3MQ0A

Crystal structure of agobacterium tumefaciens repressor blcr
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
251
structure length
243
Chain Sequence
b'SQISDTVPALRRAVRILDLVAGSPRDLTAAELTRFLDLPSAHGLLAVMTELDLLARSADGTLRIGPHSLRWANGFLSHLDIVSTFNDHLAQRHDLDPYTVTLTVREGGEVVYIGCRNHTFRIGMRLPAPFTATGKILLSDLGPGELRMLFSQFPQPLTSRSVAGLSQLEEELALTRARGYSIDDGQIREGMLCIGAAIRDYSGAASAGIAISLIRSEASDEKIAYLGEELRTTANALSEKLGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional repressor of the blcABC operon
publication title The Agrobacterium tumefaciens Transcription Factor BlcR Is Regulated via Oligomerization.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Transcription repressor
total genus 76
structure length 243
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
A PF09339 HTH_IclR IclR helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mq0A01
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mq0A02
3SXYA 4KDPA 3PQKA 2XVCA 4UUVA 2PN6A 4A6EA 2MD5A 1RZ4A 1IN8A 1O3TA 3QP6A 1Y0UA 1QNTA 1YS7A 3U1DA 1R5GA 4CO8A 2HS5A 3WE2A 4N9IA 3H3ZA 4P5OA 4EJVA 3HTUA 2O9BA 3MAJA 3I59A 5BMZA 3S7OA 5D8KB 3DP7A 4IHSA 1TW3A 4OIOF 3DV8A 4P9FA 5DFXA 1P4WA 4OINF 3GF2A 4WXHA 1IW7F 5CYVA 2D2WA 2QUFA 5JI6A 3QOPA 1CF7A 4G94A 4OMZA 4AIJA 1IUYA 3F22A 3JW4A 3O2PE 3MZYA 3RFBA 1TQMA 4AIKA 1IN5A 3F8MA 1U2WA 4NB5A 2MLKA 1IXCA 5LRSA 3I58A 4I0BA 1I6XA 1R1VA 2ZKZA 3QU6A 3O6BB 2K86A 3SFZA 4L0YB 2P5KA 2Y79A 2M87A 5JFRA 1Z6RA 3KETA 1RI7A 1FPQA 2FNPA 3COAC 3Q9SA 1HBXG 1VHMA 4FOFA 2P6TA 3I59B 3S7NA 1T39A 4LB5A 2BV6A 4A0ZA 2DPDA 2HYGD 2JPCA 1O7FA 5HDGA 4IJGA 3RKYA 1KA8A 2YPRA 4E04A 5HLGA 5HLIA 4I2OA 5JVTA 2A68F 1IXSB 1EH6A 5HS9A 5J8CA 1Z1DA 5LBQA 3HUGA 1CF7B 2X0LA 4MCWA 1H9GA 1DPRA 4BXUA 3V7RA 2ZO4A 3ECHA 4GO1A 2GA2A 2DLLA 5E18F 2ZMFA 4IUKA 5D8LB 1S29A 2Q0OA 2OD5A 4OOIA 1BM9A 2Y0MA 5E20A 2HDCA 2OA4A 4QWQA 2O8XA 1P4AA 1YW7A 5K5OA 4NQWA 2XRNA 4M9SA 1EV7A 2ISYA 3V7SA 1FOKA 2VEAA 2MH9A 1XMKA 3C3WA 1ZLJA 1FY7A 1LNWA 4BNCA 4WXCA 3LWFA 4HQMA 5HVQC 4IUHA 1ON1A 3BJ6A 1E17A 2MLGA 3F6OA 2FU4A 4A0XA 4G7HF 4A5MA 1XSXA 3BZ6A 5HLHA 2EFNA 2FE3A 5CVUA 3GX4X 3TO9A 3ZP5A 4HV6A 2RQPA 3MZHA 2J5OA 4QLCU 3TQNA 3HRMA 1JGSA 3DBAA 4WXDA 3LSTA 4Q0HA 2PFBA 1OYWA 4PGGA 4Y2FA 4A2UA 2OQRA 4OIPF 2KLIA 3CJNA 3PFIA 4DMZA 3Q5FA 3MF0A 4EJTA 1I1GA 4KMUX 4OMYA 3LFKA 4Q0JA 3KP7A 3BJOA 4FHTA 5ERIA 1J7KA 5DYMA 1QPMA 3W6KB 3MCZA 3GXOA 5D4SA 3KLOA 3SZTA 3C2WA 5J8FA 1R36A 4AIHA 1SFXA 4EM1A 1GHCA 3CO7C 3I71A 4O01A 5AIQA 2QWWA 5D6FA 3DPLC 1K79A 5E8IA 3L09A 1RNLA 4HOBA 2R7DA 3TO7A 4YNRA 1TW2A 2Y75A 3E97A 3REOA 4G6DA 5DUKA 2FBIA 2DAOA 2RN7A 4KUMA 4MQVA 2M7VA 2IA0A 1KYWA 3R0AA 4GYIA 2Z9OA 2CQKA 3ISPA 5HDNA 4UVCA 3CUOA 3DEUA 2LB5A 2H09A 2W25A 3IC7A 3ZN1A 2DK5A 3ULQB 3TGNA 2VC0A 1MD0A 2EV5A 3TKYA 4ON0A 1ZAOA 1FYLA 1KU7A 5EEHA 4HF0A 1Z7UA 3QPTA 2A3SA 5CLSA 4CGZA 3TOBA 2JSCA 4CQHA 2HOEA 1LDKB 2LF7A 2RVCA 1MC0A 2VOOA 2R7FA 1FZPB 1W4MA 4GLQA 4G3VA 4G8XA 4HBLA 2WTEA 1U5TA 4G3WA 1YG2A 3KSGA 4XSZF 1X3UA 3FMQA 4KT5C 2AS5F 5AONA 4ZYHA 2DPUA 2G7HA 2OU2A 2XAHA 3CDHA 4Z1WA 3I54A 5D6EA 1XDUA 3EDPA 3MMHA 3KP6A 3FX3A 2UZKA 3I5UA 3WGGA 1U6GA 3PQJA 3HOSA 2OOLA 4RGSA 1XCBA 4KICA 3P9CA 2M7UA 2QM3A 3C1DA 4YIFA 2DTRA 4PAUA 1DDNA 4RAZA 2FMYA 4XRFA 4PZJA 4I7HA 2E1NA 3QAHA 5L3GA 2W57A 3NOUC 4B09A 4Y3IA 3ZQ5A 4R79A 1BI2A 1MJBA 1FX7A 2F5CA 2YSRA 4R70A 4HDUA 2CO5A 3WTZA 3F72A 1V3FA 2HGVA 3U2RA 2L02A 1C0WA 1JE8A 3OOVA 1KU3A 3WODF 2JZYA 2V6CA 3GZ5A 2HKXA 5LHIA 1JHHA 2CFXA 1O3SA 1YW8A 1ZG5A 1NHAA 1U5TB 5FD6A 3C18A 3D5LA 3GFJA 4HX4A 4Q48A 2ZCWA 5ILVA 2C6YA 2HR3A 3WTYC 3I64A 3P7NA 2PBIA 2QBYA 3HYIA 1P4XA 2KKOA 1P6RA 3M9AA 3WU0A 3HIFA 3IL2A 2EFQA 1IN4A 4LLLA 5FFXA 2L54A 3IKVA 2H6CA 4LRYC 2AXLA 4H0EA 4RGUA 2XKPA 1SD7A 4OIRF 2V1UA 1XCVA 4IRGA 5LGTA 4HA8A 1O57A 2HKOA 4ME4A 2GIVA 3E6DA 5FD5A 4IRIA 1UFMA 1BN5A 2OBPA 3CUQA 4ZZLA 1PDNC 6PAXA 3J80K 4YIIA 4ZYEA 2A69F 1B59A 3P9IA 3BJNA 5H6RA 4KIFA 1HKSA 3ZMTA 5K5BA 1SFUA 5AJGA 4O3MA 3BY6A 2ZFWA 2J5PA 2O6GE 1G3YA 1ZH5A 2R3SA 4G7OF 4YOFA 2BYVE 4R1HA 1GVJA 2VE9A 5HDKA 1ONVA 1TQIA 2PMUA 3KCCA 4Y17A 4ASNA 2QBYB 4A12A 3FMRA 2A6EF 4HX8A 5ICGA 4EGYA 2L4MA 1HKTA 4MEXF 2DQRA 2VN2A 4BHBA 2ISZA 4UVAA 2VOPA 1U8RA 3DPTA 4YG2F 3HOTA 1BBYA 3J7AO 2VBYA 4BAYA 3ZQ7A 4BHPA 1S7AA 2KIMA 2O9AA 2X4HA 3EYIA 2W84A 1OPCA 2GX5A 3CUQB 3JSOA 1BI3A 4EM2A 1KU2A 2K7LA 2HZTA 1IRGA 4YFKF 2Q2EA 5JR3A 4BWIA 3CUQC 2EFPA 3QRFF 5DDGA 5E1ZB 3ECOA 4AVPA 2P5VA 3V7CA 3HRTA 3TOAA 3ZMDA 4MQ9F 5K1YA 2HTJA 1A04A 1F5TA 3KFWX 3VODA 2VBZA 1D5VA 1F1ZA 2RGVA 2ZXJA 4XLNF 4M9XA 1AWCA 1BC8C 3HSRA 1Z91A 4HYEA 4EGZA 3SZPA 2FMLA 1YS6A 3FXRA 3ZMVA 2FOKA 4M72A 3T1BA 3J80Z 2FNAA 4L5JA 2HQRA 1L3LA 2A6HF 3E98A 2YU3A 5BPDA 1H0MA 1SMTA 3FWEA 5HPFA 1KYZA 1IN6A 3OBFA 1I5ZA 3DFGA 2P7VB 5LHGA 3R60A 3NOPC 1S7OA 1IRFA 1ZRFA 4L5IA 4HZFA 4TV7A 1TD5A 3IRQA 3F23A 1L0OC 1U3EM 5DD4A 3ABTA 3VB2A 1T98A 1XGSA 4U0WA 3V8LA 2W85A 4LMYA 2V1DA 1XGMA 3K1PA 4JQFA 2M30A 4Z2YA 1J59A 5I5LA 5D4RA 3HSFA 3RKXA 3CO6C 4MMNA 2P7CB 4ZH4F 3JSPA 1HQCA 1FBSA 5CJ9A 3NHQA 3C7JA 2FXAA 2O61A 2RNJA 1JXSA 4IRHA 3B02A 1PP7U 3JTHA 1V4RA 2Z99A 1FBQA 2FBKA 2O99A 1FYKA 2DFIA 5LHHA 3GFIA 1U78A 3RJPA 2XIGA 2CGPA 3JAMK 4M6XA 3TO6A 2MC3A 4MEYF 1Z9CA 2VC1A 2PQ8A 1AOYA 3BDDA 3BOQA 4XLPF 5IT9K 5HPIA 5HOOA 1LB2A 4U0YA 1G3WA 1BI0A 4K2EA 2F5FA 2KJBA 4M73A 2RDPA 5AIPA 1HW5A 4LD5A 2CW0F 5LBRA 3WU1B 3QU3A 5DFYA 2B0LA 5CVIA 3KLNA 4EUVA 1BOAA 2IVMA 3I0TA 2BBYA 2CG4A 5HS7A 2EK5A 4LGWA 2LB9A 4RB0A 1XDSA 3KP2A 3WGHA 1XSDA 3FZVA 1PUEE 1KQ0A 1MDMA 4MGRA 2KJCA 1YW9A 3KEOA 1XB4A 2HQNA 1D8KA 2QQBA 3HHGA 5HL6A 4R8HA 2VBWA 3Q9VA 5ICCA 3T8RA 2KIFA 3DXJF 3BJAA 3HRSA 3GLXA 4HLYA 4BHCA 1OKRA 5H6QA 4I98B 2GXGA 3K2ZA 2VE8A 1VTNC 4U0VA 1G6NA 2A5YB 1BJAA 1BIAA 4KMFA 1ZYRF 3RYPA 1HXDA 1LDDA 2HFHA 1WQ2A 2QZ8A 5H20A 1YTYA 4D0PA 1F4KA 3GZ6A 4L18B 2EA4A 1BC7C 3DQVC 5FGMA 3BPXA 4QPRA 3JAMZ 2OAZA 3GWZA 4U88A 5C5KA 2Z33A 5F1RA 3DKWA 1MDMB 1RUOA 5IT9Z 2LF8A 3WTWC 2D1HA 3NRVA 2L3DA 4WX9A 2ZNZA 2ADUA 3CLOA 1HSTA 4EJUA 2ZMEA 5ICEA 1FP2A 3NQOA 4R6LA 5IT3A 4RB3C 2VKSA 1UB9A 1OMIA 5F6FA 2FBHA 1KGSA 2CSOA 2DU9A 2W1TA 2QYOA 1ZN2A 4A0YA 3AAFA 5LEJA 4ETSA 3GVAA 4BQAA 1B1BA 2CYYA 1W7PD 2PG4A 4EJWA 3RPUA 3TDUC 5E1XA 2ELHA 5L8MA 1W7PA 3WG9A 4OU0A 5LGNA 4YFNF 5CVVA 1DPUA 2CWEA 4Q5SF 3EUHA 1P2FA 2JTVA 5L3FA 2YR2A 1B6AA 3K9TA 4KIGA 2EA2A 4P9UA 2BEOA 2XROA 1T0FA 1XN7A 2IA1A 2D1VA 2O03A 4Y15A 2M1BA 2D45A 4N9HA 4IF4A 1SFEA 5HS8A 2LDUA 1R1UA 1YYVA 2ZMEB 3ERED 4FX4A 4G6QA 4LK0F 4MNUA 3K2NA 2ZJ2A 4G3KA 4N0BA 2K4BA 3U9GA 4HDVA 2QLZA 4HW0A 1BIBA 5FO5A 1R22A 2FEZA 2RV8A 5DCMA 1XGNA 1SD6A 2P5LC 4L9TA 5FLXK 3BP8A 4LB6B 3T0YA 1W7PB 3VOEA 4RGRA 1MKMA 2COMA 1WRJA 3EETA 3QP5A 4IXAA 3R4KA 4WCGA 2F2EA 3GYHX 3M8EA 1MJAA 3E5XA 4LJZF 3HTSB 4LLGF 4MTDA 3T5XA 2O3FA 3E6BA 1J5YA 1PP8F 4O0PA 2FQ3A 2PJPA 1XGOA 3HRUA 1FLIA 1T2KA 5J6XA 1OYYA 3WTSC 4ENJA 2ZBKA 4JBAA 2QENA 3N97A 4DNCA 2IW5A 1U5TC 3ELKA 2LKPA 4FT8A 2MA3A 1CGPA 3FXUA 5DCMB 3KP5A 2IPQX 1TTYA 2W1RA 4LRXC 1TLHB 1ZRDA 1TNTA 5TJJA 4MN7A 2NS0A 2P6SA 1R58A 2RKHA 1KQ9A 1QGPA 1K6OA 1SMYF 4RAYA 2VBXA 4ESBA 1ON2A 1UHMA 1QQIA 2XSSA 3SQNA 4DQ2A 2ETHA 1UHWA 5D5XB 4LK1F 5FB2A 1T6SA 1T38A 2VJWA 3F8NA 5BPIA 4HF1A 4ENNA 1TBXA 5DV5A 2IJLA 3WTXC 2V1XA 1KQ8A 3IWZA 5CVJA 1DUXC 2E7XA 1UCRA 1Q1HA 2ACJA 3IBRA 3V8KA 4RB1A 2VODA 5LRRA 1F5MA 1SAXA 5FLXZ 3TDZC 2NNNA 4L9JA 4FX0A 4CHUA 5EEGA 4CZZA 4UHTA 3F8FA 1WI9A 1MJ9A 1F9NA 3RPQA 1ZHFA 4EV0A 3IKTA 3MFKA 2IT0A 4S05A 2IRFG 2A61A 3GW2A 2G9WA 2K4JA 1LQ1A 2VXZA 4HV5A 4HLXA 2HGCA 3L2CA 3R61A 2EWNA 2RC4A 5K5RA 1O3RA 2Q8KA 2QQAA 3M7GA 4LRZE 4GYGA 1E2XA 5D5WB 3KP3A 1EH8A 5BQTA 1R1TA 3ML6A 3K0LA 4LG0A 2EFWA 1SD4A 4M71A 1WKMA 4DN0A 3ZMUA 2QVOA 3ROUA 2H27A 3HCYA 1S8NA 2F5DA 1LEAA 4UXNA 5BS6A 2PEXA 1YQAA 1YKDA 1IZ1A 4Y13A 4CXFA 4RS8A 4AD9A 4G7ZF 1HW1A 1STZA 3FXQA 3MWMA 2G7UA 3E6MA 4KYWA 2VZWA 4PDKA 4WWCA 3I53A 2XAGA 4EM0B 1FNNA 3D0SA 1GXPA 5DCFA 3NOTC 4A6DA 4E70A 1RUNA 4IJAA 4ZYDA 5TRDA 3LQQA 1O3QA 1O7LA 2K27A 5DUIA 3VV4A 1FC3A 3ZN0A 5LEKA 2XV4S 4GW9A 1OR7A 1G3SA 2XHKA 5ILSA 3E3VA 1YO5C 4LG0B 3E6CC 3NEUA 4L9VA 5D5VB 4Y5FA 2ESHA 2IP2A 1ZREA 4ETXA 3F8CA 4I09A 3RYRA 2W3GA 3LAJA 4RGXA 1REPC 1H9TA 2W3EA 4HAMA 1LVAA 1FYMA 2XASA 2NAZA 3QPHA 3RTRA 4I01A 3ZPLA 3D3OA 1R23A 3ABUA 1MZBA 4AWXB 2OZUA 3MQ0A 1LDJA 4KIBA 2V79A 3LA3A 2FRHA 2YX4A 3MEXA 1P92A 2YX7A 4KFCA 1ZRCA 3OV8A 2GWRA 2NYXA 5LGUA 1W5TA 4L0ZB 3I4PA 1J9IA 3WTVC 3FF5A 5DD8A 2DI3A 2GZWA 2KOIA 3F3XA 4M9ZA 2A07F 1HSJA 4ZRRA 1ZG1A 2OZ6A 3L9FA 4BH9A 3K1MA 5L3DA 2P4WA 3V4GA 1XSVA 3IWFA 2TDXA 5KVRA 1J0RA 5D5UB 1WSUA 1K78A 1I27A 3R6SA 2EB7A 3K69A 2UXXA 5L3BA 4WK8F 2QQ9A 1IN7A 1ZARA 3S2WA 2M5WA 3H3UA 3P9KA 4YFXF 4KN4X 1ZGJA 4XSXF 2L01A 4U7BA 1USTA 2B18A 1HW2A 4I02A 2K02A 2K2NA 1FWZA 3RDIA 1LEBA 2PMHA 1FSHA 4L9NA 4F7ZA 2ZNYA 3ZMZA 5ICFA 2VT2A 2O9CA 4Q4ZF 2WWYA 2DQLA 3IRRA 3O5YA 1R7JA 3WGIA 4PCQA 3M1EA 2FF4A 5E8GA 3FM5A 2STWA 2GA1A 1Z6TA 2IA2A 3CTAA 4XBFA 1G4DA 5E17F 3N4MA 2VONA 2W3FA 4RQ9A 1ZLKA 1FBUA 3FMSA 5ED4A 4GXOA 4UNOA 2Y8HA 3GFLA 1K7AA 1WWXA 1K78B 2F5EA 3G73A 4NHJA 2UXNA 4BYYA 5A2QK 5BOXA 1USSA 4KNYA 1S6LA 2LNBA 3JTGA 4CICA 1ZTUA 1HKQA 4G9YA 3T8TA 4PGHA 3CI6A 3LQRA 1J2XA 3BROA 3WE3A 4ENKA 4B8XA 3EYYA 4U7DA 1D3YA 3WTTC 1J75A 5HSQA 3KZYA 3L7WA 2DO7A 5F64A 2DK8A 3W6JB 4RB2C 3J81K 4ESFA 5LLQA 3KO6A 1Z05A 2XUBA 2BE5F 3E5UA 2Z3YA 4O5VA 3V8JA 1RIOH 5L3EA 1YLFA 3LA2A 5K5QA 3KSIA 4MTEA 5E1WA 1YIOA 1B4AA 4UV9A 2Y48A 2HEOA 1FP1D 1B9NA 2H94A 4S04A 4P55A 4I0AA 1LJ9A 4HX7A 2L4AA 1ODDA 3OOPA 3VFZA 2PI0A 4LFUA 4KA4A 1QZYA 4KN7X 1IXRC 2BGCA 1QZZA 1TNSA 4Q0IA 4CDGA 3TRCA 2W3HA 4GCVA 3WTUC 2XKOA 2EV0A 2GXBA 3KP4A 4GGGA 3W2ZA 4CYDA 3F21A 3KZZA 2O0YA 2W1TB 3GO5A 2KIUA 4Q47A 3KSHA 5A2QZ 2DW4A 4M6YA 1IAWA 5JHUA 4M74A 4IPAA 2WC2A 4EMSA 3RKWA 3EEAA 1YFHA 3K1NA 2HYFA 4EVIA 3BWGA 2NNYA 3S7PA 3O3KA 3L00A 4ZYGA 2UWMA 2FSWA 3SHFA 3GUDA 5CVRA 2KRFA 4ETZA 4EQQA 2HTSA 3KE2A 4ZZDA 3FHZA 2JRTA 3HHHA 3B73A 4WF2A 4EU0A 3J81Z 1SD5A 3H92A 4O8GA 3RI4A 4IHTA 4P96A 2E1CA 1FT9A 2H6BA 2GQQA 1QBJA 2WV0A 1FSEA 1OYIA 2LSOA 2Z5UA 2E7WA 1YSPA 1TF1A 2ESNA 3E0YA 1XMAA 1B9MA 3GFMA 4ESJA 2XAJA 1G3TA 2XAFA 2JT1A 4A5NA 2W3DA 3EQLF 1GXQA 5L3CA 2EV6A 2DBBA 1EH7A 4LLNA 2OQGA 3M8FA 1MGTA 3VEPA 3KSFA 2MH2A 2NRAC 2EJRA 1ZG3A 4MHGA 4OIQF 5KK1A 5ILUA 5FFZA 3LA7A 1BI1A 4HQEA 2P8TA 1QO0D 3KEQA 2STTA 1YSQA 3ZMSA 1ZGAA 2MBFA 3LFVA 2FA5A 1I1SA 3CITA 2VT3A 2JPBA 2GAUA 2XAQA 3DF8A 1S3JA 2V9VA 1XD7A 3E5QA 3IBJA 2HWVA 3R0JA 1DP7P 3G3ZA 2M45A 4MDZA 3F8BA 3RIRA 1JHFA 3G6OA 2M8EA 2XGXA 1R5HA 3F6VA 1D8JA 4UVBA 1KU9A 2QYBA 1R00A 1W5SA 3LAPA 3FM3A 4O6JA 5DEQA 4UV8A 3BPVA 3HSEA 4JK1X 4IVNA 1IF1A 1TQPA 2PLYA 4EJOA 2W24A 4ENMA 3IHUA 3S7QA 2EFOA 1ULYA 2K31A 3GEZA 4HF2A 2DT5A
chains in the Genus database with same CATH superfamily
1UGUA 3SXYA 5M5WJ 4LITA 4KDPA 4OP5A 1LL9A 1W36C 4GZBA 3PQKA 5HAIA 4QSHA 4M3KA 1Y6IA 2BXYA 2IEKA 2KZVA 2XVCA 5GAEJ 3L1PA 4UUVA 4FD8A 2PN6A 2X1EA 3OYBA 3I55I 4A6EA 2MD0A 2TRTA 3IXBA 1SFKA 3KYDB 4RMNA 2MD5A 3G1OA 1RZ4A 4PSXA 1IN8A 3W2WA 2IWDA 1YAXA 1O3TA 1YRNA 4QHCA 3GTOJ 2B7EA 2WGWA 2R5ZA 1B72B 4PJLA 4C2MJ 3HGYA 3ZHHA 4ARZA 5GPAA 3QP6A 3IX4A 1HC8A 4JX5A 3G35A 1Y0UA 1QNTA 2HQ5A 1YS7A 3OSGA 1Y39A 4WEJA 1KE3A 3U1DA 4BQOA 1R5GA 2IGNA 4BEHA 4CO8A 3E7LA 4A3FJ 2HS5A 4V2FA 3WE2A 4DXBA 4N9IA 3H3ZA 3Q0UA 3ASOH 1GV2A 4P5OA 1JKRC 1FCMA 2X1CA 1OFCX 4ZTJA 4EJVA 3DLAA 3HTUA 1MZUA 1IV8A 1WI3A 2O9BA 1QPIA 3MKEA 3MAJA 4XOPA 3I59A 1UHSA 4IZZA 2VA0A 1YX5A 5BMZA 3LEQA 4PM7A 2ZJQF 1XJ6A 3S7OA 1X3ZB 2WUQA 3EEHA 5D8KB 4XXRA 3DP7A 2Z16A 2DA2A 3ABMH 4IHSA 1TW3A 3C7VA 3JRHA 3P01A 4OIOF 5F0HA 1AKHB 2VGLS 4ESPA 3R7WA 3DV8A 1I39A 4P9FA 5DFXA 1P4WA 2IXSA 4HSTA 4OINF 3GF2A 5IP6A 4WXHA 2L9RA 4DW6A 3S3NA 1ZR2A 1DJCA 1T56A 4H4KC 2V20A 4HPQA 4XONA 3CCMI 2J3TD 4E6WA 2XAUA 4LPZA 3HLFA 1IW7F 4XKCA 5CYVA 1IYOA 1WYBA 3NBLA 3HG9A 3LCEA 1XA1A 2D2WA 3LI9A 2ID6A 4DZJA 3HDDA 2QUFA 5JI6A 5FAQA 1X1BA 5CGSA 3OYJA 3C38A 5KSCA 5GLDA 3QOPA 1LE8B 4M3DA 5B5EC 1CF7A 2L4RA 4G94A 2CJJA 4OMZA 4AIJA 1IUYA 2JC7A 1XJ3A 3F22A 4DJ2A 2XSJC 2DFHA 2VIXA 3JW4A 3O2PE 5EJCA 5K7ZA 1E3OC 2V1BA 3MZYA 1DP9A 3N7WA 4JF6A 2WAQA 2Y2GA 1TQMA 4AIKA 3F1NB 2M2EA 1IN5A 3F8MA 3O86A 3RFBA 4A3LJ 4HOIA 2V9AA 2V0UA 1U2WA 1WJFA 4NB5A 1IRZA 2I72A 1X1AA 3IWIA 2MLKA 2VK3A 1IXCA 5LRSA 3CCVI 3EOIA 3I58A 4QD4A 4I0BA 1TZLA 1SEUA 1S72I 1NYMA 4KG5A 1I6XA 1FOXA 3S14J 2AHQA 1R1VA 2ZKZA 3KPHA 2ID3A 3RZOJ 1LI0A 3QU6A 5EG0A 3O6BB 4U0XA 2K86A 3SDGA 3W6VA 2R7TA 3SFZA 1T8IA 4L0YB 1OLTA 1PWCA 2JKRI 2P5KA 4FTHA 3K7AJ 1YRNB 1WJAA 4FETA 2Y79A 3ISGA 2M87A 1SC7A 1WE4A 2WGWB 5JFRA 1Z6RA 2R5ZB 3S2HJ 4ARZB 2DMTA 1GCEA 5FQIA 3UY6A 2GJ3A 4E3NA 4DGWB 4OQIA 3KETA 1RI7A 1FPQA 2FNPA 3COAC 2V8FA 3LR5A 4BEHB 3O8HA 5H2FC 3PL8A 4NK3A 3Q9SA 3C30A 1HBXG 3T12B 3HREA 1HLUP 3DWLE 2XFSA 4DDYA 3VP4A 1I2SA 1VHMA 5FASA 3OPHA 4FOFA 2P6TA 3DBLB 3I59B 3OIPA 4LIUA 4RAGA 1PRQA 3S7NA 2OWHA 4BL0B 4KQRA 2P0WA 1T39A 4IHWA 3GV9A 4LB5A 4S2NC 1JTYA 4BXXJ 4PM8A 3CHWP 4X68A 5DTTA 2BV6A 3KIOA 4OAYA 5EUAA 3R7WB 4A0ZA 2DPDA 1NRJA 2HYGD 2KPMA 2JPCA 1O7FA 5HDGA 2R7WA 3N4IA 4IJGA 4N9LA 3RKYA 1KA8A 2YPRA 3AG2H 1H5XA 2ZL1A 4E04A 5HLGA 5HLIA 2A49A 3GBGA 3HM5A 4N1HA 3LNQA 4I2OA 4WN5A 3VP2A 1TS7A 1ITYA 2ZLYA 5E2EA 5JVTA 2A68F 1K56D 4F94A 2QEXI 1IXSB 1EH6A 5HS9A 5J8CA 5FSRA 1S1YA 3WS1A 3CMYA 1Z1DA 4BS9A 1ZKJA 3JRFA 3W8KA 5LBQA 2X6WA 3HUGA 4XLFA 2LRDA 4PFPA 2CUZA 1TC3C 2QA4I 1CF7B 4I99C 2VKVA 3S16J 2OSUA 3L9KA 2X0LA 4MCWA 1H9GA 1DPRA 4BXUA 1K56A 3V7RA 2WZZA 3B6AA 2ZO4A 3ECHA 4WMCD 4GO1A 2GA2A 4ZJ1A 4MIMA 5EF6A 4Y0UA 3ZQFA 5CHUA 2DLLA 5E18F 1KVMA 2ZMFA 4IUKA 5D8LB 4K0WA 1O07A 1SVMA 4ZC3A 1N77A 1FTTA 1S29A 2WGVA 3CMAI 2Q0OA 2FFYA 2OD5A 4X1MA 5EG0B 4OOIA 1BM9A 2Y0MA 5E20A 2NVUB 2VLAA 1E4DA 5L2FA 1ORKA 1V5FA 3MXSA 2MFZA 2OA4A 4XOTA 2HDCA 4GS9A 3UO9A 5KMWA 1X1DA 4R3JA 2YUSA 2F5VA 3QODA 4YWZA 4E6KG 1D1JA 5J1RA 4PJJA 1H88C 1Y4OA 4ID4A 5J4YA 3OYFA 4QWQA 2HPBA 4HJ4A 2B95A 2O8XA 1P4AA 4E7JA 1YW7A 5K5OA 1G2HA 2PAVP 3GQZA 4NQWA 1LPQA 3CG5A 3MFXA 3BG9A 2XRNA 1Z09A 4M3EA 3SS4A 4M9SA 4MLLA 1EV7A 2ISYA 3V7SA 2UUZA 4J01A 1FOKA 2JWTA 4XKWA 3A3JA 2MSYA 1NH3A 4IHQA 2EIMH 2VEAA 2MH9A 1XMKA 5GAHJ 3W4PA 3C3WA 3C4OA 1ZLJA 2PYRA 4ITVA 5E2FA 3BFDA 4E3MA 1O4XA 2F6CA 2ZOHA 1FY7A 2LH9A 5GHXA 1LNWA 2DN0A 2DTZA 1IG7A 4BNCA 2OPTA 4ZDXA 4WXCA 3LWFA 3OCNA 3K4CA 4HQMA 3CMEI 4HBTA 2KDOA 3MSHA 5HVQC 4XORA 2ZL1B 1ON1A 3BJ6A 1E17A 4IUHA 5JYPA 5L09A 1K6RA 2WA0A 1WCMJ 2MLGA 3F6OA 3IF6A 2FU4A 5I94A 2E1MB 4AU7A 2WY7Q 5CX7A 2VQCA 2BZTA 4ABZA 4YIRX 4A0XA 4G7HF 2I10A 4A5MA 3S22A 5JYOA 1PJRA 5EE8A 3LEZA 3HBLA 3HUGB 1XSXA 3LI8A 3BZ6A 5HLHA 2EFNA 2FE3A 5CVUA 5J1YA 3TO9A 3GX4X 3ZP5A 1LVKA 3BW6A 4C3HJ 1RR7A 1VQ9I 3PJRA 3M4OJ 3ZVWA 3S3OA 2E1MC 4UAAA 1X19A 4HV6A 5EVEA 2VI6A 3QOEA 2PU2A 2RQPA 2R7ZJ 3MZHA 2J5OA 4QLCU 1BULA 2AQFA 3G1LA 1K6SA 3NULA 3TQNA 3HRMA 1JGSA 3HOUJ 1QMFA 1L0DA 5EOEA 3DBAA 4B43A 1Y54A 3QP8A 4WXDA 3LSTA 2OCEA 1Q1VA 3BC8A 4Q0HA 2PFBA 1I6HJ 1IYQA 4GS9B 3H35A 1OYWA 1JKQC 2KISA 1V5EA 1GUUA 4PGGA 2GBYA 5F1GA 3NY4A 4Y2FA 1JKPC 2X6XA 4A2UA 4PM6A 3TSGA 2OQRA 4OIPF 2KLIA 2ECBA 1HZOA 2XD1A 2HP5A 3CJNA 2JA7J 1JVJA 3PFIA 2HJ9C 4DMZA 3Q5FA 1CI9A 4NQWB 3MF0A 2H0TA 2KX6A 4EJTA 2PD8A 1I1GA 4KMUX 4OMYA 3TE8A 3LFKA 3BCAA 3SH7A 2BY0A 2ZXWH 4Q0JA 3MBZA 3KP7A 3BJOA 1D0YA 3LSMA 1NRFA 1BA5A 1IYSA 4JLFA 4FHTA 5ERIA 5JHFA 2MYSA 3JRGA 2HJEA 1J7KA 5DYMA 4XRMA 4GJ4A 1QPMA 2RREA 2TCTA 3W6KB 1PWDA 4AVZA 3RZDJ 1MBEA 3MCZA 4D1QA 3GXOA 5D4SA 3HB9A 3DTKA 2V9PA 3KLOA 3SZTA 1ZC2A 3C2WA 3IF5A 3DWKA 2MW8A 5J8FA 1R36A 4AIHA 3BG6A 4ZBEA 1SFXA 3WU2C 4EM1A 1GHCA 3ZG5A 5IU1A 3CO7C 3PAEA 4OOMA 1NZUA 3IF6B 3CJRB 3I71A 4O01A 2NS7A 5AIQA 3KYLA 3A1YA 5DF7A 2QWWA 5D6FA 1T19A 3DPLC 1K79A 2M34A 5E8IA 4RM2A 4BKXA 3L09A 5C4JJ 1RNLA 4RLFA 5E3MA 1TDLA 4Y0TA 5FI7A 4BBVA 1UG2A 2V9KA 4HOBA 1X1CA 2BY2A 2K9MA 2R7DA 3TO7A 2E8JA 4YNRA 1TW2A 2Y75A 1FMWA 3CCLI 3PXPA 3T50A 3S93A 1P0ZA 1X2MA 3E97A 3FXOA 4FASD 3REOA 3IF6C 1S6RA 4G6DA 2RAEA 2Q1ZB 5DUKA 2R9WA 4W97A 3BTCA 4NUBA 1W79A 4LOCA 2EINH 1TL8A 2WYXA 2FBIA 2DAOA 2HVQA 2RN7A 2KZGA 4UUTA 2VQGA 1EA3A 4KUMA 4XR6A 3U1KA 3W3CA 4DYRA 3B3XA 4MQVA 2M7VA 1YJNI 1G8XA 3GLLA 3NCKA 2IA0A 1KYWA 3R0AA 2WKIA 2JKGA 4C6YA 4GYIA 1HDDC 4P1WA 2HZ5A 1K0KA 2M4KA 2NVYJ 2RQQA 1ZKGA 2QQ8A 4C30A 2AXTC 1N9NA 1OTBA 2Z9OA 2CQKA 2E5ZA 3ISPA 1MY8A 1P9WA 4KZ8A 2Y2IA 3GTPJ 4ZDLA 5HDNA 4UVCA 5F0CA 1GT0C 4UB8C 3MKFA 4EQ1A 3SEZA 2OV7A 3CUOA 3DEUA 2LB5A 2H09A 3ZQHA 1S4SA 2W25A 3LIAA 3IC7A 3DU6A 3ZN1A 2CQQA 1LI9A 4O7DA 1CK3A 4R23A 2DK5A 3ULQB 3HZJA 5FKLA 3TGNA 1XC5A 2VC0A 1YHQI 1FR1A 2Q9MA 2FJ1A 1C3BA 1LSVA 1KGFA 1MD0A 2PBDP 2EV5A 4B3XA 1NLZA 3QHYA 5EZGA 3TKYA 3CCSI 2VGJA 2DA4A 4U87A 3DBRB 4ON0A 1ZAOA 4QIWN 4OOYA 1FYLA 1KU7A 4FH2A 3VDXA 5EEHA 2NVTJ 4HF0A 1Z7UA 3QPTA 2A3SA 1MIJA 3H9GA 5CLSA 3TOBA 5BNGA 4CGZA 1U60A 1K55A 3G2YA 3WS0A 2VV7A 4DYQA 5HDCA 2XD5A 2JSCA 4I3JA 3CJQB 4CQHA 1S7EA 2DDAA 4E6XA 2HOEA 1LDKB 2LF7A 2RVCA 3D5SC 3HBRA 3EQUA 3K70D 4YFMA 3UB5P 2V8CA 4LV1A 1MC0A 3UE0A 2GLOA 3FXJA 2ME0A 2VPRA 2VOOA 2R7FA 1FZPB 1W4MA 3HUMA 5GTHC 2BG1A 3NWSA 1WGXA 2LVSA 4GLQA 1V54H 5EM0A 3H5NA 1G59A 1GDTA 1X58A 2QF7A 2AO9A 5AQ7A 4G3VA 1K6YA 4G8XA 4HBLA 2EZKA 2WTEA 5EOOA 1U5TA 1GVDA 1XA7A 4A3IJ 4G3WA 5FJ8J 3OLOA 1YG2A 3KSGA 4LIVA 5HLTA 3IXHA 4CPKA 3DEWA 4XSZF 3HOZJ 5JVGF 2V2FF 5DVAA 2LBFA 3UNGC 1X3UA 3FMQA 4KT5C 5IOYA 2WKPA 4RYEA 2AS5F 5AONA 4ZYHA 2DPUA 5HL1A 5AQ9A 3T1XA 3A01A 2G7HA 1Z0XA 2OU2A 1D1BA 2XAHA 4UY8I 2QKPA 2ZJPF 1LT0A 5HWWA 3CDHA 4Z1WA 5GHYA 1V55H 3I54A 4JP0A 5D6EA 1XDUA 2ZM0A 3EDPA 4FTXA 3MMHA 3RTYA 4EEPA 2XF5A 2CV0A 3LIFA 2KT0A 3KP6A 3FX3A 2UZKA 3JYIA 3I5UA 3WGGA 1POGA 4GFBA 1U6GA 3PQJA 2LTPA 3KEYA 3A0SA 3HOSA 3PBSA 5HX9A 2OOLA 2GOXB 4RGSA 1XCBA 4KICA 2CUEA 1SANA 4CCMA 2GDNA 3LGOA 3P9CA 3OPLA 2M7UA 2QM3A 3F1PA 2PR6A 4KQDA 3C1DA 3LSKA 4DJ3A 3U4LP 2RNGA 1VQMI 2OTJI 4EW7A 4YIFA 2DTRA 3JREA 4PAUA 4X1LA 2XGEA 3SFIA 5A91A 4UUSB 1DDNA 1ZK8A 1K4FA 3UDFA 2R93J 4RAZA 2FMYA 5DTDA 1PFLA 4XRFA 2NXNB 3O8GA 1WJCA 5FKOA 4PZJA 4I7HA 4D7NA 3D5RC 5IP7J 1N9LA 4XN3A 2CMNA 4OP8A 4X69A 3CQZJ 1UZCA 2E1NA 4PSWA 3QAHA 5L3GA 3OL4A 2GM4A 4KFCA 2W57A 3ITBA 2Y69H 3G2BA 4B09A 3NOUC 4Y3IA 4BL2A 3MFDA 3ZQ5A 4R79A 1BI2A 1JUPA 4J19A 1MJBA 1FX7A 2F5CA 2YSRA 4R70A 3LMMA 4HDUA 2CO5A 3WTZA 3F72A 1V3FA 4ANJA 2HGVA 3BQYA 3U2RA 1F98A 4FUWA 4DF6A 2LYCA 2L02A 1C0WA 3TG9A 2WK0A 1JE8A 4B88A 3HLGA 1KU3A 3OOVA 1ERMA 1WH7A 3H1CA 1D0ZA 3BM6A 3WODF 2JZYA 3OS0A 2EWVA 1OQYA 2V6CA 1VM1A 3GZ5A 3PFYA 2HKXA 5LHIA 2O9LA 3PBRA 2P74A 1JHHA 2CFXA 5HFOA 2Y2QA 3A3EA 3NIAA 1N78A 2V6EA 4EXOA 1O3SA 1YW8A 1ZG5A 1NHAA 1U5TB 2CU7A 2ZC3B 5FD6A 3C18A 3M3YJ 3CJTB 3D5LA 1W5CC 3GFJA 1IJWC 4Z9QA 5F83A 4HX4A 4Q48A 2ZCWA 5ILVA 3OOUA 2C6YA 3FXKA 1TS8A 1W63M 5HZHA 2HR3A 2LBFB 3WTYC 2HU9A 4HHDA 5GLAA 1P97A 3I64A 3TEDA 3DKYA 4CLCD 5FAOA 3BQ8A 5CHMA 5IS1A 4A93J 3P7NA 2PBIA 2Y2MA 3AG1H 2WV1A 3A01B 2QBYA 3HYIA 2J80A 2VL8A 3G71I 4BBRJ 1P4XA 2KKOA 1P6RA 4IHYA 1I2WA 3M9AA 2K7SA 3WU0A 3HIFA 3PHYA 4XUZA 2Z6DA 5GADJ 3IL2A 2EFQA 3MXQA 1SCWA 1IN4A 4LLLA 3A0HC 5FFXA 3SZGA 1JNUA 5J47A 1A6QA 3VE4A 1YLTA 2OCCH 1X3WB 1OCZH 1JTDA 2L54A 1V9YA 3IKVA 2H6CA 1JWZA 4LRYC 4OH0A 5KZHA 3OSFA 2AXLA 3F1PB 4H0EA 2WADA 1W36D 3A0VA 3ABKH 1A35A 4H6JA 4RGUA 2XKPA 2XA7S 3G4PA 3VOLA 4Q8IA 4HP4A 2VGLM 3VYRB 5DKKA 5DKLA 5GLBA 4F93B 1SD7A 2K85A 4OIRF 1ESUA 3QWLA 4DOZA 2V1UA 2HPIA 4X6TA 1XCVA 3AG4H 4IRGA 1Z21A 2J9PA 5LGTA 4HA8A 3HUOA 3UKGA 1RP5A 1O57A 2HKOA 5IYDJ 4L9EA 4ME4A 5KSHA 1SVLA 3QPLA 1PZPA 2GIVA 3CDLA 3E6DA 1VF9A 5FD5A 4IRIA 1UFMA 3PR6A 1BN5A 2OBPA 3CUQA 3PUFA 4ZZLA 4GD6A 5HWVA 1G68A 3UE1A 1PDNC 6PAXA 4XICA 3J80K 2JE5A 3UB6A 3S1MJ 4YIIA 4ZYEA 3OYDA 2PR5A 2Y55A 2A69F 1B59A 1XFQA 3P9IA 1TWGJ 3BJNA 2K3PA 5H6RA 4KIFA 1HKSA 1HVBA 3FIWA 1Z3XA 3ZMTA 2E71A 1DJBA 2OF7A 1MBLA 1SFUA 3B47A 5AJGA 5IHVA 5K5BA 4O3MA 2XF6A 1HTZA 4HNBA 3BY6A 4QTRA 2ZFWA 1MMSA 3E2LA 2P7JA 4UB6C 4NC8A 2J5PA 5TFQA 2O6GE 1G3YA 3A3IA 4WBGA 2DJNA 4X53A 1ZH5A 2R3SA 4G7OF 4C2TA 4YOFA 4BE2A 4UQIS 2BYVE 4R1HA 1GVJA 2VE9A 2CW7A 5GL9A 5HDKA 1ONVA 1TQIA 2PMUA 4DZPA 2EX8A 3SW1A 3KCCA 1Y8RB 2M0CA 3UPOA 2AQEA 4Y17A 4ASNA 4W1UA 3HJEA 3ZR8X 2QBYB 4XLEA 2PRFA 4A12A 2NOGA 4NNJA 4XIDA 2HF6A 2DT7B 4QY6A 4OVDA 3FMRA 2KMUA 1UWNX 4EV4A 2A6EF 4HX8A 5ICGA 4EGYA 2KRHA 2R92J 1JTGA 2L4MA 1SFOJ 4S2OA 3PSFA 4R3AA 3IXDA 1HKTA 4MEXF 3LIBA 1RPWA 1CEFA 1BW5A 2DQRA 2VN2A 4M3FA 4BHBA 3MQQA 2ISZA 2ZMAA 4UVAA 2VOPA 3IT9A 5KAFC 2VASA 1E3UA 5HDDA 2PD7A 1K61A 2Z2MB 1U8RA 3DPTA 2DA6A 4YG2F 3UB8A 4H6JB 3HOTA 4AFIA 1R4MB 4CLCC 2JCHA 1BBYA 3CCQI 4ZTKA 1GHMA 5A90A 3J7AO 2VBYA 5M1AA 4BAYA 3ZQ7A 3ZGKA 2L7MP 1YJWI 1S66L 3I7JA 4BHPA 1EF4A 2DXIA 1S7AA 2KIMA 1GHIA 2O9AA 2X4HA 5E79C 4A69C 3EGDC 3EYIA 2W84A 1T33A 2JK3A 3CPTB 1OPCA 1G5UA 2GX5A 3K4JA 5AVFA 3HEFA 2IWCA 2WZXA 4WL9A 3S4XA 2XH9A 3CUQB 4A3EJ 3JSOA 1JWVA 1SAUA 1VQ4I 1BI3A 2CUJA 4EM2A 2G2UA 4N92A 3PYPA 1KU2A 2K7LA 1OCPA 3IH3A 4FISA 4Y33A 4HEA2 2HZTA 1S0WA 1T08B 4CCKA 1IRGA 3DTIA 4YFKF 1PUFA 2HDUA 3UE6A 2Q2EA 4IQ4A 5JR3A 4BWIA 3F1OA 5AQBA 3CUQC 3LSHA 3BR0A 3K4LA 3QQAA 2W27A 1GSVA 2EFPA 3QRFF 3AGFA 4E3KA 5DDGA 1VQNI 3B42A 3ZNTA 4DE2A 1W63Q 2CQXA 4ZJ2A 5E1ZB 3ECOA 4AVPA 3DTMA 4UA9A 1TP4A 2P5VA 3V7CA 2L0KA 3HRTA 4QU3A 3RJUA 3TOAA 3ZMDA 4MQ9F 5K1YA 1NWZA 2HTJA 1KZHA 3H9WA 1A04A 3KYZA 3A2KA 1F5TA 2IS6A 1XG1A 1ES2A 1BR4A 3KFWX 4FQGA 3VODA 2MG4A 2VBZA 1D5VA 3N6IA 1F1ZA 3M6BA 2RGVA 2ZXJA 3J7ZI 4IEJA 4XLNF 4F91B 1IEMA 3M8JA 4M9XA 2WKRA 2VUMJ 1AWCA 1BC8C 1NJ4A 3HSRA 4BBSJ 1Z91A 1VQPI 2XEPA 4HYEA 4G12A 1RGZA 4EGZA 3SZPA 1N25A 2DMPA 2FMLA 1YS6A 2RCXA 3ZFZA 3FXRA 1IDYA 4Y0OA 3ZMVA 1UMQA 1I3QJ 2FOKA 3PBNA 4M72A 2H10A 2JA6J 2M7AA 3T1BA 4OQ0A 3J80Z 4PUSA 3HGGA 2FNAA 4FSFA 4L5JA 2HQRA 1L3LA 3I3LA 3BEBA 5C44J 2A6HF 3E98A 3BR6A 1PIOA 1JJ6C 2YU3A 2Y2PA 3D9YA 1VZ0A 4A3CJ 1Q2PA 1KOUA 5BPDA 3FKJA 2Y30A 2VQLA 1H0MA 1TT0A 3OR1C 1YLWA 3NDGA 1SMTA 4EATA 3WS5A 3FWEA 5HPFA 3CLQA 1KYZA 4BDYA 3IX3A 4WZ5A 4EEFG 1IN6A 2PT7A 3OBFA 4WM9A 5HD3A 1IUFA 2Y31A 1I5ZA 3DFGA 2VJJA 2P7VB 5LHGA 2WAQN 3R60A 4Y4RA 3NOPC 2VQHA 1YLPA 1S7OA 5HW3A 2OLVA 1JT6A 5F04A 1PUFB 2Q2EB 1IRFA 1XMXA 1ZRFA 4L5IA 1JGGA 1BLSA 3J7YJ 2JKFA 4HZFA 4TV7A 1TD5A 3IRQA 3F23A 2NUTC 1L0OC 3N8SA 5DJUA 1U3EM 3CD6I 1ZG6A 5DD4A 3FG8A 3ABTA 1TWAJ 1T98A 3VB2A 4NXEA 3HL2A 1A31A 3FHNA 4H8RA 1XGSA 3MD2A 4U0WA 3V8LA 2W85A 3A0BC 4LMYA 2ZD8A 3BFCA 2V1DA 4IBXA 3CDIA 1XGMA 4OLGA 3K1PA 4JQFA 2QJ7A 2M30A 2E2HJ 4Z2YA 2O8KA 3ZQCA 3KZIC 1J59A 5I5LA 5D4RA 2R7SA 2BHYA 4GOGA 4G6TB 1XP4A 4FCFA 3HSFA 2MC4A 1E3HA 4BY7J 3LOCA 3RKXA 5DM7F 1DU0A 3CO6C 3N8RA 4KT6A 4MMNA 3ZCZA 1ETVA 2P7CB 4ZH4F 3JSPA 4RDUA 3BFGA 1V5GA 4JX4A 3A03A 1HQCA 2M3AA 1FBSA 4M3GA 1DRMA 4FE7A 5CJ9A 3O87A 2ECCA 3UB9A 3NHQA 3C7JA 2FXAA 3G6EI 2RNJA 2KDZA 4IRHA 4IOAF 2O61A 3B02A 1JXSA 1PP7U 5CGXA 5CECA 1X1PA 4K91A 2ZMVA 3JTHA 1NTCA 3F9KA 1V4RA 2VXDA 4OQGA 1XX2A 4UA6A 2Z99A 3LSPA 1DJAA 1FBQA 4L9GA 3QYFA 2F4IA 2FBKA 1MMDA 2O99A 3IAS2 3SYTA 4KISA 5CEDA 4IVKA 2KRCA 9ANTA 3BR1A 3M07A 1FYKA 2RL3A 2DFIA 3OIQA 4JGPA 2ZXHA 2BHZA 4X6AJ 2VB6A 5LHHA 5A8BA 2IBDA 3GFIA 1U78A 3RJPA 2XF3A 1WJEA 2XIGA 2CGPA 3DLLF 4D5FA 4XLAA 4CYCA 3QP1A 4E3LA 1S9HA 4HJ6A 3JAMK 5EYRA 4M6XA 1ETWA 3TO6A 5IPAA 2MC3A 5CERA 4MEYF 1Z9CA 1S4RA 2C6WB 2VC1A 5B1AH 4BJ6C 2PQ8A 1AOYA 4BBUA 3BDDA 3BOQA 4XLPF 4CJNA 1IYPA 1WJ5A 2YS9A 4NETA 4WELA 5IT9K 4BD1A 5FRNA 2ZC2A 1UJ8A 5HOOA 1IKIA 3FDYA 5HPIA 1MMNA 1LB2A 3RCOA 4U0YA 5EV0A 3K4BA 1FIAA 2EIKH 3EUKL 4F55A 1G3WA 5TBMA 1BI0A 4N4OB 4K2EA 3C7UA 4WZ5C 2F5FA 2KJBA 4Y52J 1OTIA 3GVBA 4AC0A 3LR0A 4M73A 1OTAA 4B4XA 4RM3A 3MJQA 2E1OA 3HC7A 3K2AA 4B1RA 2RDPA 5AIPA 1HW5A 4LD5A 2CW0F 4B9OA 3MKYB 5LBRA 1WJBA 3WU1B 3OPRA 3W4OA 3QU3A 5DFYA 1XX5A 4S2JA 2HV1A 4JGRA 3DTEA 1ACFA 4HJ3A 2B0LA 1E0EA 1IKGA 2PDRA 2IWBA 5CVIA 2A2LA 3CZDA 3KLNA 4EUVA 1ZHHB 1NG7A 1VQ5I 1BOAA 4NKPA 3FXLA 5HWTA 1E3PA 1FCOA 1ZG4A 2HVSA 2IVMA 4KZ4A 1MH4A 2EQRA 3I0TA 3TJZC 5TGTA 4Z6YA 5EECA 2JVHA 3K4KA 3CP2A 2BBYA 1LL5A 2CG4A 5HS7A 3SS5A 4EETB 2EK5A 4LGWA 4E7HA 4BDZA 2LB9A 4OLDA 2BXZA 2H8RA 1CJFA 4RB0A 2J8YA 1VEUA 4QPOA 1XDSA 3KP2A 1BL0A 4UA7A 1QHHD 1H3QA 3WGHA 4BUPA 1MMGA 3HXLA 2MGQA 3FZVA 1XSDA 1PUEE 1H89C 4EESA 4BMWA 1KQ0A 1MDMA 4U0TA 5J8XA 2DJIA 1HD8A 4AIDA 4BJPA 5MC7A 4MGRA 2KJCA 3TP0A 2EPFA 3IXGA 1YW9A 4C75A 4B4CA 3KEOA 1N9OA 1XB4A 4AYBA 4CYCB 2HQNA 1D8KA 2QQBA 3HHGA 5CPRB 3CCRI 1YLJA 5HL6A 5CQEA 4EERA 1HCRA 4R8HA 3FKVA 3MZFA 3W4QA 4KITB 2ZB9A 3H82A 5A93A 2VBWA 3Q9VA 5ICCA 1I50J 3ESWB 3T8RA 2KIFA 2O7OA 5HNHA 3DXJF 1CQTA 1SDEA 3BJAA 4MNRA 3HRSA 1QHGA 3AG3H 3GLXA 3PO2J 3VFHA 4CUGA 1YT4A 1VQ7I 4HLYA 5FATA 5TBMB 4BHCA 3MR0A 4P87A 2W00A 1VQLI 1OKRA 5H6QA 3VP3A 1XPBA 4I98B 3ASNH 4EQIA 2GXGA 4DDSA 3HOXJ 2ELJA 3OR2C 4FE4A 2VKDA 3OPPA 4X25A 4BACA 4KG2A 2MJ6A 3K2ZA 1T18A 4OPQA 3BY9A 2VE8A 2WB1A 2Y2KA 1VTNC 1VETA 5A92A 4L5EA 1IGNA 3KX2A 4CCOA 4J00A 4A3MJ 5EPHA 4U0VA 1G6NA 2XDVA 5E3LA 2HVRA 2WB1N 1BJAA 2A5YB 1WJDA 1WVRA 3A4CA 1BIAA 2HOSA 4KMFA 3CWFA 1ZYRF 3T4OA 3GZNB 4NXBA 3RYPA 4EWFA 1HXDA 2EX9A 1LDDA 4P6ZS 2HFHA 1WQ2A 2NS8A 2QZ8A 4XLCA 5H20A 1YTYA 2DMQA 1FILA 4D0PA 1F4KA 3GZ6A 4L18B 3MZEA 2DA5A 3PBQA 3Q0WA 3CUEA 1XS9A 3L7HA 2EA4A 3LO7A 1BC7C 1M40A 1N75A 2BTFP 3QNBA 4KZ9A 4DE3A 1KONA 3DQVC 1DP3A 5FGMA 3BPXA 3CF5F 1ESIA 2M1CA 4QPRA 3VFFA 1DY6A 1VEUB 3JAMZ 2OAZA 3GWZA 2P08A 4U88A 5C5KA 1IELA 2PYPA 2Z33A 1JKOC 1BYWA 2YKFA 1ALQA 1W7FA 2QKLB 2E36A 2JRMA 1MSFC 1PVEA 3BG5A 3DKWA 5F1RA 3QNCA 1MDMB 1RUOA 2CV2A 5IT9Z 2LF8A 1K54A 3WTWC 1UAAA 2D1HA 3NRVA 4I3IA 2L3DA 4JKTA 3CC2I 4EEUA 2LY1A 2LC2A 4WX9A 3BY8A 4F92B 2ZNZA 2ADUA 1FEXA 3CLOA 1HSTA 2GNXA 2INWA 4EJUA 2ZMEA 1TS0A 3E2KA 3H82B 2R7VA 5ICEA 4F3LB 4CCJA 1UELB 1FP2A 3NQOA 3SDBA 2E2IJ 4R6LA 5IT3A 4KENB 2PX9A 2IS4A 4RB3C 2VKSA 2A05A 3HLEA 1UB9A 4IL6C 1OMIA 3IWQA 1EWZA 5F6FA 2FBHA 4IHVA 1OTEA 1KGSA 2CSOA 2DU9A 3CCYA 2Y9ZA 2W1TA 3RPUD 2LY2A 1YOVB 2QYOA 1ZN2A 4A0YA 3AAFA 3PIPF 2K9QA 5LEJA 3Q7ZA 2OUMA 3UPNA 1TWFJ 2VJ4A 3S3MA 4ETSA 3GVAA 4BQAA 1B1BA 2CUFA 5HAPA 2K5CA 2CYYA 1W7PD 2PG4A 4EJWA 3RPUA 3TDUC 1WHUA 1VETB 2EX2A 3DWZA 1RKWA 2DNSA 3UR3C 2Y2OA 5E1XA 2ELHA 2OWJA 2Q9NA 1ETOA 1MMAA 2JA2A 2L9NA 5L8MA 3H7WA 1W7PA 3WG9A 4R4SA 3SH9A 4OU0A 5LGNA 2QCOA 2LR8A 4YFNF 5TR7A 5CVVA 1DPUA 2CWEA 2DYSH 4Q5SF 4A5RA 2XA7M 1W8YA 3UNWA 1YQSA 4I3AA 3J7AY 3EUHA 1P2FA 4JOMA 3TW6A 2JTVA 5L3FA 2YKHA 3NDEA 2YR2A 1B6AA 1AWIA 1IV6A 3K9TA 4KIGA 2EA2A 4P9UA 2HDSA 3ZNYA 2BEOA 2XROA 2COBA 2L7FP 2XK1A 1T0FA 3Q82A 4I76A 4DXCA 2KIQA 3GCMA 1XN7A 3CC7I 1K25A 2JKTM 3T1SA 2IA1A 3I4MJ 4FH4A 1MSEC 1LFPA 2DMUA 2D1VA 4GN2A 2O03A 4Y15A 3HL9A 1IDZA 3CUEC 4JGOA 3V5MA 2R78A 2M1BA 3LSRA 4RAFA 2KQRA 3PIOF 3CCJI 2D45A 2H1KA 1EW0A 1RGYA 1S1ZA 2LOOA 4MFDA 3DBHB 5FKKA 2ZC5B 3GDIA 5E3OA 3JRCA 1FSYA 2BLSA 1OCCH 4N9HA 4MEZA 3QP2A 4IF4A 4NBQA 3RXWA 2CQNA 3BG3A 1SFEA 3ITAA 4S2KA 2ELKA 5HS8A 1PW1A 2G2WA 4UHUA 2DA1A 2LDUA 1R1UA 4JXVA 1O7EA 1YYVA 2Y2LA 2ZMEB 3ERED 4FX4A 3BFFA 4G6QA 3TP3A 1H8ZA 4LK0F 2R7QA 4MNUA 1K4TA 2ZJ2A 1VQQA 2R9XA 5TISC 3DAVA 3K2NA 4G3KA 1K54C 4UQIM 4N0BA 2K4BA 3TMOA 2HZDA 3F0CA 4BENA 3U9GA 3OL3A 5CTMA 4A3JJ 3ZQQA 2PHYA 4HDVA 2A24A 2QLZA 4HW0A 3Q07A 3T4JA 1BIBA 5FO5A 3GR2A 4GRIA 4U3TA 2ZMEC 1R22A 2FEZA 2RV8A 5DCMA 1XGNA 1LFBA 1YE9A 5F08A 1J3WA 3Q1FA 1SD6A 2GZAA 2P5LC 5FEFA 4BQQA 1YLYA 1OJGA 2EXBA 1HDPA 2UV1A 5FI6A 4L9TA 3Q7VA 5FLXK 3BP8A 4NC7A 5FKMA 4LB6B 3I4NJ 4A3GJ 3T0YA 1W7PB 3VOEA 3H7WB 4AUXA 4RGRA 4RA7A 5BOHA 2HXIA 3FK6A 1MKMA 4LG3A 3IP4B 2COMA 2FFFB 1WRJA 2VPLA 3UB7A 2O5RA 1B8IA 3HKZA 3GTCA 3EETA 3QP5A 4N4NB 4IXAA 3R4KA 2Y59A 3PO3J 3NWTA 4WCGA 2F2EA 3GYHX 3M8EA 3ZRGA 4ZJ3A 2A6TA 1MJAA 2LLKA 3E5XA 3O3VA 3HKZN 1UG0A 2ZC6B 3P98A 4OONA 5F6AA 3S2DJ 4LJZF 3HTSB 4LLGF 4MTDA 3D72A 4PHTA 1XPXA 3OMYA 2QKMB 4LENA 3T5XA 3SH8A 4C3IJ 3DU5A 4EUZA 2O3FA 1K55C 4MBHA 4B93A 4A3KJ 3OYHA 3GTGJ 3E6BA 2EWWA 3EUHC 1J5YA 1ETXA 3OCLA 1PP8F 5EVIB 2VJIA 3N05A 4O0PA 1MH3A 3H0GJ 3G32A 2GXAA 2EZHA 3S1QJ 1AXBA 1GA9A 2FQ3A 2PJPA 4II7A 4BL3A 1XGOA 3OYEA 1KE0A 4BBTA 3HRUA 1FLIA 1T2KA 1ETYA 1MNDA 1OYYA 5J6XA 3WTSC 2LD5A 1JI8A 4E7KA 4ENJA 2XPVA 2ZBKA 3S15J 3JRDA 1KE4A 4JXGA 4D9JA 1JT0A 4JBAA 3HOVJ 1L0FA 2QENA 4E7ZA 3N97A 4DNCA 2J3WA 2HYJA 4HQAA 4L0LA 5EVIC 1ERDA 2IW5A 4N9KA 1U5TC 1FOFA 2B02A 3ELKA 2Y4AA 2JBFA 4LLOB 1ZTRA 1IOUA 2LKPA 4M6VA 3T1RA 1QA6A 1DQUA 2A24B 2D01A 2QHKA 3QP4A 4F3LA 3H9QA 4FT8A 2MA3A 3OYAA 1MWUA 3HLWA 1J09A 3IAM2 2QMIA 5K7HA 2GIZA 4BGDA 1CGPA 1YM1A 3FXUA 5DCMB 2VV8A 5DTSA 3KP5A 2DFFA 3T4TA 2IPQX 3IHBA 2JSPA 1TTYA 5FAPA 2F4MB 4YELA 3NJAA 4NEED 2W1RA 3WWXA 3VYUB 1ETQA 2Y0SA 1TLHB 2EH3A 4LRXC 3Q7VB 1OTDA 1Z67A 4II3A 1ZRDA 1TNTA 4KQQA 1BT5A 5TJJA 1LHYA 4D60A 4MN7A 5D3OA 2NS0A 2JN7A 4F52A 2P6SA 1FQGA 1R58A 4CLCA 4JX6A 1B8IB 2RKHA 1KQ9A 1AU7A 3K4NA 3TW7A 1QGPA 1K6OA 1SMYF 4RAYA 4XKVA 5J7EA 3MKZA 1F36A 2VBXA 4ESBA 1ON2A 3K4MA 2QSGX 5G4ZA 3FC7A 1UHMA 1BTLA 5CRFA 2R0QC 1FOYA 1QQIA 2EFXA 1N9BA 3OYNA 2XSSA 2DFEA 1NK2P 3SQNA 1W5DA 3LSJA 4DQ2A 4KZBA 2ETHA 1JWPA 1ONHA 1UHWA 2L7ZA 1X0OA 5D5XB 4LK1F 1IC8A 5FB2A 1XTAA 3HUNA 3LIEA 5FA7A 1T6SA 1T38A 3FYZA 2VJWA 3ZG0A 1IFQA 1Z3YA 3F8NA 3AFHA 1P7IA 1HLVA 3CESA 1YJ9I 5BPIA 4MN6A 4R1GA 4OOLA 2KLOA 2K3FA 2VLGA 1VQKI 2X02A 4HF1A 3JRIA 4ENNA 1TBXA 4BU2A 1WPKA 1JTXA 1CF0A 3JCUC 3BQZA 5DV5A 1W0TA 2IJLA 1MBFA 1NLYA 2HP9A 3WTXC 4EBNA 3OY9A 2FOWA 4C3JJ 3JRBA 2V1XA 2V4JC 1KQ8A 1T1CA 3IWZA 3HOYJ 4I5SA 4ZAMA 5CVJA 1DUXC 2E7XA 2B63J 5GHZA 1UCRA 1Q1HA 5LD2C 2ACJA 3IBRA 3V8KA 4RB1A 2VODA 2X85A 2DOAA 2OJED 5LRRA 1F5MA 5FQMA 1SAXA 5FLXZ 3TDZC 1E3UD 2Z2SB 4MBFA 4DKIA 2NNNA 2VV6A 2Z1DA 2IGKA 3L2QA 3IHAA 3LR3A 4Y7PA 4FCYA 1BLPA 2H1LA 4L9JA 1PNEA 4P6BA 4FX0A 4CHUA 2ZM2A 3EPZA 5EEGA 4DBQA 1CEGA 3UN7A 3VOZA 2K9LA 4HY8A 5CXWA 2BOLA 5EVID 4CZZA 4UHTA 3BZCA 1AHDP 2XSDC 1G28A 3F8FA 1BR1A 1WI9A 2WKEA 1MJ9A 1F9NA 3RPQA 1Y8QB 1ZHFA 1BW6A 4EV0A 2R5YA 2Y2HA 3IQAA 1VB6A 5G4YA 2FX0A 4E3IA 4HIAA 2L9VA 3H9JA 5B3SH 5JLXA 3LIDA 5EM1A 2R7UA 3Q81A 1VQ8I 1H8YA 3SS3A 3CMMA 5M3MJ 3OS2A 3IKTA 1TWHJ 2Y2ZA 5J3LA 3MFKA 2IT0A 3CC4I 4WYYA 4S05A 3L2WA 2IRFG 2A61A 3GW2A 3JPUA 4OWRB 2EZLA 2FUG2 5GP9A 1XXMA 2G9WA 2K4JA 2ZQ9A 1LQ1A 2H0YA 2VXZA 3ZVTA 5J4EA 4HV5A 2LG4A 1FCNA 1D5YA 4HLXA 3V3RA 1M1EB 2HGCA 3L2CA 2PMZA 3R61A 2CC1A 2FD5A 2EWNA 2RC4A 5K5RA 1RRJA 5EVLA 1O3RA 3CMZA 5M18A 2M4GA 1ZELA 2Q8KA 4S2IA 4DRTA 2QQAA 1K57A 2V26A 3M7GA 4LRZE 4GYGA 4E7SA 1E2XA 1F43A 3V42A 1BOBA 3HLBA 5E2HA 5D5WB 4GD8A 3KP3A 1Y1WJ 1VI0A 1AA7A 1Y1VJ 1EH8A 2L5QA 5J4VA 1R4NB 1G6OA 1V9ZA 3OIOA 3IX8A 4OPYA 5BQTA 1R1TA 2ZC7A 2ZQDA 4QB8A 2LK2A 2XQZA 3ML6A 4EBPA 3K0LA 4LG0A 3C5AA 2EFWA 1SD4A 1BLCA 1JUMA 4PM5A 2XGNA 4M71A 1WKMA 3U2AA 2PU4A 4DN0A 3ZMUA 3IH9A 4QPQA 2QVOA 3ROUA 2L0WA 3BFEA 4M3BA 4BLMA 1U8BA 2H27A 2KP6A 4RA2A 1F9IA 4KZAA 4NG2A 4DJAA 3HCYA 4P85A 1S5LC 1S8NA 3RKQA 2F5DA 4HRIA 1EJ9A 2D02A 5FDHA 4DE0A 2IGMA 1LEAA 4UXNA 5BS6A 2PEXA 1YQAA 3D4FA 4PJNA 3T1QB 1NXYA 1YMXA 5E2GA 1ACIA 5GTIC 1YKDA 1IZ1A 4Y13A 1H8MA 3GRJA 3WS4A 3LY3A 4CXFA 3ZG7B 4RS8A 2XPWA 3E0JB 4V2GA 1FMVA 4AD9A 2XR0A 1CQAA 2HOAA 3VYSB 3G31A 3M6HA 5GLCA 3GTJJ 4G7ZF 3WRZA 4DIQA 1HW1A 4S2NA 2E34A 2KHMA 5KAIC 1STZA 3MS6A 3FXQA 3MWMA 2G7UA 1IO2A 3E6MA 4JYKA 4KYWA 2VZWA 4PDKA 4WWCA 2R5YB 4HP9A 1F2KA 2E19A 1Z6FA 2VGKA 5KNLA 3I53A 2XAGA 4JPMA 1SKOA 4EM0B 3GTKJ 1FNNA 3D0SA 1GXPA 5DCFA 5EZHA 4PKYA 4E7LA 3ICYA 1NG6A 1BR2A 3NOTC 2HDWA 3H5RA 4A6DA 1OCRH 4E70A 1KGGA 1FIPA 4KQOA 1RUNA 3TOIA 4IJAA 2V1AA 4XM3A 3VWBA 1VFCA 4ZYDA 2EA9A 2XPUA 3G1MA 5TRDA 3S1NJ 2IGOA 2HNHA 1X4OA 2BVMA 3LQQA 1O3QA 1O7LA 4XNFA 1KDWA 2QSHX 1E25A 2CMPA 2K27A 5DUIA 3VV4A 3OS1A 3M2JA 1FC3A 3DW0A 3ZN0A 4DYCA 5LEKA 3BTLA 4C2UA 5M19A 1GSXA 2XV4S 4GW9A 3BTIA 1OR7A 3M1CA 1G3SA 2XHKA 3F1OB 4DE1A 5CEBA 1MBKA 2X9DA 2DYRH 3T4LA 5ILSA 3E3VA 4CZCA 1YO5C 1ONGA 4LG0B 3E6CC 2LP0A 5G18A 3NEUA 1MXOA 1K57C 4BQMA 4L9VA 3H36A 5D5VB 3CJMA 3HVFA 2ESHA 4Y5FA 2IP2A 3IWOA 1ZREA 5AVEA 4ETXA 1ZGWA 3EGXC 3HPHA 3F8CA 1BLHA 5FI2A 5HDSA 3UMDA 2K9NA 4XL9A 4I09A 3RYRA 3H0DA 1KGEA 2W3GA 4D2OA 1YX3A 3NARA 1GHPA 3LAJA 4RGXA 1REPC 3GMEA 1H9TA 2UWXA 1MNMC 2ZXIA 3LFUA 4GDBA 2W3EA 4HAMA 1LVAA 1FYMA 2IS1A 4HBUA 2XASA 2WGIA 2NAZA 4X56A 3OYKA 3QPHA 3RTRA 4JBFA 2A3UA 2EZIA 3ZXSA 2LKSA 2I5UA 4I01A 3ZPLA 3D3OA 1R23A 3UDXA 3ABUA 1T1AA 4PK4A 1MZBA 2NVQJ 4AWXB 5DS9A 5CGWA 2E60A 2OZUA 2EX6A 2HQAA 3MQ0A 5JLWA 5J3WA 2R7XA 2QPNA 3CAXA 4P6ZM 2DRWA 3JR9A 1LDJA 2M8GX 3ZGAB 4KIBA 1X2NA 1SKOB 4IQJA 2V79A 3LA3A 2FRHA 2YX4A 3KYEA 2HXOA 1R5ID 1W1WE 3C2GA 2DT6A 3MEXA 4CH7A 1P92A 2YX7A 2BY1A 2M0MA 1ZRCA 2ZSHB 3OV8A 1BJZA 2GWRA 2LMDA 2NYXA 3I9V2 5LGUA 5M5XJ 3HJIA 2CH0A 3NAUA 1W5TA 4L0ZB 3VP0A 2MABA 3I4PA 1RR8C 1J9IA 3WTVC 2ZJRF 3FF5A 5DD8A 4KZ6A 4NXFA 2DI3A 2GZWA 5FL3A 3FBIB 3FWLA 2KOIA 5EDNA 1M6KA 1OPXA 3F3XA 4S2LA 4QWOA 4R4RA 5KIZA 4M9ZA 2A07F 1HSJA 2PJRA 4ZRRA 1ZG1A 2OZ6A 2JKTI 3L9FA 2LREA 3OYLA 4BH9A 3K1MA 5L3DA 1R71A 2P4WA 4CA0A 3V4GA 2CFOA 4A3DJ 2GOMA 1Y28A 3OYGA 1XSVA 3I56I 3MN2A 4GHIA 3K3CA 5M5YJ 3VSLA 5F1FA 3IWFA 1XFNA 2TDXA 5E3NA 3SJMA 2P04A 5K7FA 2JJ7A 5KVRA 1TDGA 2ZJ9A 1J0RA 1Y0NA 3V67A 1APLC 2M9HA 4S0HB 3HOWJ 4R3BA 5D5UB 1WSUA 1H8AC 4B48A 2FQ4A 2J3TC 4WMCA 1K78A 1I27A 3R6SA 1D06A 2EB7A 1OR7C 4I6ZA 3K69A 4NC6A 4B47A 4QJGA 2UXXA 5L3BA 1PZOA 3BECA 3GTMJ 3LY4A 1FOWA 1MWRA 1L0GA 3E1SA 2QQ9A 4WK8F 4OPRA 1IN7A 3RH8B 1ZARA 2VKEA 3S2WA 1DP6A 4OQHA 3GTLJ 3Q3SA 2M5WA 3H3UA 3P9KA 4XQFA 1U9OA 4YFXF 5B66C 1MKIA 3C4PA 4KN4X 5IP9J 2I8DA 2L1MA 1ZGJA 4XSXF 2L01A 4U7BA 3LL7A 2VKHA 3VE3A 1P9RA 4E3JA 1USTA 3LSIA 2B18A 2X48A 3G4SI 2ZSIB 4A3BJ 1HW2A 3JVUA 2Y2NA 4I02A 2K02A 2EXAA 2K2NA 1LFUP 3MQOA 3VYTB 4B44A 1FWZA 3RDIA 1LEBA 3LR4A 1T95A 4ZYAA 1DGRM 1PWGA 5FEGA 2DCFA 3NI9A 3MKLA 4PFOA 2PMHA 1J9MA 1MBJA 4MFEA 1QVUA 2BY3A 1FSHA 1LL8A 4GKUA 4L9NA 4F7ZA 2ZNYA 3ZMZA 5ICFA 2VT2A 3BTJA 5GPCA 2O9CA 4S2MA 2LFBA 4Q4ZF 2WWYA 4BE1A 3V3SA 2ACGA 4MBKA 4E4HA 3CZ6A 3WHCA 5B1BH 3SOIA 4II2A 2QJ5A 3UPPA 3S17J 2K40A 5AQAA 2DQLA 3IRRA 4RBOA 3IS2A 3O5YA 3QPSA 5FQJA 4Y7NJ 1R7JA 1PYYA 3WGIA 1FR6A 2X51A 4AYBN 4PCQA 3M1EA 2ZOIA 2FF4A 2PJRB 2ZQ7A 1QVTA 5E8GA 1ETKA 3FM5A 2R4GA 2STWA 2GA1A 2NUPC 1Z6TA 2IA2A 3CTAA 2HP6A 3T4SA 4XBFA 1G4DA 5E17F 4PKYG 3N4MA 2VONA 2W3FA 4RQ9A 5FQKA 1MWSA 1ZLKA 3ONQA 4GHIB 1FBUA 4M4XA 3FMSA 2OV5A 2IS2A 5ED4A 4GXOA 4BE0A 1D7EA 4L9FA 4XN0A 5DF8A 1RKTA 2HI3A 4I39A 4JXWA 4EBLA 4UEYA 4UNOA 4C3QA 1R6RA 2Y8HA 4JF4A 1LLBA 3GFLA 2PBYA 2V0WA 2F4OB 1K7AA 1WWXA 4MLOA 1DGWY 4NDLA 1K78B 1OMEA 1Q2QA 5DTKA 2F5EA 3OC2A 1JUSA 3G73A 2Z6CA 5C4XJ 4NHJA 2DOEA 2WAEA 1YITI 3G2ZA 2UXNA 4X1EA 2BW3A 1XGIA 5U47A 3GMWA 5EEAA 4BYYA 2L9SA 2J7VA 4DBRA 5A2QK 4XT2A 2Y2JA 1QZEA 4ZTFA 5E43A 4HI4A 5BOXA 5HNFA 4CCNA 5HARA 1K4SA 1DU6A 2JMWA 2WKQA 1USSA 4HH3A 4KNYA 4LCMA 5FQ9A 2H8WA 1S6LA 3S1YA 3T4QA 2LNBA 3IV5A 4PJ0C 2BVLA 3JTGA 4MN5A 1D0XA 4CICA 3PNVA 4HNTA 1ZTUA 1HKQA 1JJ8C 1PI5A 4G9YA 3T8TA 3W2VA 4PGHA 2V1ZA 4KZ7A 2HDDA 3ZQIA 3CI6A 2LKXA 4YINA 3LQRA 4RLQA 3UDIA 2B9SA 4IOCF 1SDNA 3UE3A 3A0RA 2YU9J 2HDRA 4BJ5C 1J2XA 2FH5A 3BROA 2JA8J 3BLSA 1BSGA 3PNTA 3DEEA 3WE3A 1QRYA 1I3AA 4ENKA 4B8XA 3C8CA 3FV7A 4RVAA 1WA9A 4K08A 5FQQA 1NY0A 5M3FJ 1L2SA 2DOFA 2NOJB 4HNUA 1PI4A 2X6YA 3EYYA 3S1RJ 1KVLA 3BRMA 3IS2B 4U7DA 3N8LA 4JXSA 5EVIA 1RETA 1D3YA 1OCOH 3WTTC 1A0KA 4E3OA 1GLNA 4OPZA 1J75A 3MKWB 1X4PA 3OZHA 5HSQA 3KZYA 1TT5B 3HJKA 2XGDA 2CV1A 1Y56A 2JVGA 4PMAA 3AGEA 2JQ7A 3L2RA 4KJZA 5LFAA 1N4OA 5TGFA 5C3EJ 1TWCJ 3L7WA 2JKRM 2DO7A 4RX3A 2W7NA 2EILH 3BR2A 3PSIA 5F64A 3SEQA 1SKFA 2DK8A 3W6JB 3FKWA 3FXMA 3H3VK 3G30A 1QMEA 4IBRA 2D5VA 5DJTA 4R38A 1EKEA 2EIJH 2OTLI 2E8IA 4RB2C 1OJLA 5L07A 1K83J 3J81K 4ESFA 2ZM8A 4P0MA 3BR3A 4KUKA 2W82A 5LLQA 3KO6A 3LICA 3E4QA 1Z05A 2HDQA 2XUBA 2BE5F 4ZDPA 5IYCJ 1XGJA 3QYBA 3KYCB 4WEKA 3VOYA 4X0GA 1P9QC 3E5UA 3K10A 1UWPX 3Q0VA 2BW3B 5KCMA 4HH2A 3TW8A 3TBIA 3H5AA 3MXRA 1OCTC 2Z3YA 4XT2B 4O5VA 3V8JA 1RIOH 5L3EA 1YLFA 3LA2A 3A3DA 3HPGA 1RESA 5EFWA 2DA3A 5K5QA 5FRMA 3RXXA 2NVXJ 3KSIA 3BLYA 2OAQ1 2EBIA 4MTEA 1TS6A 3HLDA 5E1WA 2JUGA 3X2QH 1YIOA 3ABLH 3FISA 2FZ0A 1B4AA 4UV9A 2N8GA 4CSWA 2Y48A 1GSWA 1QU3A 2HEOA 4LCLA 1FP1D 1MW7A 1TVFA 1B9NA 1ENHA 2X1DA 4UUSA 3VPRA 1ES3A 2KDKA 2H94A 4S04A 4Y3OA 4P55A 1WZ2A 2ZQAA 1A5JA 2QSFX 5FKNA 3IH2A 1EROA 4I0AA 1LJ9A 4HX7A 1D1CA 2M7BA 2CS3A 2KL4A 2L4AA 1MBGA 1BZAA 2QGUA 1ODDA 1Z77A 3OOPA 3VFZA 2PI0A 1G6AA 1LSXA 3CP8A 4LFUA 4KA4A 1QZYA 4KN7X 3GTQJ 2CQ7A 2AVXA 1IXRC 2BGCA 3ZG9B 3G34A 4XRSA 2XC7A 3O88A 4S2PA 4BQNA 1HF0A 1XJ2A 3ZDJA 3BWLA 1TNSA 1QZZA 4Q0IA 2DMWA 5F68A 4BJTA 4IVIA 2Y91A 3K6GA 3RSNA 4CDGA 2XF7A 3AGDA 2W3HA 4GCVA 3WTUC 2P9VA 3TRCA 1OJ5A 2XKOA 2EV0A 2GXBA 3KP4A 2DDBA 4GGGA 4HSRA 2BASA 5HD5A 3W2ZA 1GV5A 4CYDA 3MVPA 3F21A 2V1NA 1GA0A 1FTZA 3ZQLA 4RX2A 3BYDA 3DKXA 3KZZA 2O0YA 2W1TB 3WS2A 3GO5A 2KIUA 2W1OA 1OT9A 4Q47A 4XMYA 1U0JA 5HODA 2L2OA 3L2VA 2XDMA 3KSHA 3S8PA 2DW4A 5A2QZ 4M6YA 3LUQA 4R0QA 3ZCOA 1IAWA 1NZOA 3E4OA 4IX7A 4CCLA 3BZKA 5JHUA 4M74A 3IH4A 5F69A 5F27A 3FZCA 4CLCE 4XUXA 3VMAA 4IPAA 1ES4A 3OYMA 4KUOA 2WC2A 1ODVA 1HA8A 4KZ3A 4EMSA 3RKWA 3FPVA 3AKZA 2Y9YA 3EEAA 3E4PA 1YFHA 3K1NA 4WUJA 2HYFA 4EVIA 2H5SA 3BWGA 2NNYA 1HOMA 4D7MA 3QYEA 1MNEA 2JUCA 3FK7A 3S7PA 3O3KA 5CQGA 3IH8A 3K3DA 3FPWA 4N1XA 3BR5A 1EI5A 3L00A 4ZYGA 1NYYA 3P09A 5F0FA 1P7JA 2UWMA 2FSWA 2JA5J 2X01A 3C2BA 3OWTA 4XLHA 3SHFA 4BXFA 4BY1J 1XKZA 3GUDA 3WG7H 5CVRA 2KRFA 4B3AA 2ME6A 3CCEI 4GCZA 3ZG8B 4ETZA 4V19K 4EQQA 2HTSA 1MPLA 3BCBA 5FLVA 3KE2A 4X55A 4HNVA 2G0EA 4ZZDA 2P81A 1T0FC 3TL4X 1ES5A 3FHZA 1R9TJ 2JRTA 2VX8A 3FBNB 3HHHA 4I38A 1I5QA 4D5CA 2QWSA 3B73A 4WF2A 4EU0A 4ZDOA 1YLZA 1WH5A 4IEDA 3J81Z 1SD5A 3H92A 3RQIA 2ZQCA 3BQAA 4LV2A 4O8GA 3RI4A 2P9VB 4IHTA 2F48A 5DM6F 4P96A 4GB7A 2C5WB 2E1CA 3NECA 1FT9A 2W48A 1YMSA 2R7OA 2H6BA 2GQQA 1QBJA 2WV0A 1FSEA 5IY5H 2CRGA 3AL0B 4QY5A 3UMEA 3PTEA 1OYIA 5HAQA 2LSOA 1YI2I 2DMNA 2Z5UA 2E7WA 5EGOA 1BUEA 1KDSA 1TF1A 1YSPA 3GSGA 4KZ5A 1RC9A 4WZ4A 2W4SA 1K4EA 1R49A 5F82A 2JHEA 3K70C 3B6CA 5CTNA 2ESNA 4WLAA 5GAGJ 2J9OA 2ZQ8A 3E0YA 4HESA 5L10A 1A36A 2XFTA 1XMAA 3DCFA 4AM3A 1B9MA 4GDNA 3GFMA 4ESJA 1W8QA 3AL0C 1OT6A 2XAJA 1G3TA 2XAFA 4IO9F 2L7KA 2JT1A 4A5NA 1ZR4A 3NC8A 5DF9A 4OKPA 2DCEA 2Y0SN 3P5JA 3EQLF 1GXQA 3OYIA 1VQOI 5L3CA 2EV6A 2W3DA 1EH7A 2DBBA 3L2UA 2H28A 4ZJZA 4LV0A 4OAZA 1SVOA 3PNYA 1FJLA 1ZQ3P 2OAP1 4LLNA 2OQGA 3M8FA 4PPRA 2X6OA 1MGTA 3VEPA 3KSFA 1SZVA 4KG6A 1VNDA 2ZC4B 3U21A 2MH2A 5IOZA 3CF2A 3V39A 5KHDA 2NRAC 3V50A 2LY9A 2WKHA 2E5NA 2EJRA 2KFDA 2UV0E 3MZ8A 4WF0A 3ZQGA 3PBOA 1FIKA 5FDSA 3HLCA 2R7RA 3EWKA 3PBTA 4PJMA 1ZG3A 2IAIA 3BG7A 1FSWA 1L0EA 2XRLA 3WHBA 3A02A 4YRVA 1RCJA 4MHGA 2XLNA 4OIQF 3M2KA 3LYXA 1D1AA 2WBMA 5KK1A 4PM9A 3CPTA 3W2AA 4F3QA 5ILUA 3EQVA 5FFZA 2ZFUA 1XJ4A 3LA7A 1BI1A 1A6IA 2W0NA 3KX0X 4HQEA 2A5WA 1LSWA 1NK3P 3D1NI 2P8TA 4JF5A 2K9SA 1QO0D 2DODA 3KEQA 2STTA 1YSQA 3ULFA 3BT9A 4GDFA 4C9YA 5CHJA 4XKBA 3ZMSA 4K0XA 1ZGAA 2MBFA 5FROA 3LFVA 2HOTA 3B33A 1LUJB 2EFUA 2FA5A 3ERMA 2HPMA 5CKTA 1VQ6I 1TEMA 1I1SA 3BLMA 3JRAA 3CITA 2XB5A 2VT3A 3IUOA 3T4KA 2JPBA 2GAUA 2VJ5A 2XAQA 3OYCA 2QZ6A 1B72A 3EUAA 1YPRA 3PAGA 3DF8A 1S3JA 4HG2A 2E35A 4IKFA 1PYVA 2V9VA 1XD7A 2WY8Q 5EGOB 2E2JJ 2CW8A 3E5QA 2ZBBA 2HWVA 3IBJA 2DA7A 1DP8A 4XRSG 2JN6A 3FKIJ 3R0JA 1MWTA 1DP7P 2OLUA 2XB0X 1Z7LA 3G3ZA 2M45A 3A3FA 4LV3A 4MDZA 5IYBJ 3LSGA 3F8BA 3RIRA 2WAFA 1WYCA 3PUBA 1JHFA 3ZOBA 5F1JA 1S67L 3G6OA 1W0UA 1CI8A 2ICWG 4CLCB 4XK4A 2M8EA 2XGCA 4HEFA 1LKXA 4B4ZA 3C2HA 2XGXA 1T1BA 3WRTA 2B5RA 1R5HA 1OISA 3F6VA 1AKHA 1D8JA 1PW8A 3VP1A 4UVBA 1IRXA 1KU9A 4YEJA 1R00A 2QYBA 1U9NA 5F5YA 1W5SA 3FM3A 3LAPA 4O6JA 2Z2LB 5DEQA 1ERQA 5IT5A 4UV8A 3BPVA 4NXGA 3DPUA 1WFXA 3JVVA 3HSEA 4JK1X 3MZDA 4IVNA 2V7FA 1IF1A 3PM1A 2X71A 4JGQA 3KYQA 1TQPA 3S32A 2PMZN 2PLYA 4EJOA 5FLMJ 3MMYB 3RQ4A 4GNUA 2W24A 4ENMA 3IHUA 4MO7A 3S7QA 1SHVA 2EFOA 1ULYA 1LE8A 3VSKA 2K31A 3GEZA 4HF2A 5J1UA 1MBHA 5J40A 4IHXA 1YIJI 2DT5A 2I9VA 4BD0A 2OC6A 4E7IA 3F1NA 3GECA 3ZYTA 1K38A 3CCUI
chains in the Genus database with same CATH topology
1UGUA 3SXYA 4KDPA 3PQKA 2XVCA 4UUVA 2PN6A 4A6EA 2MD5A 1RZ4A 1IN8A 1YAXA 1O3TA 4ARZA 3QP6A 1Y0UA 1QNTA 4WEJA 1YS7A 3U1DA 1R5GA 4CO8A 2HS5A 3WE2A 4N9IA 3H3ZA 3T4SA 4P5OA 4EJVA 3HTUA 1MZUA 2O9BA 4R3AA 3MAJA 3I59A 2VA0A 5BMZA 3S7OA 1XJ6A 3EEHA 5D8KB 3DP7A 4IHSA 1TW3A 3P01A 4OIOF 2VGLS 3R7WA 3DV8A 4P9FA 5DFXA 1P4WA 4OINF 3TW8A 3GF2A 4WXHA 2J3TD 4LPZA 1IW7F 5CYVA 2D2WA 3LI9A 2QUFA 5JI6A 3C38A 3QOPA 3FPWA 1CF7A 2L4RA 4G94A 4OMZA 4AIJA 1IUYA 1XJ3A 3F22A 4DJ2A 3JW4A 2V1BA 3O2PE 3MZYA 1DP9A 3RFBA 1TQMA 4AIKA 3F1NB 1IN5A 3F8MA 4HOIA 2V9AA 2V0UA 1U2WA 4NB5A 2MLKA 1IXCA 5LRSA 3EOIA 3I58A 4I0BA 1I6XA 1R1VA 2ZKZA 3QU6A 3O6BB 2K86A 3SFZA 4L0YB 2JKRI 2P5KA 2Y79A 2M87A 5JFRA 1Z6RA 4ARZB 2GJ3A 3KETA 1RI7A 1FPQA 2FNPA 3COAC 3LR5A 3Q9SA 3C30A 1HBXG 1VHMA 4FOFA 2P6TA 3I59B 3S7NA 2OWHA 1T39A 4LB5A 2BV6A 3R7WB 4A0ZA 2DPDA 1NRJA 2HYGD 2JPCA 1O7FA 5HDGA 4IJGA 3RKYA 1KA8A 2YPRA 4E04A 5HLGA 5HLIA 4I2OA 4WN5A 1TS7A 5JVTA 2A68F 1IXSB 1EH6A 5HS9A 5J8CA 1S1YA 1Z1DA 5LBQA 3HUGA 3T4JA 1CF7B 2X0LA 4MCWA 1H9GA 1DPRA 4BXUA 3V7RA 2ZO4A 3ECHA 4GO1A 2GA2A 2DLLA 5E18F 2ZMFA 4IUKA 5D8LB 1S29A 2Q0OA 2OD5A 4OOIA 1BM9A 2Y0MA 5E20A 2HDCA 2OA4A 4GS9A 4YWZA 4QWQA 4HJ4A 2O8XA 1P4AA 1YW7A 5K5OA 4NQWA 3MFXA 2XRNA 4M9SA 1EV7A 2ISYA 3V7SA 1FOKA 4IHQA 2VEAA 2MH9A 1XMKA 3C3WA 1ZLJA 2PYRA 2ZOHA 1FY7A 1LNWA 4BNCA 4WXCA 3LWFA 3OCNA 4HQMA 5HVQC