3MQ0A

Crystal structure of agobacterium tumefaciens repressor blcr
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
251
structure length
243
Chain Sequence
SQISDTVPALRRAVRILDLVAGSPRDLTAAELTRFLDLPSAHGLLAVMTELDLLARSADGTLRIGPHSLRWANGFLSHLDIVSTFNDHLAQRHDLDPYTVTLTVREGGEVVYIGCRNHTFRIGMRLPAPFTATGKILLSDLGPGELRMLFSQFPQPLTSRSVAGLSQLEEELALTRARGYSIDDGQIREGMLCIGAAIRDYSGAASAGIAISLIRSEASDEKIAYLGEELRTTANALSEKLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Agrobacterium tumefaciens Transcription Factor BlcR Is Regulated via Oligomerization.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Transcription repressor
molecule keywords Transcriptional repressor of the blcABC operon
total genus 76
structure length 243
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
A PF09339 HTH_IclR IclR helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mq0A01
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mq0A02
2XUBA 2RDPA 1F4KA 2O8XA 4KYWA 2Y8HA 4AVPA 1QPMA 2RV8A 3DP7A 1MDMB 2ZMFA 1U5TA 3CITA 1YW9A 5E1WA 3IL2A 4H0EA 4Y3IA 5CVRA 3JAMZ 3D5LA 4TV7A 2DPDA 1KA8A 1F5TA 4Q47A 3J80K 3WGHA 2JT1A 1E2XA 3ABUA 4RS8A 3KSFA 1B59A 4LK0F 4B09A 4L18B 1ON2A 1DP7P 1V3FA 2K4JA 1OYYA 2QYBA 3NOTC 1SD4A 1IN6A 2W24A 3FM3A 1HKQA 1TW3A 2K27A 4U0YA 3NOPC 4Y15A 2PEXA 3M9AA 4WXCA 3LA2A 2XIGA 3CJNA 1W7PD 3R0AA 4I02A 4Q0HA 4RB2C 3DBAA 2XAQA 3MWMA 5DD4A 2D2WA 2JTVA 1EH6A 3DF8A 1XMKA 2VBWA 2AXLA 5HLHA 3RYPA 1BI3A 2IT0A 2M7UA 3V7CA 3P9IA 1DDNA 5A2QZ 4Q4ZF 1TNSA 1IZ1A 1UHMA 2F5EA 4ZYDA 1NHAA 1YQAA 4MDZA 1R1VA 3ERED 4GXOA 2RN7A 2VBYA 2NS0A 3E6CC 2RNJA 2JRTA 4LB6B 2VEAA 3VB2A 4ENKA 1UCRA 1ZRDA 1WKMA 4MEYF 1J5YA 3GO5A 4IUHA 2EFWA 3BWGA 5EEGA 1GHCA 5HSQA 3R4KA 3BJOA 4KFCA 4KNYA 2W84A 5BPDA 2EB7A 3F23A 5BOXA 5FD5A 3U2RA 3O2PE 3I4PA 1XSDA 4KICA 2FU4A 3C1DA 2M30A 4UUVA 4OOIA 1SMTA 5DCMA 3U9GA 5LRSA 5K5BA 5D5WB 1BI0A 3CUQC 2OD5A 2TDXA 5I5LA 4HQMA 4P9FA 3K1MA 3LQRA 4BHPA 2ZXJA 2HTSA 2GWRA 1JXSA 2FOKA 3KP7A 5D6EA 3GLXA 3RTRA 1I27A 3CO6C 2D45A 3KP4A 4ZYEA 4EGYA 2XAGA 4ZYGA 3Q9VA 2MLKA 3K2NA 2GX5A 1FZPB 3QPHA 2BBYA 2GXBA 4MEXF 1FLIA 2LKPA 3MFKA 2O99A 2X0LA 5CLSA 4UNOA 3KSGA 1XGOA 3S7NA 3GW2A 4M9XA 1P6RA 3HRUA 4KIFA 1LJ9A 2E1NA 1BI2A 4LD5A 4WWCA 4NQWA 1SD5A 3GFLA 4BXUA 1U78A 5CVIA 5CJ9A 3V7SA 2H6CA 1B6AA 2PN6A 2XKPA 4DQ2A 2DW4A 3WTWC 2JSCA 5HOOA 2KJBA 3JTHA 5DEQA 1ZARA 2DBBA 2A6HF 2HZTA 5A2QK 1FSHA 1WI9A 3RKXA 1IN5A 4IJAA 2L3DA 5L3FA 2MD5A 2MH2A 1EH8A 2A61A 4U7DA 1GXQA 5D4RA 4EGZA 2A69F 2RC4A 2E7XA 1HW1A 1MJAA 4I09A 5AJGA 4IJGA 2DQLA 2FBHA 1HKTA 4PZJA 2EFPA 3VFZA 3DFGA 3PQJA 3S7PA 4HF2A 5DDGA 2Y75A 4L9NA 2OA4A 3IBJA 1MJ9A 4CGZA 4A5NA 3QRFF 1QO0D 4A0YA 3LA7A 3WGGA 2KIUA 5FFXA 4HYEA 1F5MA 4I7HA 4IHSA 3F6VA 4O0PA 1SMYF 3MEXA 4G7OF 3FF5A 3JW4A 4CXFA 5IT9K 3DEUA 3QPTA 3CUOA 4WCGA 4CDGA 2BYVE 3DV8A 3BROA 3KFWX 2QQ9A 3T1BA 4EUVA 4CQHA 5AIPA 1Z05A 1IN7A 2KJCA 1XD7A 4S05A 2YU3A 4U0WA 2H09A 3TGNA 1J7KA 3LFKA 2DK5A 2VN2A 3BZ6A 2JZYA 1O3TA 2EK5A 2O9AA 1ZLJA 2PLYA 4QLCU 4MCWA 1J59A 4G3VA 2IW5A 4L9JA 2YPRA 3IKVA 5KK1A 3E6MA 3F21A 2WV0A 1BC8C 3JSPA 2Q8KA 2QENA 3WTUC 3CDHA 4BHCA 3HOSA 3MAJA 1YSQA 5D5XB 3O6BB 1QNTA 1YO5C 2A5YB 2OZ6A 1T98A 3GXOA 3FMRA 2D1HA 2JPCA 1CF7A 4IRHA 4Q48A 1HW5A 3MF0A 1FBUA 5ICCA 3O3KA 4AIKA 3SXYA 2VT3A 2LB5A 1BJAA 4G3KA 1YYVA 3GFMA 3I59A 2ZNZA 2DPUA 3BPXA 3LFVA 1D3YA 1L3LA 1LB2A 4HF1A 2FXAA 2GA2A 2ZCWA 3K1NA 3CTAA 2KIMA 3TRCA 1IF1A 3B73A 3IC7A 3KO6A 2PG4A 3E5XA 4ETZA 3IBRA 3RJPA 3K69A 5LHIA 4HV6A 1LDJA 1OPCA 5D5VB 3P9KA 5BQTA 4A6DA 2V1DA 2LF8A 3HSRA 1B4AA 2FRHA 2CWEA 2G7UA 4HV5A 2W3EA 4HOBA 4PCQA 1IUYA 3HTSB 3J81K 1TTYA 1FNNA 3C7JA 2BGCA 1B9NA 2ZMEA 2IA0A 2QM3A 3F72A 3HTUA 3W6KB 5CYVA 3VV4A 4JQFA 1I6XA 3KEOA 2M5WA 5CVVA 1Y0UA 2O03A 4IF4A 3QU3A 2PFBA 2OZUA 2EJRA 4ZH4F 3JTGA 3GZ5A 3ZPLA 4JK1X 3RYRA 1YFHA 1V4RA 1BIBA 2M8EA 3ELKA 1I1GA 5FD6A 1O7FA 3EYYA 4EM1A 3S2WA 3FX3A 4CICA 3OOPA 4EJOA 1WRJA 2M7VA 2ELHA 2G9WA 5C5KA 4EJWA 2ZMEB 3F22A 2F2EA 1YW8A 3GVAA 1RUOA 3W6JB 1TW2A 2OU2A 3WODF 4NHJA 3HRSA 1XCBA 4Y5FA 1GVJA 3O5YA 4LG0B 1CGPA 3S7OA 5IT3A 2O0YA 4KA4A 3BJAA 2P7VB 4MNUA 5L3CA 1IRGA 3TQNA 1ULYA 3KSIA 2CQKA 3KEQA 2P7CB 2W1RA 1ZG3A 5FLXZ 1BC7C 2ACJA 2BV6A 2IA1A 1K78A 3D0SA 1MDMA 3KP6A 1D8KA 4UV8A 2XASA 1U3EM 4CZZA 2ISZA 2K2NA 3DQVC 1REPC 1MGTA 2KRFA 2QLZA 3R61A 3ZMTA 1T38A 3WTXC 2COMA 5LGNA 3I53A 1QZYA 4HLYA 5JVTA 3GFIA 5F1RA 2VC0A 5LHGA 3BP8A 1HQCA 2K31A 3Q9SA 3LA3A 4GLQA 4M6YA 2VT2A 2DLLA 2IRFG 1FYKA 1F1ZA 3F6OA 4R8HA 2GAUA 3I71A 3H92A 2IA2A 2NRAC 3FMSA 1TD5A 1XDUA 1R22A 3M1EA 1K7AA 2W3GA 2K02A 4Q0JA 4O5VA 1BM9A 4RAYA 2OBPA 2CO5A 1TLHB 1XGSA 2Z33A 3C2WA 4Y13A 1ZRCA 1U6GA 5LGTA 3FXUA 3MMHA 4QWQA 3E0YA 2NNNA 4O6JA 2FBKA 3HRMA 5ICFA 3VEPA 1WWXA 1VTNC 1W4MA 1IRFA 1FWZA 3MZYA 4KIBA 2PMUA 5DUKA 3CI6A 4UXNA 2VJWA 2ADUA 3E98A 1HKSA 3KP3A 1O57A 1U5TC 2P5KA 2EV5A 3RFBA 1SD7A 2ZNYA 3ULQB 2MBFA 2HGCA 2P6SA 5LEJA 2VOOA 2VODA 5LEKA 2ISYA 2K7LA 4L5IA 3F8BA 5HS9A 2HQNA 2Z5UA 1B1BA 3I59B 4RGRA 2QQBA 2DTRA 3E5UA 3QU6A 1P4AA 3HHHA 2R7DA 1QQIA 4Z2YA 2VE9A 5HDKA 4DN0A 1W5TA 5BS6A 1TNTA 3C3WA 5L8MA 4M72A 1LDDA 5FGMA 2QVOA 4YNRA 1P4WA 1IN4A 4NB5A 3CO7C 3J7AO 1R1TA 2QUFA 4P96A 2B18A 2QBYA 2M45A 1ODDA 3FZVA 5DFXA 2EA2A 4HX7A 2V9VA 4LRXC 1W7PA 2RGVA 1KYZA 4GCVA 2XAHA 3ZN1A 3OV8A 1HXDA 2DO7A 1QGPA 2Z3YA 4PGHA 4KMFA 4Q5SF 1C0WA 3ZMVA 4BHBA 2FE3A 1H9GA 5E18F 2GXGA 1BOAA 4IRGA 5F6FA 4R6LA 4OIQF 2FEZA 2LDUA 3QAHA 1IXCA 3FHZA 1G6NA 3N97A 3FXQA 4YFXF 1JE8A 2R7FA 3FWEA 5K5QA 5ILUA 4LB5A 1LVAA 1XDSA 4EJUA 3EDPA 2VONA 4RQ9A 3NEUA 2V79A 3IRQA 2XAJA 4DNCA 3ZP5A 1G3WA 1MJBA 2WTEA 4QPRA 2V6CA 2A3SA 3ZMSA 2G7HA 3BDDA 3DKWA 1W7PB 4L9VA 1S7OA 1AWCA 5E17F 3RI4A 5D8LB 2P5VA 2O6GE 1FT9A 1RI7A 4M9SA 2FBIA 4O3MA 2HKXA 2KLIA 1O7LA 1YS6A 3LSTA 2J5OA 1MD0A 2DQRA 5KVRA 4OIPF 2Z9OA 4HZFA 5K1YA 3DPTA 4KT5C 1U8RA 1UHWA 4N9IA 3QP6A 4R70A 2OQGA 2Y0MA 3CLOA 3ECHA 4IPAA 5H20A 3WE2A 4GYIA 5HPIA 2KKOA 2W3FA 3I58A 2Q2EA 3IRRA 4BYYA 2PJPA 1Z7UA 5L3GA 2NNYA 4EU0A 2F5DA 1Z6TA 2DT5A 1OMIA 4FX4A 1KU9A 4LMYA 1P92A 1QZZA 2RKHA 2P6TA 1ZTUA 4IXAA 4OIOF 1FPQA 2VC1A 3BOQA 4KN4X 4PAUA 1SD6A 1B9MA 1KU3A 3KZZA 4YOFA 5FB2A 4P9UA 5HDGA 4LGWA 2H6BA 4LLLA 5JR3A 1FSEA 1ZRFA 2JPBA 2XVCA 3ZMZA 2CFXA 5K5RA 1XMAA 4ESFA 3IWZA 1Z1DA 4HAMA 1UB9A 1FY7A 2A68F 4KUMA 2EFNA 2O3FA 1R23A 4I2OA 2BEOA 4IVNA 2MC3A 2K4BA 5E1XA 4CHUA 1G3YA 1XGMA 1R00A 2WC2A 5HS7A 4EJTA 4AWXB 4RAZA 3ISPA 4BNCA 1MC0A 5FO5A 1FOKA 1W5SA 1PP8F 4HBLA 2STTA 2QWWA 4ASNA 1LQ1A 3IHUA 1YKDA 3L00A 3J80Z 2HFHA 5DFYA 4ESBA 2O9CA 5HPFA 4L9TA 3N4MA 4FX0A 2X4HA 4ZRRA 1IN8A 2IPQX 3U1DA 2HYGD 1KGSA 2HTJA 5EEHA 2B0LA 4G6DA 3I64A 2GZWA 3SZPA 4ZZLA 1WSUA 1TQMA 2MA3A 3E6DA 1YG2A 2YR2A 5IT9Z 5ERIA 5LBRA 2YSRA 3T8TA 3GFJA 5D6FA 2XROA 4PGGA 2HEOA 4I01A 2LSOA 2PI0A 2FMLA 1KQ9A 2QYOA 3TO7A 1R7JA 3M8FA 1BIAA 4M73A 2MLGA 2VBXA 3MCZA 4LG0A 3WTSC 1FP1D 3ZMDA 3R0JA 5HVQC 1SFXA 4LLGF 1TQIA 1XCVA 1O3QA 6PAXA 5AIQA 4ENNA 1DPUA 4R1HA 1EV7A 2QZ8A 1HBXG 4ETSA 3KETA 1ZYRF 3KLOA 2ZKZA 3F8NA 2VXZA 1ZGJA 2EWNA 2DAOA 4IRIA 5JHUA 3F8CA 2XKOA 4I0AA 4ZYHA 3HSEA 5FFZA 2Y79A 1J2XA 5ILVA 4AD9A 2YX4A 1J9IA 2L4MA 3V4GA 3ZMUA 4MQVA 5HLGA 1XSVA 3P9CA 4ENMA 1R5GA 4FOFA 4G6QA 2V1UA 5K5OA 4M9ZA 5L3BA 4KN7X 2PQ8A 1SFEA 4ME4A 3L09A 2GA1A 1BN5A 4HLXA 4L0ZB 1JHHA 3IKTA 1R58A 1S7AA 2W3DA 2Y48A 3E97A 1LEBA 5DCMB 2VKSA 2K86A 4XLPF 1VHMA 5L3DA 3HUGA 3KE2A 5TRDA 2ZBKA 3NRVA 1T6SA 1D5VA 2O9BA 4MHGA 3AAFA 1K6OA 2A07F 2H27A 3DXJF 2EFQA 3WTTC 3WGIA 4LRYC 4KIGA 3HYIA 1X3UA 1TQPA 2PBIA 5BMZA 4CYDA 3TOBA 3G3ZA 4FT8A 2ESNA 4MQ9F 5E20A 3E6BA 2EFOA 3EUHA 3MQ0A 2R3SA 4KMUX 4YFKF 2W25A 1P2FA 3REOA 1ZGAA 5CVUA 5JFRA 1K79A 3WU1B 2W1TB 3HRTA 1FBSA 4N9HA 4BWIA 1R36A 2Q0OA 4Y17A 3K9TA 5TJJA 2LB9A 4HA8A 3NQOA 4ZZDA 3GYHX 1ZLKA 4M71A 4XBFA 4YIFA 3KP2A 1HSJA 3F8FA 4MN7A 5AONA 2CG4A 2XHKA 4Q0IA 3G6OA 1KU2A 4RGSA 2FF4A 3QP5A 1YIOA 1TF1A 3HSFA 5D5UB 2VZWA 3WG9A 3PQKA 4WX9A 3I54A 2LF7A 2DI3A 2RQPA 3TO9A 3NOUC 3L9FA 1STZA 3B02A 2HKOA 1L0OC 4RB3C 1RUNA 5D8KB 2VBZA 3BJ6A 2CYYA 4B8XA 1WQ2A 4WF2A 5ED4A 2V1XA 5CVJA 2ZFWA 1GXPA 4G9YA 1E17A 4UVAA 1Z91A 2DK8A 3KZYA 4EQQA 5LRRA 3W2ZA 1LNWA 3H3ZA 2A6EF 3ZQ5A 3HOTA 1HW2A 4O01A 3Q5FA 3SFZA 5E8GA 3GX4X 3IWFA 2RVCA 1J75A 2UXXA 4ENJA 3PFIA 4R79A 1MZBA 4L5JA 2DFIA 1S29A 3I5UA 4EM2A 4LLNA 3JAMK 4OU0A 4G94A 3BY6A 4GYGA 1FX7A 3K0LA 4FHTA 5LBQA 1CF7B 4N0BA 2XGXA 3BJNA 3WE3A 2E7WA 2W1TA 1MKMA 2AS5F 1OKRA 3FM5A 1XGNA 5J6XA 1R1UA 3FXRA 1G3TA 2PMHA 1IAWA 3GF2A 5LHHA 3QOPA 3BPVA 3ROUA 4U88A 2QBYB 4GO1A 3RPUA 2L4AA 4M74A 1O3SA 4LK1F 1YSPA 2GIVA 2L54A 4HF0A 5H6QA 2FQ3A 1J0RA 4HDUA 3DPLC 3RIRA 1LEAA 4PDKA 4U0VA 4OINF 1KQ8A 1SAXA 1Q1HA 1YW7A 2Z99A 2W85A 1USTA 2CW0F 2YX7A 1ZG1A 2F5CA 2FNPA 2LNBA 4A0XA 5HS8A 2HDCA 3R6SA 3OBFA 3CUQB 3GUDA 5ILSA 2OAZA 4P5OA 4EMSA 2IVMA 2L02A 4I98B 4KDPA 4WXDA 5HDNA 1DUXC 4MGRA 5FLXK 4MMNA 1RIOH 1KU7A 4G7HF 1SFUA 3GWZA 1AOYA 4RB0A 3ZN0A 3HIFA 1KYWA 2D1VA 5HLIA 3K2ZA 1USSA 2ETHA 4E70A 3K1PA 3E3VA 4EVIA 4ETXA 4YFNF 1F9NA 3L2CA 3L7WA 3HHGA 1ONVA 2O61A 5DUIA 5LLQA 4G8XA 1U2WA 5ICEA 5DD8A 2MH9A 4GW9A 2EV6A 5F64A 3FMQA 1LDKB 4G3WA 2OOLA 2XAFA 4F7ZA 4YIIA 2UZKA 1OYWA 2IJLA 1ON1A 2CGPA 3F8MA 1FC3A 4UVCA 3EQLF 1HSTA 4MTDA 3TKYA 4D0PA 1OR7A 3VOEA 4A2UA 3SHFA 4OMZA 5DCFA 4IHTA 1YLFA 3TDZC 1G3SA 2W3HA 4I0BA 3RPQA 1PDNC 1XN7A 1ZREA 2XSSA 1U5TB 1ZAOA 2XV4S 2P4WA 5J8CA 3V8KA 1O3RA 3EETA 4MTEA 4XRFA 3JSOA 4DMZA 1ZN2A 4BQAA 3E5QA 3H3UA 1JGSA 2NYXA 4WXHA 1YS7A 3V7RA 4A5MA 3OOVA 1FYLA 4OIRF 4CO8A 4YG2F 3WTZA 2J5PA 3ZQ7A 4LRZE 1BBYA 1S3JA 3S7QA 3TOAA 3T8RA 3WTYC 3TO6A 1UFMA 4M6XA 4A6EA 2E1CA 1IXSB 3RKYA 1I5ZA 4JBAA 2STWA 1IXRC 2CSOA 1IW7F 3T5XA 4ESJA 1T39A 3R60A 5DYMA 2F5FA 3EYIA 1QBJA 3MZHA 3LQQA 4UVBA 4XLNF 4HX8A 5DV5A 1R5HA 3GEZA 2OQRA 4OMYA 3ECOA 1G4DA 2P8TA 2P5LC 2ESHA 1Z6RA 3LAPA 4UV9A 2FA5A 5HL6A 3G73A 4EJVA 2UXNA 5L3EA 4O8GA 3NHQA 4AIHA 4XSXF 3EEAA 4EV0A 4ON0A 4HDVA 4LJZF 3D3OA 2HQRA 4BH9A 2KOIA 3P7NA 3TDUC 4EM0B 4G7ZF 3LAJA 1H9TA 3F3XA 2BE5F 4K2EA 3T0YA 3J81Z 3KLNA 2C6YA 1RNLA 3SZTA 1XSXA 1FP2A 2HOEA 2M87A 1JHFA 3ABTA 5H6RA 1A04A 4BAYA 2HGVA 1PP7U 2EA4A 1ZH5A 4XSZF 4HW0A 3SQNA 1ZG5A 4HQEA 4AIJA 2W57A 1OYIA 2ZO4A 3M8EA 4U7BA 4WK8F 2KIFA 3VODA 1FYMA 2NAZA 5JI6A 1S8NA 4E04A 2QQAA 3CUQA 4HX4A 4P55A 5E1ZB 2HR3A 4A0ZA 1XB4A 1Z9CA 2VE8A 1RZ4A 1ZHFA 2WWYA 1H0MA 2HS5A 3M7GA 3WTVC 2FMYA 4LFUA 3RDIA 1P4XA 3COAC 3V8JA 2XRNA 2HWVA 2EV0A 1K78B 5LGUA 2ZJ2A 1EH7A 2DU9A 4IUKA 4GGGA 3KSHA 2UWMA 2IP2A 3GZ6A 1YTYA 4L0YB 2FSWA 4UHTA 4A12A 2GQQA 5D4SA 1T0FA 2FNAA 1PUEE 1TBXA 4Z1WA 4Y2FA 5J8FA 3WU0A 5ICGA 1T2KA 3I0TA 1S6LA 2H94A 1D8JA 4RGUA 1KQ0A 1I1SA 4RB1A 2M1BA 4RGXA 1FBQA 4S04A 5E8IA 2HYFA 3ML6A 2L01A 5BPIA 3KCCA 3V8LA 3KP5A 1BI1A 2VOPA 3RKWA 1DPRA 3C18A 3LWFA 3HCYA
chains in the Genus database with same CATH superfamily
1E3UD 2XUBA 1E3HA 5TR7A 4DE0A 2L7MP 2RDPA 4IVIA 5B5EC 4NEED 1EJ9A 1SKOB 4JF4A 1F4KA 3OYMA 2O8XA 3VSLA 4QIWN 4KYWA 2DCFA 1K25A 1PW1A 2Y8HA 4UAAA 4AVPA 5MC7A 1QPMA 4RA2A 3WRZA 1B8IB 3EOIA 2RV8A 5J4EA 1ETKA 1TWGJ 3DP7A 4D9JA 5HLTA 1MDMB 3BWLA 2ZMFA 1U5TA 3T1QB 1A6QA 3CITA 1YW9A 5E1WA 3IL2A 4H0EA 4Y3IA 5HDSA 2NS7A 5CVRA 3DTKA 1VFCA 3W6VA 4CUGA 3JAMZ 3F1PA 3IXBA 1Z3XA 3KEYA 3D5LA 5A90A 4TV7A 4CH7A 2DPDA 4LV0A 4Y0TA 1KA8A 2P9VA 3PNTA 1F5TA 4Q47A 4DZPA 3ABMH 1D1BA 1XPXA 2NUTC 2KT0A 3J80K 3WGHA 2JT1A 5EVID 1TWAJ 1T1BA 1E2XA 1W8YA 5HAPA 4BQQA 3ABUA 4XRMA 1GSWA 4RS8A 5CKTA 2LC2A 1X1BA 3LY4A 3KSFA 2BOLA 1B59A 2DYRH 2UWXA 2CMNA 2ZC3B 4LK0F 2MYSA 4B09A 4DGWB 4L18B 2OLVA 2OWJA 4CLCC 1JKQC 1ON2A 3TE8A 1OCRH 3BLSA 1DP7P 3KYQA 1KOUA 1V3FA 4HP4A 2K4JA 1OYYA 4CCNA 2QYBA 3MSHA 2ID3A 4KZ9A 5J40A 2M7BA 3TBIA 4D5CA 3NOTC 3WS1A 1SD4A 5E3OA 3I4NJ 5M18A 1IN6A 2VKHA 3G1LA 2W24A 2WB1A 3TW6A 1JWPA 2KP6A 5JYOA 2R5ZB 5FI6A 1Y1WJ 3T4OA 2P08A 3HKZN 4DE1A 3FM3A 3TJZC 1B72B 4B93A 3F1PB 4FE7A 4E6XA 4RX2A 1HKQA 1TW3A 5CQGA 4B48A 3IS2A 5EVIC 1BA5A 3RZDJ 1MNMC 5DTKA 2K27A 4ZTFA 4U0YA 3NOPC 1ZGWA 1W63M 1XP4A 3DBRB 4Y15A 2PEXA 3M9AA 2NS8A 5EVLA 2KIQA 3LA2A 4WXCA 3PNYA 4XM3A 2E19A 4F3QA 2XIGA 4XRSA 4IO9F 3CJNA 1W7PD 3R0AA 4I02A 3CC7I 3NCKA 4Q0HA 4RB2C 5GLAA 3DBAA 2XAQA 1N9BA 1IFQA 1JTDA 3MWMA 3T4LA 5DD4A 3CZDA 2MG4A 4JF6A 2D2WA 2Y59A 2JTVA 4Y7PA 2DJIA 3EGDC 1EH6A 4D1QA 3SW1A 3DF8A 1A0KA 1XMKA 2VBWA 2AXLA 5HLHA 1SKOA 2VGLS 2JA7J 2JC7A 3B3XA 3RYPA 1S0WA 1BI3A 2IT0A 1VQ6I 2M7UA 1MSFC 3V7CA 1MWUA 3P9IA 1CQAA 1DDNA 1QPIA 2UV1A 4V19K 2PD8A 5A2QZ 4Q4ZF 2V0WA 3P09A 1TNSA 1IZ1A 2FFYA 4FH2A 1UHMA 2LLKA 3CMEI 4HBTA 4WN5A 1F43A 3ZYTA 3A0BC 5EEAA 2F5EA 4OPQA 4ZYDA 1T08B 1NHAA 2KFDA 4OAYA 1GV5A 1GSXA 2JHEA 1YQAA 2OCCH 4MDZA 1R1VA 3ERED 1YQSA 1RKTA 3RQ4A 4GXOA 1L0EA 2B02A 2DN0A 1FILA 2RN7A 2VBYA 3K4CA 2NS0A 1JTYA 5G4YA 3V3RA 2HNHA 3E6CC 4C3HJ 2RNJA 2C6WB 2V8FA 2JRTA 4IEDA 4BXXJ 1WZ2A 4LB6B 2VEAA 5CHUA 3I4MJ 1P9WA 1W63Q 1T56A 3VB2A 4ENKA 1UCRA 1Y0NA 4NBQA 1WKMA 3MKYB 4MEYF 1ZRDA 4E7SA 1W7FA 4KZAA 1J5YA 3OSGA 3MQQA 3GO5A 3OYKA 1P9QC 3CMAI 2ZM2A 3PBRA 4IUHA 3GMEA 4II7A 3UPPA 2EFWA 3QP8A 3H0GJ 4RAGA 1XXMA 3BWGA 5GTHC 5EEGA 3HL2A 1I50J 1K38A 5HNHA 1NZUA 1QZEA 2LBFB 3S3NA 1GHCA 1N9LA 1X58A 2A24A 1G6AA 4PPRA 5HSQA 1YLPA 3R4KA 2V6EA 3D9YA 5EZGA 3K7AJ 2HOTA 5GPCA 3BJOA 5C3EJ 4KFCA 4KNYA 5EOOA 2W84A 2XF6A 3B33A 2EZIA 5BPDA 4MO7A 4O7DA 1BR1A 4HIAA 1W0TA 1F9IA 3LSJA 2J9PA 3LICA 5EJCA 3HBLA 3LR0A 3FKVA 3H9WA 2EB7A 4XR6A 3F23A 5BOXA 3MZFA 5KSCA 5FD5A 4YRVA 1UELB 3U2RA 3S1YA 3JRFA 2BXYA 2EH3A 3O2PE 5HWTA 4XORA 1K61A 3J7ZI 4AFIA 2PBYA 2E2IJ 3I4PA 4JPMA 1BULA 1XSDA 1S66L 1YRNB 2L0KA 4KICA 2ZQ8A 4JF5A 2OCEA 2FU4A 4X56A 3C1DA 1OFCX 4OPZA 2M30A 4UUVA 2M4GA 3K4NA 2LOOA 4OOIA 1SMTA 5DCMA 3U9GA 4RLQA 2VI6A 1IDYA 5LRSA 2HQ5A 5D5WB 4HJ4A 1BI0A 1G5UA 3CUQC 3F9KA 1VQ5I 3JYIA 5DF8A 2B5RA 2OD5A 2WKQA 2TDXA 1QHGA 1ALQA 2V9KA 1JVJA 5GHXA 2KRCA 5I5LA 4HQMA 2BHYA 2CUEA 3S2DJ 1K4EA 4P9FA 4Z9QA 3K1MA 2WGWB 3LQRA 2W0NA 3Q1FA 1JJ6C 1OCOH 4BHPA 1BLPA 2KQRA 4GKUA 3WS2A 1WH7A 2BY2A 2ZXJA 3IXHA 2I10A 2HTSA 1KGFA 3BECA 5AVEA 2GWRA 5FKKA 2FOKA 1LFUP 1HC8A 1JXSA 1M6KA 5K7FA 1XA7A 3KP7A 1JI8A 1P9RA 1G2HA 3KZIC 3FBIB 5D6EA 3GLXA 3RTRA 2L1MA 2DMTA 3ZCOA 1KONA 1I27A 3CO6C 1I2SA 2L2OA 2D45A 4ID4A 3KP4A 3IS2B 2ZL1B 5KHDA 5L10A 2IWBA 2X01A 4GLQA 4ZYEA 4EGYA 2Y2MA 1MBJA 2XAGA 4ZYGA 3Q9VA 3CCYA 1WJEA 2MLKA 4NC7A 3K2NA 4I6ZA 1TVFA 2GX5A 1NYYA 2Y0SN 1FZPB 3QPHA 2DDBA 3S2HJ 2BXZA 1OPXA 3IH9A 2DJNA 2BBYA 3QOEA 2GXBA 4MEXF 2BW3B 1FLIA 1MIJA 2LKPA 3MFKA 2O99A 4IHQA 2X0LA 5CLSA 2JVHA 4UNOA 4A3LJ 5FASA 5FRNA 3KSGA 3BT9A 1XGOA 3UB6A 3S7NA 2CUZA 4ESPA 3GW2A 4M9XA 3CCUI 5F1FA 3RTYA 1P6RA 3HRUA 2CU7A 4KIFA 5GADJ 1LJ9A 2PD7A 3F1OB 4KG5A 3I9V2 3H0DA 3QP2A 2E1NA 3OMYA 1BI2A 4BUPA 4KUOA 2IGKA 4LD5A 2IWDA 4HOIA 3UMDA 1B72A 3CF5F 4WWCA 4NQWA 1SD5A 3GFLA 4BXUA 4XUXA 3UNGC 1U78A 5CVIA 1GHIA 3BR2A 4KG2A 5CHJA 5CJ9A 2IEKA 2H6CA 3V7SA 3SEQA 4CCLA 3HUOA 3GVBA 1B6AA 2PN6A 2JVGA 2RQQA 2XKPA 4DQ2A 2DW4A 3WTWC 2JSCA 5HOOA 2A5WA 2KJBA 3JTHA 5DEQA 4F94A 1ZARA 4WZ5A 4RDUA 4EQ1A 2DBBA 2AQEA 4BY7J 1HD8A 5CRFA 4KQOA 4N1HA 2A6HF 1J3WA 3ZRGA 2HZTA 4JLFA 2PR6A 3AG3H 5A2QK 5J1UA 5FL3A 5DF7A 3A03A 3CMZA 4WUJA 5FATA 1ESIA 2HXIA 4HJ6A 2VGLM 3S1RJ 2WGWA 4LV2A 1FSHA 1WI9A 2IBDA 3HLFA 3RKXA 1A5JA 1IN5A 3OCNA 1GHPA 4OAZA 3HUNA 2ZOHA 4DRTA 2E8IA 4RM2A 1VQ4I 4S0HB 2DOEA 4IJAA 4QTRA 1FSYA 4LV3A 2KDZA 2L3DA 3DU5A 5L3FA 1YITI 2IGMA 1EI5A 2MD5A 1LI0A 1VI0A 3PBOA 5CEBA 5DJTA 1PZOA 2MH2A 4S2KA 3B6AA 1EH8A 2A61A 4PJ0C 2V8CA 1YLTA 4NXBA 4U7DA 3OYIA 3CQZJ 5FQMA 1D1JA 1GXQA 5D4RA 4EGZA 2R7VA 1YOVB 2A69F 2B63J 2RC4A 3UY6A 2WKPA 2E7XA 2VGKA 2VQHA 3PYPA 1NTCA 2XB5A 1FR6A 1W79A 2JN6A 3N4IA 1W36C 1MPLA 2BVMA 1HW1A 4NNJA 2ZJ9A 1KE4A 1MJAA 4KITB 4I09A 4I38A 5E2HA 3GTLJ 3HC7A 5AJGA 3RJUA 5CEDA 4IJGA 5EYRA 2DQLA 2FBHA 2KLIA 4CJNA 1HKTA 2Q9MA 2LRDA 5D3OA 1VB6A 4L9EA 2JWTA 1TDGA 4PZJA 3ZNTA 2EFPA 1UAAA 3VFZA 2WAQA 3DFGA 3PQJA 3S7PA 4HF2A 3H3VK 5HZHA 5DDGA 4GDBA 5HW3A 2Y75A 4L9NA 2M3AA 3NULA 4UHUA 2DT6A 2OA4A 4KZ4A 3V50A 5J4VA 2UUZA 4KG6A 3OYCA 3IBJA 1B8IA 1MJ9A 4ZJZA 3CCEI 3S32A 2FD5A 1LE8B 3JVVA 2XLNA 4CGZA 4A5NA 3QRFF 1QO0D 1OT9A 5CXWA 4A0YA 3PM1A 5IP9J 3LA7A 1SVMA 2KIUA 5FFXA 4HYEA 3WGGA 1F5MA 4I7HA 5HODA 4ZDOA 1LT0A 4IHSA 3ZG5A 3BW6A 3AG4H 3HUMA 4XXRA 5FQJA 1SANA 3F6VA 4O0PA 2ZJPF 5L09A 4XUZA 1OTIA 5FAPA 3K2AA 1SMYF 3MEXA 4G7OF 4PJNA 5U47A 3FF5A 3JW4A 4CXFA 3U21A 4X69A 4EV4A 5IT9K 2LP0A 4XMYA 3DEUA 3BM6A 4AU7A 4MEZA 4AYBA 2L7KA 3QPTA 3CUOA 4CPKA 4WCGA 4CDGA 2BYVE 3H35A 4OQGA 5KIZA 3DV8A 3BROA 3KFWX 2QQ9A 3AG1H 2M7AA 3IXGA 3T1BA 3H36A 4ZJ1A 4EUVA 4CQHA 5AIPA 1Z05A 1IN7A 5EOEA 3ASOH 3M4OJ 4U3TA 3EWKA 2KJCA 3Q0UA 2ZSHB 1XD7A 4NDLA 4XKWA 2YU3A 2Y9YA 4S05A 3CCSI 4Q8IA 2XRLA 4U0WA 2PMZA 1GHMA 5A92A 4EEPA 2DA6A 3EGXC 1YJWI 2H28A 3MZDA 1S67L 4XONA 5FSRA 2H09A 3GBGA 3LSMA 4HEA2 3TGNA 1J7KA 1Y1VJ 2PJRA 1K55A 3LFKA 4MFDA 2DK5A 3HOYJ 1H8YA 2VN2A 5EF6A 2V1ZA 3BZ6A 2BVLA 4EEUA 1JGGA 2GZAA 2JZYA 1O3TA 2ZC4B 1ERQA 3UB5P 3V39A 2WBMA 3HGGA 3W4PA 4DJ2A 2EK5A 4QWOA 2F6CA 3WRTA 2O9AA 1ZLJA 3QNCA 3ONQA 1YRNA 2PLYA 4QLCU 1F98A 4MCWA 4A69C 4UUSB 2BHZA 2B7EA 2V1AA 1J59A 4B43A 4G3VA 2IW5A 3VP1A 3AL0B 4L9JA 2YPRA 3IKVA 1ZR2A 3EUHC 5KK1A 3E4QA 3E6MA 3F21A 2WV0A 3LIFA 1BC8C 2CQQA 3JSPA 4LIUA 2HJ9C 2Q8KA 3CDIA 2QENA 3WTUC 4GD6A 4X68A 2FJ1A 1YIJI 3CDHA 3PBTA 2M0CA 2OC6A 5F68A 2HZDA 4BHCA 1Z6FA 1T95A 3HOSA 2JA2A 3MAJA 4G12A 1YSQA 2JKGA 2JKTM 1T1AA 3DWZA 5D5XB 5J47A 3O6BB 3WS0A 1QNTA 4XL9A 1YO5C 3CJMA 1P97A 4XOPA 3C4PA 1FMVA 3HKZA 2A5YB 1ES3A 1IGNA 2X51A 2VV6A 3MFDA 2OZ6A 3WS5A 1T98A 1MH3A 4FASD 1PVEA 3GXOA 3FMRA 3I56I 2V26A 3VDXA 2XDMA 2D1HA 4F93B 2JPCA 3DKYA 1J9MA 3M6BA 1CF7A 1EROA 1VNDA 1E0EA 2PU2A 2EXBA 4IRHA 4Q48A 4FSFA 3V42A 1HW5A 3MF0A 3K4BA 1LSVA 5KMWA 3P98A 2IGNA 2K9SA 3BTLA 1FBUA 5M5WJ 3G6EI 4M3EA 5ICCA 3O3KA 1OJGA 1IYQA 1XJ2A 4AIKA 4Y3OA 1K6SA 1YM1A 3SXYA 1R9TJ 2Y69H 2BTFP 2VT3A 4II3A 3JREA 1IYPA 1Q2PA 1BJAA 2EBIA 2LB5A 4G3KA 3HJEA 1YYVA 4PSXA 1MBEA 3DU6A 3GFMA 4BLMA 3I59A 3A3IA 2ZNZA 5E3LA 5F83A 2DPUA 3BPXA 3LFVA 2V9PA 1N75A 1A31A 3IHBA 4JGQA 3SEZA 3H9GA 1D3YA 4WYYA 3NDGA 3K10A 1LB2A 1L3LA 2H1LA 2FXAA 2GA2A 1IUFA 4HF1A 5DVAA 3LL7A 1W5CC 2DMPA 5AVFA 2BG1A 3CAXA 1NJ4A 4U87A 5B66C 1ESUA 2K85A 3CP8A 2ZCWA 4UUSA 5BOHA 2LH9A 2Y2QA 3K1NA 3FBNB 1W5DA 4NKPA 2XD1A 1W8QA 1WH5A 2BW3A 1XFQA 3CTAA 3E7LA 2A2LA 2KIMA 2Q9NA 3TEDA 2K3PA 1ETVA 2N8GA 5EGOA 3TRCA 1IF1A 3B73A 3IAM2 3IC7A 2PG4A 3KO6A 3E5XA 4HH3A 4ETZA 1OQYA 2OLUA 4YEJA 3IBRA 3N05A 3RJPA 5FEGA 3K69A 5LHIA 4PSWA 3VFFA 1RR7A 4HV6A 4JGOA 1LDJA 2L9VA 1OPCA 4RVAA 5D5VB 2V1NA 1SVOA 5F04A 2IS2A 2AHQA 3P9KA 5BQTA 3FKIJ 4A6DA 3O88A 2V1DA 4X1EA 2ME0A 3FISA 3LUQA 3OS1A 4ZAMA 4BL3A 3C2HA 3U1KA 3K4MA 3OYFA 2LF8A 3HSRA 2ZD8A 1B4AA 2ZXHA 2Y2LA 4OLGA 2FRHA 3CMMA 2V1BA 2O7OA 3RCOA 4BGDA 2CWEA 2G7UA 3QPLA 2EZHA 4HV5A 4GDNA 2W3EA 4HOBA 1BLSA 4PCQA 2E35A 3WHBA 1HTZA 1IUYA 3HTSB 4FCYA 3J81K 1TTYA 2ZFUA 1N77A 1CQTA 3MZEA 4OP5A 3IX4A 1FNNA 3C7JA 1OT6A 3OSFA 3FK7A 4M3BA 3JR9A 3OC2A 5M19A 1LHYA 1LSWA 1Q1VA 2BGCA 3OYGA 2Y2JA 5KSHA 1B9NA 2ZMEA 3DTMA 3BR3A 2IA0A 2G2WA 4AUXA 2QM3A 1GCEA 3F72A 4NQWB 1WJBA 2WK0A 3UNWA 3HTUA 1FOFA 3W6KB 4FCFA 2AQFA 4S2MA 5CYVA 1HDDC 3VV4A 4AYBN 1YI2I 5FDHA 1VQ8I 3OPPA 1CI8A 1WJ5A 1I39A 4JQFA 4ZC3A 3MXRA 4B3XA 1I6XA 3KEOA 3V5MA 1MWTA 5EM1A 4MIMA 2M5WA 1X19A 3ERMA 5CVVA 3CUEC 1Y0UA 3G34A 2HDRA 5KNLA 2O03A 4IF4A 3KX0X 3QU3A 5F0FA 1MBFA 2PFBA 1SVLA 2OZUA 4W97A 3JRBA 1IRZA 2ZQ7A 2X6OA 2EJRA 1BLCA 4ZH4F 2XH9A 2LFBA 3JTGA 2KMUA 4D7NA 3GZ5A 1YLWA 4E3OA 2XPVA 3ZPLA 4JK1X 4WELA 2FX0A 2VV8A 2ICWG 3RYRA 3LEZA 4EBNA 3NWSA 1YFHA 3LIBA 4KZ5A 1V4RA 1BIBA 2M8EA 3ELKA 1I1GA 5FD6A 4C6YA 3H1CA 1IV8A 1VF9A 4E7ZA 3HJKA 1O7FA 3TOIA 3EYYA 3PTEA 4EM1A 3S1MJ 2OTLI 3S2WA 2VK3A 3FX3A 4KZ7A 4CICA 4RA7A 2M34A 1V5GA 3OOPA 3PSIA 4EJOA 5EE8A 1WRJA 4B1RA 5FRMA 4N9LA 3HUGB 2M7VA 2EILH 4GD8A 2XPWA 2ELHA 1FOWA 4HSTA 2G9WA 1W0UA 2PYPA 1K54C 4E7IA 3O87A 5HX9A 4EJWA 4BBSJ 5C5KA 4PM7A 3VYUB 2ZMEB 3F22A 2DTZA 4CYCB 3FKJA 4BDZA 2F2EA 1JTXA 2YU9J 4IHXA 1YW8A 3GVAA 1RUOA 2WZXA 2Z2MB 3BY9A 2L5QA 3W6JB 1BYWA 1D7EA 1MNEA 1TW2A 1BTLA 4JGRA 4U0XA 4AM3A 4XLCA 5DKKA 2OU2A 2OJED 3WODF 2LY2A 2LREA 4NHJA 3BFCA 4F52A 1AKHA 3TG9A 1ZKGA 4A3JJ 3HRSA 2NOJB 1XCBA 3FYZA 2VUMJ 4N4OB 1GVJA 2PAVP 3O5YA 4Y5FA 3T4SA 4LG0B 1CGPA 2DFFA 3S7OA 5GLDA 5IT3A 4YELA 5JHFA 1CEFA 2O0YA 4BE1A 4KA4A 2QCOA 3BJAA 1BZAA 1WA9A 3JPUA 5TGTA 2P7VB 1BSGA 4MNUA 2D5VA 1KVLA 5L3CA 1IRGA 5GLCA 3TQNA 2XGCA 4JX6A 3FXKA 1ULYA 2MD0A 1XGIA 3HOZJ 2CQKA 3KEQA 3KSIA 2P7CB 4IOCF 3OIPA 2W1RA 1ZG3A 5FLXZ 4BE2A 1BC7C 3TP3A 4JKTA 3LSIA 4IEJA 2YKFA 3UE0A 3HZJA 2ACJA 2BV6A 2CUFA 3E1SA 3SJMA 2IA1A 3H5AA 2H1KA 1K78A 2GM4A 3D0SA 1MDMA 2CQXA 1D8KA 3KP6A 4UV8A 2XASA 2AXTC 1U3EM 1KE0A 1ETQA 1I3AA 4CZZA 2CC1A 2NVUB 4OLDA 3WU2C 4F91B 2FFFB 4XQFA 2ISZA 3ITAA 2K2NA 4C30A 4LG3A 2WA0A 3DQVC 1REPC 1VEUA 2GOXB 2E8JA 2WKHA 2XGNA 1S7EA 2DFEA 1MGTA 2KRFA 2QLZA 3R61A 5DKLA 5J8XA 3MVPA 3ZMTA 1T38A 5F0HA 1HVBA 4KZ6A 3WTXC 2COMA 5LGNA 3I53A 4ABZA 1QZYA 4BXFA 3I55I 1YAXA 2Y2ZA 3LSPA 5JVTA 3GFIA 4HLYA 2JA5J 5F1RA 3TW8A 2VC0A 5LHGA 3IWQA 2J7VA 3BP8A 1HQCA 3O86A 2HZ5A 2K31A 3Q9SA 1XTAA 2KLOA 3CP2A 3UDXA 1XJ3A 2K5CA 3S17J 3LA3A 2X71A 3AGEA 2ZQDA 2WZZA 3OLOA 4M6YA 1DJBA 2DMQA 4XK4A 2VT2A 4A3IJ 2HPBA 2DLLA 4M3DA 2IRFG 4HJ3A 4IBXA 3G71I 1DP8A 4WZ5C 3CCMI 3JRCA 1FYKA 3ZGAB 4KQDA 2HXOA 5EG0A 3DPUA 3VP3A 1F1ZA 2XB0X 5GP9A 2HVQA 3FWLA 3F6OA 2VIXA 5KAFC 1OCCH 3I7JA 4R8HA 2E5NA 2GAUA 4DYRA 1PW8A 2W1OA 3I71A 5B1AH 3H92A 4BENA 2WADA 3MXSA 1LKXA 2IA2A 2NRAC 3CMYA 4GJ4A 3T1XA 3FMSA 4R38A 4X25A 3QHYA 2F4OB 1R5ID 4PJMA 2HOSA 1TD5A 4QPQA 1XDUA 3GCMA 2IS4A 5FKLA 3OR1C 5BNGA 1H88C 4C9YA 2PJRB 1R22A 3M1EA 1K7AA 1MWSA 2HDWA 2W3GA 1WJDA 1QVUA 2K02A 3S14J 5M3FJ 1DGWY 2FUG2 4O5VA 4AC0A 4Q0JA 4WMCA 1JUMA 4LIVA 1BM9A 4JBFA 3K3CA 2HVRA 4RAYA 2OBPA 1G6OA 1Z77A 5FQKA 1AU7A 1WJCA 2CO5A 1TLHB 1WVRA 4A3FJ 3S3OA 1IJWC 1XGSA 2Z33A 3C2WA 4Y13A 3ZDJA 1ZRCA 1U6GA 5LGTA 4X1LA 3S1QJ 4R1GA 3RSNA 4U0TA 1HA8A 3FXUA 3S22A 1DP6A 3MMHA 4QWQA 1NY0A 4HBUA 2MC4A 2PYRA 3E0YA 3Q0WA 3LI9A 2NNNA 2ZQAA 4O6JA 2FBKA 3HRMA 5ICFA 3VEPA 1WWXA 2XA7S 1M1EB 2R9WA 4GDFA 2V2FF 2VV7A 2HI3A 2QF7A 1VTNC 2QSGX 3OYEA 3OYLA 3GTKJ 3IWOA 3IH8A 1TT5B 4EUZA 5FA7A 1W4MA 2GIZA 1IRFA 1FWZA 3MZYA 4KIBA 2PMUA 4M6VA 5CQEA 5DUKA 2BY1A 5CHMA 4BJPA 1C3BA 3CI6A 1AXBA 2KDOA 3ZR8X 2XF3A 5IHVA 1L0DA 4B88A 3S1NJ 4UXNA 3U2AA 2VJWA 2ADUA 3PIOF 3BEBA 4QJGA 1K4TA 1RP5A 3E98A 1CJFA 1OJ5A 3NI9A 3ZG8B 1HKSA 3KP3A 1MBHA 4HSRA 3LOCA 5GHZA 1LFPA 1O57A 1U5TC 2P5KA 2EV5A 3RFBA 1K55C 3J7AY 1SD7A 2EX9A 2ZNYA 5IP6A 3LR5A 3ULQB 2MBFA 4D7MA 2KZVA 3P01A 2HGCA 1CI9A 4K08A 3E2LA 2P6SA 1OTEA 5LEJA 2A24B 3CJQB 2VOOA 2AO9A 2VODA 5LEKA 1OTAA 2ISYA 4OP8A 4ZTJA 2K7LA 4L5IA 4DF6A 3PO2J 2QEXI 1P7IA 1N4OA 3F8BA 4LLOB 3IWIA 2ZJQF 1Y6IA 5HS9A 2PHYA 5TBMB 2HQNA 2PU4A 4C3QA 4MNRA 2Z5UA 1B1BA 4PJLA 3T4QA 5A8BA 5F0CA 2BY3A 4B44A 3I59B 4RGRA 3PO3J 2QQBA 2DTRA 3E5UA 3QU6A 1P4AA 2R5YB 2DOFA 3HHHA 3OWTA 2R7DA 4S2NA 4DE3A 3K3DA 3O8GA 1WE4A 3ZG7B 1QQIA 4Z2YA 2VE9A 5HDKA 3OYJA 2OAQ1 4DN0A 3R7WA 1W5TA 3Q7VA 4X53A 5BS6A 1TNTA 2MSYA 3BFDA 3MS6A 3C3WA 3SDBA 5KAIC 5L8MA 2I8DA 4M72A 5FI7A 1LDDA 1JWZA 3LR3A 5FGMA 4M4XA 3PFYA 2QVOA 2V4JC 3BQ8A 4YNRA 1P4WA 2J3TC 1KGGA 1IN4A 4NB5A 3CO7C 4UQIM 2VASA 2VLGA 3ZQHA 3J7AO 5HARA 4AIDA 3CUEA 2LY9A 1Y39A 1SZVA 1T19A 1R1TA 5FAQA 4CSWA 4N9KA 2XDVA 2DNSA 5GHYA 2QUFA 4P96A 5B3SH 1PYVA 4S2LA 4H8RA 2HYJA 2RNGA 3VYTB 3CJTB 2QBYA 2B18A 2LBFA 4P6BA 1EA3A 4YIRX 4E6KG 2M45A 2PR5A 4V2GA 1ODDA 1Z09A 2W48A 3FZVA 1DQUA 2EA2A 3FIWA 1UMQA 1UWPX 4HI4A 5DFXA 4HX7A 1ETYA 2V9VA 4LRXC 1W7PA 5GPAA 5CTMA 2RGVA 1KYZA 4GCVA 2R7QA 1JT0A 3E4OA 3PBQA 5FQ9A 1X1AA 1XC5A 4BMWA 2XAHA 2MGQA 4R3BA 3ZN1A 3OV8A 1P7JA 3Q7VB 1HXDA 2DRWA 3AGDA 2FQ4A 2DO7A 4M3GA 5C44J 1QGPA 2F5VA 3QWLA 1NH3A 3HOXJ 1LL9A 1OTDA 2Z3YA 2JBFA 2K3FA 1D1AA 4GS9A 4PGHA 2X85A 4UUTA 4XICA 1X0OA 1ENHA 1MNDA 2R7ZJ 1YJNI 5F69A 4KMFA 4B9OA 4Q5SF 4BU2A 1C0WA 3ZMVA 4BHBA 2FE3A 2EZLA 1H9GA 2Z2SB 5E18F 4XOTA 4BACA 4A3BJ 2P04A 4P6ZM 2L9SA 2Q1ZB 2X02A 2GXGA 1TEMA 1BOAA 2O5RA 3F1OA 1E3OC 2Z6CA 4IRGA 1TS0A 5F6FA 1J09A 2Y31A 4R6LA 2IGOA 2HJEA 4OIQF 2FEZA 4FUWA 3VP4A 2LDUA 4FD8A 2VB6A 3QAHA 1IXCA 3FHZA 1G6NA 1RPWA 2QZ6A 3N97A 1PWCA 2B9SA 3FXQA 4YFXF 1JE8A 3H5NA 3KYEA 2R7FA 3FWEA 3LGOA 3H9QA 3NAUA 3K4LA 5FROA 2EX6A 4JXWA 5K5QA 4MLLA 3IF6C 4I5SA 5ILUA 4A5RA 4LB5A 1LVAA 1XDSA 1HCRA 5A93A 1X4OA 4EJUA 1T18A 3EDPA 2VONA 5B1BH 2HDDA 4RQ9A 2WV1A 3GRJA 2R5YA 1D0YA 4GS9B 1PIOA 3NEUA 1EKEA 2V79A 2XAJA 3IRQA 4GB7A 1O4XA 2ZMEC 1I3QJ 1IYSA 4XNFA 1KGEA 3G4SI 2PRFA 4DNCA 3ZP5A 3D72A 1G3WA 5CGXA 1MJBA 2WTEA 1RGZA 1U9NA 5HFOA 4DDYA 4QPRA 2V6CA 2A3SA 2H5SA 2Z16A 4P85A 1ZK8A 3VMAA 3ZMSA 2G7HA 4K0XA 3ZQCA 3PL8A 4Y4RA 1IC8A 3BDDA 3DKWA 1W7PB 4L9VA 1Z3YA 1S7OA 4BEHA 1AWCA 3IAS2 2BASA 5E17F 2Y30A 3RI4A 2KDKA 2WY8Q 1VQOI 3SH7A 5D8LB 1SCWA 1TS6A 5IU1A 2KISA 3JRDA 4Y33A 2P5VA 3ZGKA 3IQAA 2O6GE 1FT9A 2VQCA 3C7VA 3UE3A 1RI7A 4M9SA 1VQMI 2L0WA 1KZHA 3OPRA 2EPFA 1ZR4A 5GLBA 2FBIA 2ZMVA 4O3MA 3LCEA 4IHVA 2HVSA 2HKXA 3BZKA 1O7LA 1YS6A 3LSTA 3MKLA 3CCVI 2DXIA 1DP9A 2BLSA 2J5OA 1Q2QA 1MD0A 3OS2A 5IP7J 4S2NC 5F82A 3BTCA 5GAGJ 2DQRA 5KVRA 1FIKA 4OIPF 2Z9OA 1IKIA 4HZFA 5K1YA 3DLLF 3DPTA 3UKGA 1NRFA 2LG4A 4GHIB 4KT5C 4NC6A 1U8RA 1UHWA 1PWGA 2Y2KA 4UEYA 4BBUA 2VJ4A 4RMNA 4N9IA 2BZTA 4A3CJ 2R7UA 3QP6A 1SEUA 3RZOJ 3ZFZA 4EATA 3RKQA 2H0TA 4J01A 1ETXA 2VGJA 3MKEA 4R70A 2OQGA 4HEFA 1YHQI 2OAP1 2Y0MA 3HXLA 2ZC6B 3H7WA 1JUSA 3CLOA 3ECHA 4IPAA 3BRMA 5H20A 3WE2A 4GYIA 3ZVWA 4DIQA 2ECBA 3VE3A 5HPIA 4FETA 2KKOA 3M8JA 2EWWA 3A4CA 5CERA 2QKLB 2W3FA 1K6YA 1QA6A 1S4SA 2Y9ZA 1SFKA 3HOVJ 2EIMH 3CPTA 2DCEA 2FOWA 3I58A 1ACIA 4HNBA 2Q2EA 3IRRA 3A1YA 4BYYA 2PJPA 1Z7UA 5L3GA 5HAIA 2NNYA 1MSEC 1Y56A 2CH0A 4IL6C 3SH8A 4EU0A 1WJFA 2F5DA 1Z6TA 4W1UA 2DT5A 1OMIA 1XX2A 2HP6A 5CGWA 4FX4A 1KU9A 2MW8A 3N8LA 4LMYA 4E7HA 2XEPA 1P92A 1QZZA 3VOYA 2RKHA 2P6TA 2W00A 4XLAA 1ZTUA 4IXAA 1FPQA 2VC1A 4OIOF 3WWXA 1HLVA 3BOQA 1NXYA 4S2OA 3B42A 3UR3C 4CCMA 3BYDA 2OPTA 2K40A 3E0JB 4KN4X 4KISA 4PAUA 1SD6A 2JK3A 1B9MA 4KZ8A 3FHNA 1MY8A 1BR2A 1KU3A 3KZZA 3G35A 4YOFA 5FB2A 4XKCA 3NC8A 4E3LA 4P9UA 5HDGA 1IEMA 2INWA 4LGWA 1O07A 3HLGA 3C2GA 2VL8A 2H6BA 2XF7A 1K0KA 4LLLA 5JR3A 1FSEA 1XA1A 4I99C 4ZYAA 4BQMA 1ZRFA 2JPBA 1D0ZA 3JVUA 3FZCA 3CCLI 2XVCA 2E34A 3C5AA 2ECCA 1DGRM 3ZMZA 3CG5A 1YJ9I 2MFZA 2XGEA 4DYCA 3GQZA 2A05A 3HPHA 3NBLA 2CFXA 5K5RA 4XT2B 1U8BA 1XMAA 2MABA 4OQHA 4BBVA 4ESFA 3IWZA 3UB7A 1Z1DA 4HAMA 2XSDC 1UB9A 2OV7A 4F3LB 1G59A 4DE2A 1FY7A 2HQAA 2CV1A 3UN7A 2A68F 4HP9A 3RXXA 4KUMA 1JWVA 2EFNA 2O3FA 3C38A 1X2MA 3BQAA 1R23A 1BT5A 2EZKA 4I2OA 2BEOA 4IVNA 4RX3A 2MC3A 2VPRA 4OQIA 2K4BA 5E1XA 1SDEA 1G3YA 1XGMA 4CHUA 3G30A 1R00A 3HLWA 1FQGA 2WC2A 5HS7A 4EJTA 1FOYA 4AWXB 2RREA 4X1MA 2C5WB 2KPMA 3GTMJ 1DU6A 2DDAA 3ZQQA 4RAZA 1PI5A 3A2KA 4BKXA 2D02A 3I3LA 3ISPA 4IQ4A 4BNCA 4Y52J 5TISC 2LK2A 1MC0A 2DODA 2ELJA 4II2A 2Y91A 3BY8A 5J3WA 5FO5A 1FOKA 1W5SA 3BQYA 1PP8F 3DKXA 4HBLA 3K6GA 2STTA 1LL8A 1K4SA 2QWWA 4ASNA 2Y2NA 1MBKA 1LQ1A 4WMCD 3MZ8A 3L2VA 3IHUA 3S3MA 1YKDA 3L00A 3J80Z 2J3TD 4BD1A 4AVZA 2HFHA 1ZG6A 5DFYA 2VX8A 2P9VB 4ESBA 2O9CA 2Y2PA 5HPFA 3BFFA 4OOYA 4L9TA 3N4MA 3G32A 4FX0A 3N8RA 2X4HA 2JN7A 3IF6B 1IN8A 2IPQX 3U1DA 2HPMA 1NLZA 4ZRRA 5EVIA 2PX9A 4E3KA 2HYGD 3BLYA 2I9VA 1V9YA 1KGSA 2ZOIA 2HTJA 5EEHA 2K9LA 2B0LA 2DA1A 4G6DA 5G4ZA 3QYEA 2HPIA 1YT4A 4CLCD 3K4JA 2X6YA 3I64A 2GZWA 3SZPA 2HU9A 5DM6F 4ZZLA 1WSUA 4QB8A 1TQMA 1LPQA 1RKWA 2MA3A 1YG2A 3E6DA 2YR2A 2ZLYA 4WBGA 4QU3A 5E43A 5FI2A 4KUKA 5IT9Z 3W4OA 4JX4A 3BTJA 5ERIA 4OPRA 1BW6A 1GV2A 2M2EA 4B4ZA 5IS1A 5LBRA 4Y0UA 2YSRA 3T8TA 3GFJA 5D6FA 1DP3A 3H9JA 3ZQIA 2XROA 4C75A 1EW0A 4PGGA 2JMWA 2HEOA 2PDRA 5IOYA 2XPUA 4I01A 1ITYA 2X6XA 3EUKL 4HNVA 3U4LP 4DZJA 1XS9A 3HLBA 3PNVA 5E2EA 2DT7B 2LSOA 2PI0A 4PKYA 2FMLA 4P1WA 4DDSA 1KQ9A 4PM5A 2QYOA 2CQ7A 3TO7A 1X3ZB 1VQ7I 4YWZA 1R7JA 3D5RC 1WFXA 4OQ0A 5EGOB 4OOLA 3M8FA 4WZ4A 5IYBJ 1BIAA 2K9NA 4M73A 2KX6A 4PHTA 2MLGA 4E6WA 4Y0OA 2XFSA 2VBXA 3UE1A 3MCZA 3QQAA 4LG0A 3WTSC 1K54A 5F6AA 3WS4A 3ZNYA 4EXOA 2G2UA 3CC2I 3A0VA 1FP1D 3FV7A 1V9ZA 3ZMDA 2Z2LB 3R0JA 3KYZA 5HVQC 5HWWA 1IRXA 4UB6C 4HNUA 3UMEA 1SFXA 1QMFA 4P87A 4HG2A 3HEFA 3OS0A 2V0UA 3PJRA 2WB1N 1ZELA 2VPLA 1TDLA 4LLGF 1G68A 1TQIA 3FXLA 5F1GA 1EWZA 3CCQI 3A0SA 5JYPA 1XCVA 1O3QA 3PUFA 1Y8RB 6PAXA 5AIQA 3Q7ZA 3G2BA 4ENNA 2V9AA 1DPUA 4R1HA 1FTTA 1WHUA 2KRHA 1RR8C 3JRIA 2COBA 4KQQA 3SOIA 2JA8J 1EV7A 1WJAA 4IBRA 4UQIS 5CECA 2E36A 2QZ8A 3D5SC 5LD2C 1HBXG 3LSGA 4S2PA 2ZC2A 5M5YJ 1VQPI 1WPKA 4ETSA 1LFBA 1ZYRF 5J4YA 2WAEA 2KL4A 3KETA 3KLOA 4IQJA 1YLZA 2YUSA 3ISGA 2QSFX 2Y0SA 2ZKZA 3F8NA 3HLEA 1O7EA 2VXZA 3LNQA 1ZGJA 3IUOA 3K70C 2EWNA 1GVDA 2DAOA 3AKZA 4IRIA 4I3JA 5JHUA 3F8CA 3M6HA 2XKOA 4I0AA 5FQQA 4ZYHA 4EETB 4UA9A 3HSEA 5FFZA 2Y79A 1J2XA 3W2VA 5ILVA 2R93J 5DTSA 4N92A 4AD9A 1ORKA 2YX4A 1J9IA 2YKHA 4BL2A 1SDNA 2O8KA 2L4MA 3V4GA 4BS9A 1S1ZA 1S72I 3ZMUA 1A6IA 4MQVA 1TZLA 4XIDA 4Z6YA 3DTEA 5F27A 5HLGA 4S2IA 1XSVA 3P9CA 4ENMA 1R5GA 4FOFA 2GNXA 4N1XA 5CX7A 3PUBA 1MH4A 1HDPA 4G6QA 5K5OA 2V1UA 5FLMJ 5C4XJ 2XD5A 4M9ZA 2O9LA 2W82A 1U0JA 5L3BA 1RESA 4KENB 3SS5A 4KN7X 2PQ8A 2VKVA 2H0YA 3UB9A 3ZXSA 4F3LA 3DWKA 1SFEA 1MKIA 4ME4A 2VJ5A 3BC8A 3L09A 4RAFA 2GA1A 4DYQA 1MMSA 1YMSA 1BN5A 4HLXA 4BEHB 1AHDP 4L0ZB 5IOZA 1RCJA 2D01A 1JHHA 3TP0A 2ZM8A 3GDIA 3ASNH 3OYDA 4CLCB 4CLCE 3IKTA 3PR6A 1R58A 1S7AA 2BY0A 4BQOA 1WYCA 2W3DA 2Y48A 3G31A 3HL9A 4LV1A 2DA3A 3L7HA 2R0QC 3E97A 2IS1A 3OYBA 1K4FA 1LEBA 2DA5A 5DCMB 5IYDJ 2VKSA 3Q82A 4UB8C 2K86A 3M2KA 4EWFA 4XLPF 1S1YA 2CS3A 4KQRA 1E4DA 1VHMA 3VE4A 3H82B 3F0CA 3KX2A 1F2KA 5L3DA 3IV5A 3UE6A 2JJ7A 3HUGA 1YPRA 4M3KA 3KE2A 1ES5A 2AVXA 1T8IA 2ZC5B 1N9NA 5TRDA 5DTDA 2WUQA 2CW7A 3EPZA 2ZBKA 3A02A 3NRVA 1T6SA 4UY8I 3GR2A 1D5VA 5E3MA 2O9BA 4QY6A 4MHGA 4F92B 4E7JA 2JKRI 3DEEA 3MN2A 3CCRI 1D1CA 2HP5A 1K6RA 3AAFA 1Y8QB 2VQGA 4KT6A 1OCZH 2GBYA 4BJ6C 1K6OA 3DXJF 2A07F 2H27A 2HP9A 1BR4A 3HPGA 2EFQA 3WTTC 3C7UA 2VKDA 3WGIA 3C8CA 3Q81A 4GZBA 4LRYC 3T1RA 3N7WA 4KIGA 3HYIA 3LSKA 1OR7C 1X3UA 1TQPA 4NK3A 2XR0A 2PBIA 3GV9A 4M3FA 3SZGA 4MLOA 5BMZA 3HLDA 3ULFA 2Q2EB 3VOLA 4CYDA 3TOBA 1UG2A 3FXOA 3G3ZA 5E2GA 3BQZA 1CF0A 4FT8A 2XGDA 2ESNA 3BFGA 4X55A 2Z1DA 4MQ9F 5E20A 2XC7A 4OOMA 4A93J 1E3UA 4J19A 3E6BA 3MD2A 3LSRA 3AL0C 4X6TA 2IS6A 1H3QA 3MKWB 2EFOA 4PJJA 4MBHA 1APLC 2W7NA 1S5LC 2R78A 1XG1A 1R4MB 3EUHA 1IV6A 3MQ0A 3HGYA 1AWIA 1PJRA 1XJ4A 2RCXA 1QHHD 3IXDA 2R3SA 3GECA 5LFAA 4KMUX 3OCLA 4YFKF 2W25A 3F1NA 3ZCZA 1P2FA 3BTIA 3REOA 1ZGAA 5CVUA 5JFRA 1K79A 1H8AC 1VQQA 2ZQCA 3WU1B 1FCMA 1T1CA 1FCOA 2W1TB 4E4HA 3HRTA 1XJ6A 2ELKA 2WYXA 4NXFA 1FBSA 3GTCA 4N9HA 3TL4X 4A3KJ 3OR2C 5I94A 1S4RA 2OTJI 4K0WA 3AFHA 2MJ6A 4BWIA 2F4MB 4RYEA 1R36A 2Q0OA 3K4KA 4Y17A 1Y4OA 3ICYA 1MMNA 3K9TA 1LL5A 4JOMA 3TSGA 1JNUA 2I72A 5TJJA 2LB9A 1R6RA 4HA8A 4L9GA 3NQOA 4ZZDA 1JKRC 3HVFA 4EEFG 5JVGF 3ESWB 3GYHX 4HNTA 3D1NI 2VA0A 5K7ZA 2HV1A 1ZLKA 4M71A 3M07A 4CCKA 2Y2OA 4XBFA 3A3EA 3MKZA 4YIFA 1YX5A 3KP2A 4LPZA 5EFWA 2UV0E 4QSHA 3T4TA 5HAQA 1HSJA 1G28A 4FQGA 3UDFA 3F8FA 3L2RA 4MN7A 5AONA 3T12B 2WAFA 2CG4A 4GFBA 2QJ5A 1GLNA 2RL3A 2XHKA 1FMWA 3C30A 4Q0IA 5GL9A 3G6OA 1KU2A 4RGSA 1JT6A 4HQAA 2FF4A 3FK6A 2ZXIA 2EINH 3QP5A 1YIOA 1TF1A 3HSFA 5TBMA 2NOGA 4ZDLA 5D5UB 4E7LA 3UB8A 1PFLA 2VZWA 3V3SA 3NARA 3WG9A 1N9OA 1PWDA 3PQKA 4OPYA 4WX9A 1MXOA 3W4QA 3I54A 1S6RA 2LF7A 2DOAA 4X0GA 1N78A 5HDDA 2DI3A 1LUJB 2RQPA 4MN6A 3NIAA 4WEJA 3TO9A 3NOUC 3MMYB 3L9FA 3DWLE 1WGXA 1STZA 3QPSA 4PFOA 3RPUD 3PAEA 3BCBA 1MMDA 3B02A 2HKOA 2K9QA 2QPNA 5JLWA 2CMPA 1LE8A 2F4IA 4IOAF 1L0OC 3ABLH 4OWRB 4RB3C 1RUNA 3CC4I 3BG7A 3VYSB 1R4NB 1OLTA 5D8KB 4GRIA 1UHSA 3ABKH 4WF0A 3FC7A 2VBZA 4V2FA 3BJ6A 3DTIA 3RXWA 2CYYA 3SYTA 4B8XA 1WQ2A 4XLHA 1I6HJ 3OZHA 4WF2A 5ED4A 2E1MB 2DYSH 2V1XA 4C2TA 4G6TB 5CVJA 2ZFWA 3QODA 1GXPA 1X2NA 4G9YA 3GLLA 4XRSG 1E17A 4UVAA 1Z91A 1IELA 2DK8A 4CCJA 3G2ZA 3KZYA 3O8HA 3A0HC 3FXMA 2LR8A 2H8RA 4R4RA 5IT5A 4EQQA 5LRRA 3W2ZA 1OCTC 1XX5A 1LNWA 1YX3A 1Z0XA 2A6TA 4H6JB 4YINA 4PFPA 5FAOA 3B6CA 3H3ZA 2CRGA 2A6EF 3ZQ5A 3HOTA 4B3AA 2K7SA 5M3MJ 1HW2A 3MR0A 4O01A 1DY6A 1ODVA 2JA6J 1G8XA 3Q5FA 4RM3A 5CPRB 1X1PA 4BJTA 3C2BA 3SFZA 1GUUA 3TW7A 2EXAA 4IVKA 3ZOBA 3ZVTA 5E8GA 1R49A 3OPHA 2M4KA 4D2OA 3L2QA 3IH4A 3GX4X 1ACFA 2M0MA 4BJ5C 3IWFA 2R7WA 2RVCA 3K70D 1J75A 2W27A 3SFIA 5EUAA 2UXXA 4ENJA 3PFIA 3DW0A 3QP4A 2CV2A 3FG8A 4RLFA 4NXEA 4PM8A 4R79A 1MZBA 4L5JA 4NETA 1BL0A 1NK3P 4DJ3A 3MJQA 2M9HA 2IWCA 5HD5A 4J00A 2CW8A 2DFIA 1NRJA 1S29A 4JX5A 3BG5A 4JXGA 3I5UA 4EM2A 4A3EJ 4LLNA 4FTXA 1XKZA 5CTNA 3JAMK 3Q0VA 2Y2HA 2KHMA 4OU0A 3G4PA 1K56D 3PHYA 3PSFA 1QU3A 4G94A 3BY6A 2G0EA 1D0XA 2NXNB 4GOGA 4D5FA 1DRMA 1NZOA 4GYGA 2WGIA 1FX7A 4HESA 3K0LA 4FHTA 5LBQA 3JRHA 3EQVA 1MMGA 1CF7B 4ARZA 4OVDA 1KDSA 1OISA 4N0BA 2HDQA 2E60A 3S93A 1LLBA 4MBFA 2XGXA 3G2YA 5J1RA 3LYXA 3BJNA 3HM5A 3LIEA 1PI4A 2QKMB 2LYCA 3AGFA 3WE3A 2E7WA 2W1TA 2JKFA 1MKMA 1TWCJ 2AS5F 2VJIA 5TGFA 1ES4A 1NK2P 3GZNB 1OKRA 3PIPF 1FR1A 1NWZA 1W36D 2ZM0A 5HNFA 3FM5A 5GAEJ 2B95A 1Z7LA 5FDSA 4KZBA 3NY4A 1XGNA 5J6XA 1R1UA 1Z67A 2EWVA 1PZPA 3FXRA 4XKVA 1G3TA 2PMHA 2X9DA 1N25A 3OYNA 4HPQA 1IAWA 4PM6A 1T33A 2J3WA 5TFQA 3GTJJ 3GF2A 5LHHA 3H5RA 1KE3A 3HJIA 4R0QA 4E3MA 2H10A 3QOPA 5J3LA 1DJAA 3BPVA 5GAHJ 1BLHA 3ROUA 2NVQJ 2XA7M 4U88A 2QBYB 4GO1A 3RPUA 2L4AA 1FTZA 1MBLA 3LI8A 1V54H 3OYAA 4M74A 1O3SA 1V5EA 4PUSA 3BCAA 4LK1F 1YSPA 1H89C 3HDDA 5L07A 4EERA 4EBPA 2GIVA 2L54A 2VXDA 4HF0A 5H6QA 1VQ9I 3ZG9B 2FQ3A 3BZCA 1J0RA 2R7XA 3OL3A 4HDUA 4BDYA 4PK4A 4R4SA 2HDSA 4E3NA 3DPLC 3RIRA 3MBZA 1MMAA 2Y2GA 1LEAA 1QRYA 4PDKA 4U0VA 4OINF 3BR0A 1KQ8A 3IT9A 1SAXA 2Y2IA 1Q1HA 1YW7A 1NG7A 2VLAA 2LKSA 3E2KA 2Z99A 1TS7A 3S15J 1ERDA 1FCNA 2W85A 1USTA 1OJLA 4Y7NJ 2CW0F 1SC7A 2YX7A 4C3IJ 1ZG1A 2F5CA 1NYMA 5AQ7A 3UPNA 4ITVA 3QP1A 2FNPA 3L9KA 2EFXA 3JRGA 3EUAA 2LNBA 1IG7A 3GTGJ 4A0XA 5HS8A 1JUPA 2JSPA 2HDCA 3H82A 4QPOA 1UJ8A 3R6SA 3OBFA 1RC9A 1GSVA 1VQNI 5FEFA 3CUQB 4H4KC 2GLOA 3KIOA 4NG2A 1BJZA 4UA7A 3HOUJ 2XK1A 3BG6A 3GUDA 5ILSA 2OAZA 4P5OA 4EMSA 4E7KA 3X2QH 2IVMA 2L02A 1A36A 4I98B 3B47A 3R7WB 5FQIA 3HG9A 4KDPA 3P5JA 4WXDA 3A01B 1VEUB 4MN5A 1X3WB 2L7FP 4XN3A 3LIAA 5G18A 1UGUA 2V20A 4HH2A 5HDNA 4BBTA 2JCHA 1DUXC 4XLEA 4MGRA 1Y54A 5FLXK 2LKXA 2TRTA 4FTHA 1RIOH 4MMNA 1KU7A 4BE0A 4G7HF 1SFUA 2E2HJ 3BLMA 3GWZA 3VWBA 5HL1A 1AOYA 5M5XJ 4RB0A 3CESA 3ZN0A 3SH9A 1M40A 4I76A 1BOBA 3HIFA 1SHVA 2M1CA 1KYWA 3S8PA 3A3DA 2D1VA 1DJCA 5HLIA 5K5BA 4A3GJ 1D06A 3VFHA 2XF5A 2IAIA 4I3AA 1MBGA 3K2ZA 2L4RA 4CZCA 5AQ9A 3SS4A 1USSA 2ETHA 2XSJC 4E70A 2QGUA 3K1PA 3KPHA 3A3JA 2DA4A 3LY3A 3E3VA 1K83J 2X48A 1HLUP 4EVIA 3VP2A 4ETXA 4YFNF 1F9NA 2DA7A 4ZDXA 2I5UA 3A0RA 4ZJ3A 3L2CA 3L7WA 3HHGA 4NUBA 5EG0B 4R23A 1ONVA 1GT0C 1H8ZA 2O61A 5DUIA 5LLQA 4G8XA 1U2WA 2GXAA 5ICEA 5DD8A 2MH9A 4GW9A 1ZG4A 3OIQA 1FSWA 5EPHA 5J7EA 2EV6A 5F64A 2ZL1A 3FMQA 1LDKB 4G3WA 2LMDA 1U60A 2OOLA 5J1YA 2CV0A 3D4FA 1IOUA 1L0FA 2XAFA 4N4NB 4WEKA 5KZHA 3IF6A 5EVIB 2H8WA 1FIPA 4F7ZA 2JQ7A 3FDYA 4YIIA 1ONHA 4NXGA 5C4JJ 2UZKA 1PRQA 1AA7A 1POGA 3M2JA 1OYWA 5DF9A 2EX2A 1XGJA 2IJLA 1ON1A 3MKFA 3ZQGA 3SDGA 2CGPA 3F8MA 1A35A 4XLFA 5DS9A 3LR4A 3S16J 4UA6A 1FC3A 3W8KA 3ZQFA 5M1AA 4UVCA 3DLAA 5HWVA 3UPOA 4BBRJ 3EQLF 4DXBA 1HSTA 2L7ZA 4MTDA 4IHYA 4ANJA 3BFEA 3TKYA 1TT0A 5FKMA 4D0PA 1OR7A 1UZCA 3VOEA 4A3DJ 4A2UA 5EVEA 3CDLA 4OH0A 3SHFA 4OMZA 3GTQJ 5DCFA 4IHTA 3CLQA 3VYRB 1YLFA 3G1OA 3AG2H 3OYHA 1ONGA 2WAQN 2X1DA 3TDZC 2WKEA 2OV5A 5AQAA 4LOCA 4P6ZS 3ITBA 2IXSA 1G3SA 5IPAA 1VZ0A 2R7RA 1D5YA 1NLYA 2J80A 2W3HA 3CZ6A 4I0BA 1W1WE 1FIAA 2JRMA 3RPQA 1PDNC 1XN7A 2M8GX 5FJ8J 5FLVA 1TS8A 4C2MJ 1ZREA 4QY5A 2NUPC 2XSSA 1U5TB 4BL0B 3TMOA 1ZAOA 2XV4S 2P4WA 4DOZA 3EEHA 3FPVA 4S2JA 3HB9A 5J8CA 3V8KA 1O3RA 2YS9A 3EETA 2W4SA 1GA0A 2OWHA 4MTEA 2FZ0A 2EFUA 4XRFA 3JSOA 2PT7A 2WY7Q 4DMZA 1ZN2A 2DFHA 2VQLA 2QA4I 1E3PA 4BQAA 2ZJRF 2R4GA 2HF6A 3LFUA 3N6IA 4ZBEA 1LI9A 3E5QA 3H3UA 1JGSA 2NYXA 4WXHA 2CUJA 4DBQA 4IKFA 3KYDB 2NVTJ 1YS7A 3V7RA 4A5MA 3OOVA 3CJRB 1V55H 2RAEA 1FYLA 3PXPA 5AQBA 4OIRF 4CO8A 1L0GA 4YG2F 1XFNA 4F55A 1MZUA 3ZQLA 3WTZA 3BG9A 1HF0A 3GTOJ 2X1CA 2PBDP 5HDCA 5IY5H 1F36A 2J5PA 3ZQ7A 4LRZE 1X1CA 5K7HA 2E1MC 4JYKA 3JCUC 1BBYA 1S3JA 3A01A 3S7QA 1H8MA 3LEQA 3LIDA 3TOAA 3T8RA 3WTYC 1R71A 3TO6A 1UFMA 1H5XA 2ACGA 2GOMA 4M6XA 4XKBA 4GHIA 3IF5A 1SKFA 1X1DA 1Z21A 4A6EA 3OY9A 2E1CA 1IXSB 2R9XA 4MFEA 2DMNA 2FH5A 2ZQ9A 4QHCA 5E2FA 3IH2A 4D60A 3RKYA 2EQRA 2ZMAA 1LVKA 2NVXJ 1VM1A 1I5ZA 1U9OA 4JBAA 2STWA 3DBLB 3Q07A 4ARZB 4DW6A 4FE4A 1XMXA 1IXRC 3W3CA 2E1OA 2CSOA 2L9RA 1PUFB 1BW5A 4PMAA 1IW7F 4R3AA 1Y28A 3T5XA 1PYYA 4ESJA 3MXQA 5DM7F 1T39A 2F48A 2HDUA 1IKGA 4WM9A 3R60A 5DYMA 2F5FA 4EW7A 3LMMA 3EYIA 1QBJA 1NG6A 9ANTA 3HREA 1SAUA 3OIOA 2R5ZA 3LQQA 4UVBA 4XLNF 3MZHA 1WYBA 4HX8A 5DV5A 1R5HA 3QYBA 2X1EA 3GEZA 1P0ZA 3OL4A 2R7TA 4BD0A 2OQRA 3CCJI 1CEGA 1ZC2A 3WG7H 4OMYA 3ECOA 3W2AA 3DAVA 1QMEA 3ZG0A 5GTIC 4LCLA 1WI3A 1G4DA 4PM9A 2WKIA 4EESA 4E3IA 2P8TA 2P5LC 2WKRA 2ESHA 2Y55A 4YFMA 1Z6RA 4QD4A 2CFOA 3LAPA 1BUEA 5F5YA 2ZC7A 2VKEA 4HHDA 3PAGA 4UV9A 2FA5A 5E79C 3G73A 4GCZA 4C3JJ 1VETB 5HL6A 3VP0A 4EJVA 3KYLA 3IX3A 3GMWA 2UXNA 1TP4A 5L3EA 3L2WA 2P74A 3LO7A 4O8GA 3NHQA 1JJ8C 4AIHA 1VQKI 1WCMJ 2GJ3A 4XSXF 3EEAA 3IX8A 4EV0A 3BG3A 1QVTA 4ON0A 3BR1A 4LJZF 4HDVA 1PNEA 3D3OA 4E3JA 4B4CA 2XQZA 3S4XA 4EQIA 2ID6A 3IH3A 4DBRA 2HQRA 3UDIA 4ZTKA 4BH9A 2KOIA 2QJ7A 3P7NA 3TDUC 1LSXA 3VOZA 4EM0B 1HOMA 1YLJA 1T0FC 1HZOA 3V67A 4G7ZF 3LAJA 3MFXA 2QWSA 1H9TA 2ZB9A 4LCMA 3F3XA 4P0MA 3IP4B 2BE5F 4K2EA 1I2WA 3NWTA 3T0YA 3J81Z 4DKIA 3KLNA 2C6YA 1RNLA 3SZTA 2E2JJ 4B47A 1XSXA 4L5EA 1FP2A 1ZKJA 3PBSA 2K9MA 4KJZA 4ZDPA 1VQLI 2HOEA 2JE5A 4C2UA 3DBHB 1TL8A 2M87A 3LSHA 4GNUA 1JHFA 3CWFA 3ABTA 3FXJA 4MBKA 3GSGA 5H6RA 2DMWA 5HD3A 1PUFA 1A04A 2ZSIB 1ETOA 1RRJA 4BAYA 2HGVA 2QKPA 3RQIA 1JTGA 1PP7U 1YE9A 3G1MA 2GDNA 3HBRA 3OOUA 2EA4A 1ZH5A 1ES2A 1ZQ3P 1UG0A 3HOWJ 1YLYA 4OKPA 4LITA 1K57C 4XSZF 4HW0A 1TC3C 3SQNA 1ZG5A 5KCMA 4HQEA 5EZHA 2CQNA 4AIJA 4PKYG 2PMZN 2JKTI 3H7WB 1ZTRA 5F08A 1KVMA 1VETA 2W57A 3O3VA 1OYIA 1E25A 2ZO4A 3M8EA 4U7BA 2A3UA 4JXVA 4WK8F 1OMEA 2EA9A 2KIFA 2EX8A 3VODA 1FYMA 2CJJA 2LY1A 3CPTB 2WGVA 5A91A 4EBLA 1OCPA 1V5FA 3ZHHA 2NAZA 5JI6A 4WLAA 1S8NA 1TWHJ 4CCOA 5L2FA 3HLCA 4E04A 2QQAA 2QQ8A 4WL9A 2ZBBA 3L1PA 2EIJH 5H2FC 3CUQA 4IHWA 3T50A 4HX4A 2QHKA 4P55A 1XPBA 3CF2A 1X4PA 5E1ZB 3EQUA 2JKRM 2HR3A 4A0ZA 3NECA 1YMXA 5JLXA 4R3JA 1XB4A 3NJAA 1Z9CA 2VE8A 1RZ4A 4XT2A 1ZHFA 2XAUA 2ZXWH 1GDTA 3MQOA 1JKPC 4L9FA 3NDEA 2WWYA 4A3MJ 1MW7A 4B4XA 4GN2A 1H0MA 3PBNA 2OSUA 3GTPJ 3C4OA 3WHCA 2DMUA 3E4PA 4JXSA 2HS5A 3F1NB 2X6WA 3J7YJ 3M7GA 3WTVC 2FMYA 3M3YJ 4IZZA 1TWFJ 3Q3SA 5FKNA 1K57A 4LFUA 4JP0A 1K56A 4FH4A 5E3NA 1CK3A 3UO9A 3RDIA 2ME6A 1IO2A 3JRAA 2P81A 1P4XA 4DXCA 1IDZA 4HY8A 4K91A 4CYCA 3COAC 3V8JA 4BY1J 1FJLA 1ERMA 3L2UA 2XRNA 2HWVA 2EV0A 3BR5A 5CGSA 3RH8B 1K78B 5LGUA 2ZJ2A 4XN0A 3DCFA 3W2WA 1EH7A 1MWRA 4RBOA 1L2SA 3BR6A 2DU9A 2JUCA 5FKOA 2V7FA 4H6JA 4IUKA 4GGGA 3KSHA 2UWMA 2JUGA 2E5ZA 4CLCA 1I5QA 2IP2A 3VPRA 3GZ6A 2J9OA 1YTYA 4JGPA 4ZJ2A 3A3FA 1IYOA 5EECA 3VSKA 4L0YB 1RGYA 2XFTA 2FSWA 4UHTA 4I39A 2R7OA 4BQNA 4A12A 2QSHX 3OPLA 2J8YA 2VJJA 2GQQA 3DEWA 2NVYJ 5D4SA 1T0FA 2FNAA 1DU0A 3IHAA 1UWNX 3T1SA 3M1CA 1PUEE 3QNBA 2E71A 2R7SA 2HOAA 1TBXA 4CA0A 4Z1WA 2P0WA 5IYCJ 2Y4AA 3QYFA 2L9NA 4FISA 4Y2FA 4X6AJ 3T4JA 1GA9A 1KDWA 3T4KA 3FPWA 5J8FA 4OONA 1OTBA 2DA2A 3WU0A 4NC8A 1FOXA 3CHWP 5ICGA 1T2KA 3FKWA 3I0TA 1S6LA 3SS3A 2H94A 1D8JA 4RGUA 1KQ0A 1I1SA 4RB1A 2Z6DA 2M1BA 4LENA 5EM0A 4KZ3A 4RGXA 2KZGA 1FBQA 5EDNA 1RETA 1JKOC 2P7JA 5DTTA 4IX7A 5EV0A 4S04A 2LD5A 2EIKH 2LVSA 1SFOJ 1AKHB 4I3IA 5E8IA 3N8SA 1ETWA 4HRIA 4L0LA 2HYFA 2A49A 2QMIA 1S9HA 3ML6A 2L01A 2LTPA 3KCCA 5BPIA 3V8LA 5F1JA 3KYCB 2OUMA 3KP5A 1ZHHB 1BI1A 2OF7A 4DJAA 2R92J 2TCTA 2VOPA 3RKWA 3CD6I 1DPRA 3C18A 3LWFA 3HCYA 1EF4A 1FEXA 5DJUA
chains in the Genus database with same CATH topology
2XUBA 2RDPA 4NEED 1F4KA 2O8XA 4KYWA 2Y8HA 4AVPA 5MC7A 1QPMA 3EOIA 5J4EA 2RV8A 3DP7A 3BWLA 1MDMB 2ZMFA 1U5TA 3CITA 1YW9A 5E1WA 3IL2A 4H0EA 4Y3IA 5HDSA 5CVRA 3JAMZ 3F1PA 3D5LA 4TV7A 2DPDA 1KA8A 1F5TA 4Q47A 2NUTC 3J80K 3WGHA 2JT1A 1T1BA 1E2XA 3ABUA 1GSWA 4RS8A 3KSFA 1B59A 2CMNA 4LK0F 4B09A 4L18B 2OWJA 4CLCC 1ON2A 3TE8A 1DP7P 3KYQA 1KOUA 1V3FA 4HP4A 2K4JA 1OYYA 2QYBA 3NOTC 1SD4A 1IN6A 2W24A 3T4OA 2P08A 3FM3A 3TJZC 4B93A 3F1PB 1HKQA 1TW3A 3IS2A 2K27A 4U0YA 3NOPC 1W63M 4Y15A 2PEXA 3M9AA 4WXCA 3LA2A 2XIGA 3CJNA 1W7PD 3R0AA 4I02A 4Q0HA 4RB2C 3DBAA 2XAQA 1IFQA 3MWMA 3T4LA 5DD4A 2D2WA 2JTVA 3EGDC 1EH6A 3SW1A 3DF8A 1XMKA 2VBWA 2AXLA 5HLHA 2VGLS 3RYPA 1BI3A 2IT0A 2M7UA 3V7CA 3P9IA 1DDNA 2V0WA 2PD8A 5A2QZ 4Q4ZF 1TNSA 1IZ1A 4WN5A 1UHMA 3ZYTA 2F5EA 4ZYDA 1NHAA 1GSXA 2JHEA 1YQAA 4MDZA 1R1VA 3ERED 2B02A 4GXOA 2RN7A 2VBYA 2NS0A 5G4YA 3E6CC 2RNJA 2JRTA 4LB6B 2VEAA 1P9WA 1W63Q 3VB2A 4ENKA 1UCRA 1ZRDA 1WKMA 4MEYF 1J5YA 3MQQA 3GO5A 4II7A 3PBRA 4IUHA 2EFWA 3BWGA 5EEGA 1GHCA 1N9LA 2A24A 5HSQA 3R4KA 3BJOA 4KFCA 4KNYA 2W84A 3B33A 5BPDA 4HIAA 1F9IA 3LICA 3LR0A 2EB7A 3F23A 5BOXA 5FD5A 3U2RA 5HWTA 4AFIA 3O2PE 3I4PA 1XSDA 1S66L 4KICA 2FU4A 3C1DA 2M30A 4UUVA 4OOIA 1SMTA 5DCMA 3U9GA 5LRSA 4HJ4A 5D5WB 5K5BA 1BI0A 3CUQC 2WKQA 2OD5A 2TDXA 5I5LA 4HQMA 4P9FA 3K1MA 3LQRA 2W0NA 4BHPA 2ZXJA 2HTSA 5AVEA 2GWRA 1JXSA 2FOKA 3KP7A 1P9RA