 3JRDA 1VETA 4P96A 1N4OA 3S1QJ 1SDEA 1NK2P 3FKIJ 1YLZA 2XAUA 3OS0A 3WE3A 4Y13A 3KE2A 2ZC4B 1VTNC 2KZVA 5L3DA 2DAOA 3P5JA 3JVVA 2FOWA 3H1CA 4ZJ1A 2HVQA 3DV8A 3LQQA 1F2KA 3PR6A 3DP7A 4BQAA 4X55A 1HXDA 3CUQA 5DYMA 4LPZA 2OWJA 2A24A 3A0VA 4BJ5C 4HBUA 1ETKA 1ZKGA 4MFDA 3L2CA 1T56A 3E6BA 3OL3A 2DA2A 3GX4X 4NUBA 2BEOA 3DFGA 4UXNA 1QZZA 3HRSA 4GS9B 3VFFA 4S2OA 1RUNA 4B4ZA 1T0FC 1XPBA 3MBZA 3D5RC 4OWRB 4WCGA 4PKYG 2F5EA 1ZK8A 4BGDA 2DA5A 3HJKA 1ACIA 2W85A 3F8CA 3PQKA 5D6EA 2VJ5A 2NRAC 2QYBA 4P6ZM 2MSYA 3RDIA 4A3KJ 4EETB 2BG1A 3HJEA 3HLCA 1BI2A 2DTZA 3GZ5A 3K0LA 3OMYA 1KVMA 4PM5A 4UHUA 3S16J 4A0ZA 2QKPA 4FOFA 1FLIA 4M6YA 4CCMA 2VE8A 5JR3A 2XD1A 1W7FA 2VASA 2VXZA 2KLIA 5BOXA 1VQLI 5EM0A 2HDDA 1XCBA 2KIQA 2Y48A 3CCQI 2PAVP 5HDCA 1XMKA 5FGMA 1SAXA 2X71A 1WH5A 4CO8A 2JRMA 1UHMA 2E2JJ 4XK4A 3BR5A 4OPYA 1P7IA 3L2VA 1MBKA 1Z3XA 4W97A 3HL9A 4MIMA 2BXYA 3OV8A 4LD5A 2NVTJ 4DXCA 2V1ZA 4L0ZB 5FI2A 3ZQ7A 2YU3A 2DMQA 4Y33A 3RSNA 2QQ8A 4OAYA 5FKOA 4U7DA 1XG1A 1LVAA 2ZMEA 3V4GA 3QAHA 3ZG8B 2VQHA 2Y9YA 2GJ3A 1L0FA 2LVSA 5GADJ 4RAZA 4YELA 3OYJA 2VGLS 2DFFA 3PNTA 4KZ7A 1JXSA 3ABMH 2MD0A 3VYTB 3QU6A 1PVEA 3EEAA 1JTYA 2CG4A 4IX7A 1PI5A 2Y2OA 4ESFA 1F9NA 1FY7A 3DTIA 4KMUX 2Y91A 3WTXC 3JRBA 2HU9A 1AKHA 2BYVE 1HSJA 1DU6A 3CUQB 3ESWB 3LICA 4S2NC 4X6TA 1XJ2A 3PBRA 4OH0A 1G6AA 3BTIA 4OPZA 2Q0OA 4A0YA 1WJDA 3BM6A 1YQAA 3KEOA 3T5XA 2PI0A 4M3GA 4HQEA 3HOXJ 2OBPA 3CF2A 4E3JA 3BJOA 1FCNA 3FKWA 2I5UA 1YRNA 5HFOA 5EYRA 3KFWX 3LR3A 1LB2A 2MABA 1PIOA 1XA1A 1XSDA 2XK1A 2K9MA 4E3IA 2JZYA 3U21A 3GFLA 5CGSA 2QGUA 2VOPA 2OAP1 1XCVA 2LP0A 3HUOA 4WEJA 1HKTA 2AHQA 2DN0A 2UV0E 3FM3A 5KCMA 5FQJA 2H6CA 1IAWA 1SC7A 4CLCB 2JA8J 4KYWA 2BOLA 2XGXA
chains in the Genus database with same CATH topology
2HKXA 1K78A 1O57A 3BP8A 1T1AA 2Y79A 4KFCA 1OTAA 5E1XA 4L5IA 4XSZF 1LDDA 1MGTA 2E1CA 1SFEA 3ZP5A 2RN7A 1KQ0A 1I6XA 5DKKA 1OTEA 4P55A 4AIHA 3J81Z 2INWA 4RAYA 2W1TB 4WWCA 1B4AA 4EQQA 4YIFA 4WL9A 2K31A 4IF4A 3E6DA 3RTRA 3K9TA 4WXHA 3H92A 5F5YA 1UGUA 3DPTA 2QYOA 3LR5A 5AIQA 1W63M 2YX7A 5D6FA 1ON2A 3FX3A 2VBXA 1TS0A 1TS6A 5LBRA 2F2EA 4G94A 3WU0A 1V4RA 1LEAA 3FMQA 1BI1A 4G9YA 4HF1A 3H9WA 3V7CA 3MFXA 4I98B 4WXCA 4S04A 3F8FA 3CLOA 4L18B 1P9RA 2JPCA 5CVJA 4Y15A 2QVOA 2O9CA 2P04A 3ZN1A 2O9AA 4R79A 5LBQA 5KSHA 1S7AA 2V6CA 1TD5A 2J5PA 3JVUA 2G9WA 1P97A 4DNCA 1K78B 1U5TB 4LRXC 3T8RA 5IT9Z 3FXQA 1HKSA 2QENA 1XD7A 3O2PE 3OOPA 1LEBA 3W6JB 3V7SA 2XASA 3RYRA 3F8MA 4KIGA 1X0OA 3KYZA 2PG4A 3M8FA 3BQAA 1T2KA 4Q4ZF 5DCMA 4RB1A 3MFKA 1JHHA 3IBJA 2MH2A 2XGXA 3FC7A 1OYIA 2YKFA 3OCLA 4NXEA 5DF9A 3E3VA 3ICYA 3C30A 5KVRA 4Q5SF 1MDMA 3I54A 4Z1WA 4OMZA 3QRFF 4IHSA 2D2WA 3CO6C 4CQHA 4LFUA 4A5NA 4YIIA 2DO7A 4EMSA 1XFNA 1LSXA 3V8JA 3UB7A 3GVAA 3LIAA 4L9NA 1PUEE 4M71A 2D02A 2ESNA 4FT8A 1YW9A 3EGDC 4K08A 1UWNX 2LB5A 1H9GA 1TTYA 1P6RA 5I5LA 3K2ZA 5DUKA 2NAZA 4Q47A 3EYYA 4GLQA 5H6QA 2KX6A 2DW4A 3HSRA 1RI7A 3UB9A 3TOBA 2RDPA 1IRGA 4R1HA 5EEHA 2ZO4A 4ZYGA 3BWLA 3LSTA 3LWFA 4U88A 2O6GE 1DPRA 1U2WA 4KUKA 1O7FA 2NNYA 4NXFA 1KQ9A 3CTAA 3AAFA 4KICA 4YWZA 3G73A 2P5KA 2EV6A 4NB5A 5E20A 4K2EA 3TOAA 3TRCA 5EFWA 4OMYA 1DUXC 3RKXA 1ZHFA 1NWZA