3MQ0A

Crystal structure of agobacterium tumefaciens repressor blcr
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
251
structure length
243
Chain Sequence
SQISDTVPALRRAVRILDLVAGSPRDLTAAELTRFLDLPSAHGLLAVMTELDLLARSADGTLRIGPHSLRWANGFLSHLDIVSTFNDHLAQRHDLDPYTVTLTVREGGEVVYIGCRNHTFRIGMRLPAPFTATGKILLSDLGPGELRMLFSQFPQPLTSRSVAGLSQLEEELALTRARGYSIDDGQIREGMLCIGAAIRDYSGAASAGIAISLIRSEASDEKIAYLGEELRTTANALSEKLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional repressor of the blcABC operon
publication title The Agrobacterium tumefaciens Transcription Factor BlcR Is Regulated via Oligomerization.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Transcription repressor
total genus 76
structure length 243
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
A PF09339 HTH_IclR IclR helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mq0A01
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mq0A02
2FBKA 1R1VA 2F5EA 3BJOA 1U5TB 2VE8A 2QWWA 3V8LA 3SXYA 5A2QK 3N4MA 3QAHA 2ISYA 2FNPA 3ZP5A 2M7VA 2F5CA 5L8MA 3TOAA 3RKXA 4WXHA 2EA4A 3CI6A 2GXGA 2F5DA 3NEUA 4JQFA 3U9GA 1J9IA 2VKSA 2XKPA 1YW8A 1ZAOA 4UHTA 2XAQA 4TV7A 1BC8C 2ADUA 1LVAA 2Q2EA 5K1YA 3C1DA 1P92A 3DV8A 5AIQA 4HW0A 5L3FA 4M72A 2EK5A 3SQNA 5JHUA 4IPAA 3IRRA 1YO5C 2H27A 1OKRA 4YNRA 3F72A 2L02A 3JSPA 4G7OF 2UXXA 5DUKA 4I0AA 2VE9A 2GA2A 2W24A 2AXLA 1RZ4A 2H09A 5C5KA 4ENJA 1ZGAA 3EDPA 4FOFA 3MZYA 3JAMZ 2K86A 5E1WA 2LDUA 4RGSA 2MC3A 4BQAA 1L3LA 4MTDA 1EV7A 4DNCA 2LNBA 3TQNA 4L5IA 1YLFA 1HW1A 5HL6A 1XN7A 1SMYF 4OOIA 4ZZDA 1TD5A 4JK1X 2RC4A 2CW0F 1XMAA 4YOFA 2HFHA 2XRNA 2NNYA 3I71A 1JHFA 3LAPA 4M73A 3ZMTA 4CHUA 4YFXF 2ZFWA 2HZTA 2L4AA 3P9KA 1K78A 2FQ3A 4L18B 3EYYA 1BM9A 5DD4A 3MQ0A 4XLNF 3TDUC 3T5XA 5JVTA 1OYIA 3ECHA 2F2EA 2OQRA 3REOA 4AIKA 3L2CA 4CICA 1IF1A 1UB9A 2ELHA 3ROUA 5HLHA 4O8GA 5HPIA 4ZYGA 2DBBA 4M71A 2GZWA 3ML6A 5FO5A 1U8RA 1MD0A 2DK5A 3E5QA 1OPCA 4P9UA 3WTUC 4I7HA 1ZN2A 4R8HA 4O5VA 3MWMA 1XMKA 3LSTA 3BJ6A 2Z99A 4RB1A 2ISZA 3DF8A 2UZKA 2P5LC 2V9VA 3I59A 4ZZLA 4DMZA 2K7LA 1G3SA 1HSTA 3QU3A 1S3JA 5AJGA 4G6QA 2YU3A 5CVUA 3COAC 4A5NA 3AAFA 2ZMEB 3KSGA 3D0SA 1R1TA 3K9TA 1HQCA 1MJAA 1T98A 3HIFA 1V4RA 2RDPA 2ZNZA 2YR2A 4Y3IA 1WWXA 3RIRA 2VBWA 3E98A 2WC2A 4IVNA 4IUKA 2O99A 1TNTA 2CWEA 1SFEA 4L5JA 3BWGA 1ZLKA 1J59A 1HKSA 1I5ZA 3IRQA 4LFUA 3FMSA 1KGSA 4OIRF 2FXAA 4XSXF 2W1TA 3WTZA 1VTNC 1TQIA 4ZH4F 5J8FA 1MZBA 3WGGA 4AIHA 2FF4A 3DEUA 1H0MA 4CDGA 3MFKA 3HRUA 1WRJA 4ZRRA 2JPCA 4EJUA 2GXBA 2L4MA 4GCVA 1D3YA 4KICA 3LFVA 4Y17A 4O6JA 3FZVA 2F5FA 4G8XA 4L0YB 2P4WA 4KIGA 3CDHA 2GQQA 4BHCA 1NHAA 4M74A 4ESFA 2HGCA 3KE2A 3O2PE 3C7JA 4PZJA 4Q47A 4G3WA 4Q0IA 1IRFA 1IXSB 3F8MA 4WX9A 3WTXC 3KP3A 1SFXA 1TW2A 2VC1A 5FB2A 3NRVA 1XSVA 2PLYA 1O3RA 1HKTA 3PQKA 4YFKF 4RAZA 2MH2A 4EJOA 2G7UA 1YSQA 2IPQX 2XKOA 2ZO4A 5ICEA 2L3DA 2L01A 2QYOA 2QENA 4EM1A 4E70A 4ZYDA 2HOEA 3OV8A 2XV4S 1REPC 2RQPA 4GGGA 1YG2A 2HR3A 1S6LA 5E18F 5F6FA 4PAUA 2BBYA 3WODF 2Z5UA 1QZZA 5HS7A 4BHPA 3QPTA 4WXCA 2M8EA 3U2RA 3E6DA 1F5TA 1QZYA 1IAWA 2GIVA 5D8KB 3KP4A 1YTYA 2XAHA 3F8NA 2Y79A 2Y75A 5ERIA 2W3DA 3E0YA 1YKDA 2EB7A 1U5TC 1F4KA 4EJWA 4O3MA 3BP8A 1B9MA 1G3WA 2FA5A 5IT3A 3IHUA 4HA8A 1P4AA 2E1NA 3RPUA 4Y13A 5LRSA 3NOUC 4UUVA 1FP2A 3N97A 3BJNA 1T6SA 3I59B 1U2WA 2Y0MA 3ELKA 5FFXA 3C18A 4U88A 3FM5A 3FWEA 3O5YA 4HZFA 1TF1A 4I2OA 1KA8A 2XSSA 5FD5A 4M6XA 1T2KA 3NOTC 5H20A 1LNWA 2A3SA 4R70A 1FNNA 2LKPA 1WKMA 4CQHA 5BQTA 3G6OA 4BXUA 5IT9K 2IVMA 3CJNA 3WU0A 3QP5A 4LK0F 3QPHA 1MC0A 5HOOA 2IT0A 3C2WA 1HBXG 2HTJA 4IUHA 1XSXA 3ZN1A 1IXRC 2XAFA 3VV4A 3SZTA 2H94A 4XLPF 1FT9A 4ASNA 1XGMA 4P5OA 5FLXK 1XD7A 2UXNA 4UNOA 2W1TB 5ICFA 2EV6A 1BOAA 2K4BA 2R7FA 2O9BA 4QLCU 3ZMUA 3J80K 1LDJA 4M9ZA 2KIFA 2X4HA 3B02A 3F8FA 5LGUA 4EJVA 3LQQA 1XCVA 1XGOA 3ZMVA 2QM3A 3JSOA 4KFCA 4M9SA 3GUDA 2O9CA 2M1BA 2ZKZA 1D8JA 3EETA 3LFKA 2W57A 3MEXA 5BMZA 1WI9A 4B8XA 3MF0A 3J7AO 3RPQA 5D6EA 3E6CC 2PQ8A 4YIFA 1LDKB 3MZHA 4I0BA 1FSEA 5LEKA 2PI0A 2Q8KA 1S7OA 4IRHA 4F7ZA 4FX4A 2L54A 2X0LA 2COMA 4RB2C 2KLIA 3WU1B 4OIQF 1MJBA 4G3VA 1XGSA 5E1ZB 4HQEA 2XUBA 4A12A 4IHTA 4GYGA 2YSRA 3T8RA 2QQ9A 1B4AA 2IJLA 2MLGA 1F1ZA 4Q48A 4IRGA 1MDMA 1USSA 4LLLA 1QBJA 4FHTA 4KMUX 3RKYA 2OZUA 1W4MA 3TO6A 4LMYA 1G6NA 3HTUA 2FE3A 1KU3A 3FF5A 4L9VA 2HKOA 4S04A 2XAJA 3E3VA 3J81Z 2Z33A 2CGPA 2K4JA 1DPRA 2A5YB 2NRAC 3GFMA 4OMZA 3EEAA 2OAZA 4ETZA 3I0TA 3ZQ5A 4LLNA 3FXQA 1KQ8A 3L9FA 1RIOH 4UVCA 4A6DA 2OD5A 2E1CA 3IKVA 2QUFA 4HX8A 5TJJA 2W25A 1FYKA 5CYVA 5KK1A 1AOYA 2C6YA 3KETA 2VT2A 5KVRA 3E6BA 2VT3A 2KOIA 1I1SA 5CVIA 3W2ZA 4UXNA 1B9NA 1ZH5A 1LB2A 5L3DA 2CO5A 3HHGA 4M6YA 1R23A 2G7HA 4OINF 1G3TA 3V7SA 5HDGA 4HV6A 4HOBA 1MJ9A 3S7NA 3V8KA 3KCCA 3BOQA 2K02A 3M7GA 3EUHA 4I98B 1EH6A 2O3FA 1T0FA 2HYFA 2CQKA 5ILSA 3GFJA 3BJAA 2VONA 4Y15A 2LF7A 3LA3A 2RGVA 2V1XA 1SFUA 3RYRA 3JTGA 1Z7UA 5DCFA 3MAJA 5DDGA 3RI4A 1G3YA 1IZ1A 3P9CA 1S8NA 5CVVA 1ON2A 1ONVA 5L3EA 3EQLF 2E7WA 5ILUA 1W7PB 2M5WA 4AIJA 4KA4A 3ZN0A 4PGGA 3L7WA 4L9TA 1XDSA 5LHHA 1ZREA 1BI1A 3HTSB 1PP7U 2OU2A 1IN5A 1U78A 1TQMA 4N9IA 1IW7F 1ZHFA 2DFIA 3F8BA 3V4GA 1STZA 5LGNA 3WTYC 3IC7A 4R6LA 3H92A 2FBIA 5A2QZ 2HGVA 5F64A 3TDZC 4A0YA 2GA1A 4IJAA 2IRFG 5DFYA 4NQWA 3TGNA 5D5VB 3FMRA 4ON0A 4EVIA 4KYWA 3LA7A 1FP1D 2MLKA 3CUQA 1EH8A 1J5YA 3RTRA 4D0PA 3T1BA 1RNLA 3D3OA 4PCQA 5D5XB 2FU4A 1FYLA 1ON1A 2HDCA 4ENMA 4JBAA 4ENKA 3S7PA 1PUEE 3OOVA 4LG0A 4YG2F 4UV8A 1Z6TA 5HS8A 1GVJA 1B59A 3F21A 5EEHA 5D8LB 1YS7A 5HDKA 4ETSA 1U6GA 2KIMA 3PQJA 1T39A 3T8TA 4HLXA 5BPDA 3E97A 3ULQB 4KIBA 2HEOA 2GWRA 3R61A 2W1RA 4N0BA 1R5GA 2XHKA 2MH9A 5LBRA 3HRSA 1P4WA 2Y48A 1JXSA 1K79A 1YYVA 3EYIA 4PDKA 1KYZA 5LEJA 1BBYA 1L0OC 5HLIA 2TDXA 2R7DA 2STWA 4LB6B 2HYGD 2O9AA 5EEGA 4FX0A 3I58A 5JI6A 1GHCA 1IN4A 3KP2A 1U3EM 3V8JA 3T0YA 1LEAA 2EFNA 1QQIA 4NB5A 3ZQ7A 4WCGA 2XASA 2ETHA 1FSHA 2BYVE 2A6EF 3WGIA 4EM0B 4A5MA 3ISPA 5BPIA 3DXJF 2BGCA 4G9YA 1HW2A 2PBIA 4EUVA 1YW7A 2P6SA 1V3FA 4U7DA 1K6OA 3DPTA 3VB2A 2IA0A 1TW3A 4LLGF 3GLXA 3S2WA 5J6XA 2DQRA 3L00A 3K0LA 3WTWC 2EFWA 1QNTA 3K2NA 4KT5C 3NOPC 1JE8A 4L9NA 1XCBA 5LLQA 2PJPA 2JT1A 2VBZA 1TTYA 5TRDA 4LB5A 2A61A 3HRTA 3S7QA 2QQAA 2M7UA 2EV5A 4DQ2A 4I01A 1Y0UA 4CXFA 2LB5A 4EQQA 2EFPA 1K78B 3HCYA 4U0WA 3D5LA 3ZMZA 3CO7C 3RYPA 5E20A 1RUOA 2QYBA 2K2NA 4GXOA 2P8TA 4I09A 2EJRA 2HS5A 1Z1DA 4HF1A 1U5TA 2XIGA 2FMLA 2VZWA 1F9NA 3TRCA 1ZRCA 5E1XA 5DCMA 3OBFA 1QGPA 4P96A 1MGTA 2IA1A 2VN2A 4CGZA 3FXRA 4IF4A 3TOBA 2XAGA 3VEPA 1SD6A 3E5UA 4Q4ZF 4Z2YA 3GW2A 1YQAA 2H6BA 3GF2A 3V7CA 2J5OA 3I4PA 2P7VB 4EU0A 4IXAA 1DP7P 2ZXJA 3CUQB 3GYHX 3M8EA 2DTRA 1H9TA 2Z3YA 4LD5A 1FPQA 5DUIA 3IKTA 1PDNC 3HOTA 1J0RA 4FT8A 4H0EA 3BZ6A 4WXDA 1O57A 4WK8F 2W3EA 4UVBA 3R6SA 2GX5A 4A2UA 1HW5A 5CVRA 4KN7X 2O0YA 4CYDA 4BYYA 1USTA 1R22A 2OOLA 2W85A 3RJPA 2NAZA 5E8GA 5HPFA 2AS5F 4EJTA 5ILVA 1S7AA 1Z91A 4OU0A 4ETXA 2K27A 3J81K 6PAXA 4PGHA 5JR3A 1ULYA 3FM3A 2DLLA 2JSCA 2O61A 4KDPA 1IRGA 2DU9A 4G7ZF 2KIUA 3F8CA 3M1EA 2FOKA 1WSUA 1CF7A 2O03A 3I5UA 3H3UA 2DK8A 2EA2A 3FHZA 3DQVC 2M45A 1P4XA 2D1HA 1ZRDA 3HRMA 4LRZE 4KUMA 2QZ8A 3BPXA 1IN8A 1YSPA 4KIFA 5HS9A 3IL2A 1MKMA 1DDNA 3KSHA 3DPLC 4U0YA 3JAMK 2QVOA 5ICGA 4RB3C 3C3WA 1X3UA 4UV9A 3NHQA 1D5VA 2LB9A 3LQRA 5HLGA 1FOKA 3K1PA 2O6GE 4Y5FA 3DBAA 4Q5SF 2D1VA 2DT5A 4XRFA 3WTTC 1OR7A 4ESBA 1RUNA 5DV5A 4KNYA 1IUYA 4XSZF 2HWVA 4MQVA 3G3ZA 1TLHB 5HSQA 5HVQC 2ACJA 3V7RA 1SMTA 3TO7A 2RVCA 2KKOA 2HQRA 4P9FA 4IRIA 2NS0A 2W3HA 1WQ2A 4GLQA 2PFBA 2WTEA 2MBFA 1HXDA 1SD7A 4LGWA 1ZYRF 4R1HA 4RAYA 4GO1A 3P7NA 3JTHA 1SD4A 4R79A 3GZ6A 2DPDA 3KSIA 4HX4A 1O7LA 1BI2A 3W6JB 1ZRFA 1R00A 2ZMEA 1KU2A 4GYIA 3K1NA 4CZZA 1B1BA 4LRYC 1YIOA 5J8CA 4QWQA 4HLYA 4OIOF 2FNAA 1O7FA 2IP2A 4G6DA 1LDDA 2STTA 1FC3A 1LEBA 1XSDA 2VOOA 3IWFA 4HDVA 5DCMB 4U0VA 5ED4A 3KEQA 2KRFA 4AVPA 5HDNA 1E17A 3K1MA 1BIAA 1ODDA 2QQBA 5AIPA 4EMSA 2HKXA 2A07F 4HF0A 4MEYF 1C0WA 2LF8A 2YX7A 5H6QA 4RGRA 1KQ0A 1BC7C 5IT9Z 1LQ1A 3FXUA 4HYEA 2Z9OA 1J2XA 1XDUA 2H6CA 2W84A 5D5UB 4BHBA 3SZPA 3VFZA 3CITA 1FBQA 5FLXZ 2XGXA 2KJCA 1ZG1A 2MD5A 3Q5FA 1YFHA 4MTEA 3J80Z 1JHHA 2ZCWA 1FWZA 1ZG3A 4YFNF 1IN7A 4MN7A 3GVAA 4AWXB 5K5OA 5D6FA 3F6VA 2DPUA 4HQMA 3ZMSA 2JZYA 4MMNA 1OYWA 1OMIA 4U7BA 2IA2A 3SHFA 2D2WA 3CO6C 2HTSA 1QO0D 2YX4A 3QOPA 1FBUA 3KFWX 3CUOA 1LJ9A 2FBHA 2V1UA 2EFOA 2DAOA 1W5TA 2WWYA 4BNCA 1R7JA 1ZGJA 1UCRA 5L3CA 3KO6A 4KN4X 2BEOA 3CLOA 4MDZA 3W6KB 4A0ZA 1CF7B 3P9IA 2OZ6A 5LHGA 5LRRA 4ESJA 3DFGA 3QP6A 3NQOA 2V1DA 2PEXA 4A0XA 4I02A 2DQLA 4G3KA 4MNUA 3HHHA 1FZPB 2LSOA 1R36A 5K5BA 1DPUA 1HKQA 2P5VA 3M9AA 2CSOA 3U1DA 2YPRA 4IJGA 2UWMA 3HSFA 5CLSA 1D8KA 3K69A 3KSFA 1SAXA 1R1UA 2OQGA 3IWZA 2VODA 2VBYA 4XBFA 1O3SA 2V79A 3HYIA 2P5KA 3ZPLA 5CVJA 1TNSA 2FRHA 4K2EA 2R3SA 5DYMA 2VC0A 3FX3A 2M87A 2MA3A 1KQ9A 3MCZA 3GFLA 3M8FA 5H6RA 4RGUA 3HOSA 4MQ9F 4HAMA 1JGSA 1XB4A 1AWCA 2RNJA 5E17F 4BAYA 4MEXF 4EV0A 5FD6A 5DD8A 1F5MA 3KLOA 1MDMB 2WV0A 2O8XA 4AD9A 4BH9A 2RN7A 2DO7A 4RGXA 3PFIA 2ESNA 3F23A 1FYMA 1ZG5A 3I53A 3CUQC 2M30A 4OIPF 4Q0HA 1Q1HA 1T38A 3IBJA 5FGMA 1P2FA 4DN0A 4E04A 3MMHA 2ZBKA 5K5RA 2BV6A 2DI3A 1TBXA 4L0ZB 3QU6A 1GXQA 4YIIA 1KU9A 2IW5A 4QPRA 2BE5F 2PN6A 1KU7A 4ZYHA 2VJWA 1BN5A 3GO5A 2QBYA 2PG4A 5L3GA 3IBRA 2FEZA 1W5SA 3BPVA 5BS6A 3WGHA 4MCWA 4HBLA 2ZJ2A 3LWFA 1H9GA 1R5HA 2P6TA 4NHJA 1XGNA 2FSWA 1R58A 1VHMA 2VEAA 1EH7A 3L09A 5D5WB 2Q0OA 4LJZF 1G4DA 2A68F 2FMYA 4IHSA 1A04A 1IN6A 3K2ZA 4RS8A 1J7KA 3R4KA 2CFXA 3WTVC 3KEOA 1QPMA 2JPBA 2JTVA 4RB0A 4WWCA 2EWNA 2VOPA 4N9HA 2XVCA 5FFZA 3DKWA 2DW4A 3KP5A 1UHMA 1Z6RA 2JRTA 3GWZA 2PMUA 3ERED 3E5XA 3GFIA 4A6EA 3F22A 2V6CA 1BI3A 5LHIA 1ZARA 1S29A 1RI7A 4HV5A 2NYXA 3WTSC 1BJAA 2J5PA 2EV0A 3HUGA 2OA4A 5DFXA 1B6AA 3RFBA 4CO8A 3TO9A 2NNNA 2RV8A 3G73A 3VODA 4MHGA 1HSJA 4EGYA 2W3GA 1FX7A 1BIBA 4EGZA 1UHWA 4LRXC 3KP7A 5JFRA 3Q9VA 3LAJA 3WG9A 3BROA 3GX4X 3DP7A 3VOEA 4WF2A 1P6RA 2A69F 4Z1WA 2G9WA 3CTAA 4O0PA 2ZMFA 1UFMA 3KZYA 3B73A 1ZLJA 2ESHA 1FBSA 1I1GA 3O6BB 5LBQA 4OMYA 2VBXA 4KMFA 1J75A 3I64A 5CJ9A 2E7XA 3WE3A 3O3KA 4LG0B 1Z9CA 1I27A 3H3ZA 3R0AA 1OYYA 5BOXA 2B18A 5D4RA 5E8IA 4M9XA 4HDUA 2CG4A 3Q9SA 3GZ5A 5I5LA 1YW9A 4LK1F 3ZMDA 4HF2A 2CYYA 4O01A 2D45A 3FMQA 1O3QA 1K7AA 5AONA 5ICCA 5LGTA 5F1RA 1FY7A 2RKHA 4MGRA 2EFQA 5L3BA 1GXPA 3HSRA 3GXOA 4G7HF 2PMHA 2GAUA 1CGPA 4L9JA 1TQPA 4ME4A 1BI0A 5DEQA 4BWIA 4S05A 4HX7A 2XROA 1E2XA 2HQNA 3KLNA 3LA2A 4ENNA 1W7PA 2QBYB 1O3TA 1FLIA 3F3XA 3F6OA 3JW4A 1IXCA 5D4SA 3GEZA 3SFZA 3S7OA 1SD5A 1DUXC 2OBPA 1PP8F 4UVAA 3TKYA 1YS6A 2W3FA 1I6XA 3BDDA 4EM2A 3KP6A 4Y2FA 2QLZA 3RKWA 1W7PD 4P55A 4Q0JA 2A6HF 3R60A 3BY6A 4ZYEA 2VXZA 3RDIA 2K31A 4G94A 3WE2A 2ZNYA 1Z05A 3E6MA 4GW9A 3QRFF 5K5QA 1ZTUA 2Y8HA 3I54A 3ABUA 4RQ9A 1KYWA 2B0LA 3ECOA 2KJBA 3R0JA 3KZZA 3HSEA 4B09A 3OOPA 3ABTA 2P7CB
chains in the Genus database with same CATH superfamily
2FBKA 2Y4AA 1R1VA 3H3VK 3UE6A 3M3YJ 3AG1H 4R3JA 2QWSA 3EUKL 3OYAA 2F5EA 2IS1A 2DFEA 4LCMA 2R9XA 3PBTA 3BJOA 5FKLA 2WY7Q 4A3JJ 1U5TB 3M6BA 2VE8A 2QWWA 1V55H 3V8LA 2CV0A 2HXOA 1IV8A 3SXYA 4RA2A 5A2QK 2P08A 3JRHA 4FTXA 5TGFA 3N4MA 3QAHA 2ISYA 3TEDA 2PYPA 4JX5A 4A3MJ 2FNPA 2V0WA 4GCZA 3CZDA 4BL3A 3ZP5A 2M7VA 3S32A 4ZTFA 2UWXA 2R93J 3WHBA 1ZGWA 1CI9A 3HL2A 2HJ9C 1ORKA 4ZJ2A 2F5CA 1T18A 5L8MA 3TOAA 3RKXA 2XA7S 3KX0X 4WXHA 2EA4A 4NC8A 4HP9A 3CI6A 2GXGA 2F5DA 2I10A 4AFIA 3NEUA 4JQFA 3U9GA 4HRIA 5IP7J 4NXEA 5FI7A 3SZGA 1J9IA 2VKSA 2XKPA 1YW8A 1ZAOA 2X48A 4UHTA 5IP9J 2XAQA 2DN0A 2QSFX 1AA7A 3ONQA 3OCNA 2JHEA 3B3XA 4S2IA 4TV7A 1BC8C 2ADUA 4IZZA 1LVAA 5IP6A 2Q2EA 2H10A 3A3EA 4PPRA 1ZG4A 2VXDA 3FK7A 3C1DA 5K1YA 2Y2OA 3HLDA 1P92A 1PWGA 3DV8A 5AIQA 4QIWN 3B42A 4HW0A 3FXJA 5L3FA 2ZM8A 4FE4A 1FMWA 4M72A 2EK5A 3SQNA 2M4GA 4IPAA 2FUG2 4XN0A 5JHUA 3IRRA 1YO5C 2H27A 1OKRA 1BYWA 2PJRA 4BBSJ 5J3LA 2Y2JA 3HLFA 1BUEA 4YNRA 2NUTC 3F72A 2NVXJ 3WS4A 3GTQJ 2DMTA 3C2BA 2L02A 3G4SI 2XF5A 3C38A 2ZXHA 4LG3A 2UXXA 5E3MA 3Q0WA 3JSPA 5DUKA 4I0AA 3VYTB 2VE9A 4IKFA 1KE0A 2GA2A 2XF6A 2WV1A 1UWPX 4WEKA 2KMUA 2RNGA 2W24A 3OYFA 1P97A 5AQBA 2AXLA 3UB6A 1RZ4A 2H09A 3PR6A 3O88A 1SEUA 4I39A 4ENJA 5C5KA 4BENA 2BXYA 3QYEA 2DA6A 2R7VA 2DJNA 2PD7A 1ZGAA 2P0WA 1Z7LA 2ECCA 3EDPA 3MMYB 4R0QA 5JHFA 2R5YA 5HDDA 3AG2H 1PFLA 4BEHA 3ITBA 4Y33A 3H0DA 4FOFA 3MZYA 3JAMZ 3OS1A 2K86A 5E1WA 1QZEA 3IX4A 2YKFA 3ZHHA 4E3KA 2LDUA 2BY1A 2CQQA 4QSHA 4EEUA 3M6HA 3K6GA 1V5GA 2E1MB 3P01A 1LE8B 4RGSA 2MC3A 1VQKI 4BQAA 4NG2A 3DTMA 3VYRB 4MTDA 4D5CA 1L3LA 1EV7A 3E2KA 4OH0A 1OTIA 1XPXA 4DNCA 1LI9A 1W79A 4GFBA 4J19A 5GP9A 3K3DA 4EQIA 2LNBA 3TQNA 4B44A 4L5IA 1MWUA 1LL8A 1YLFA 1HW1A 1MBLA 3DBRB 4QWOA 5DTTA 5HL6A 3HBLA 1XN7A 1S5LC 1SMYF 3LSGA 4OOIA 4RLQA 2KFDA 3AKZA 2QZ6A 4ZDPA 4DXCA 4ZZDA 1X19A 1TD5A 4JK1X 1E3UA 1KGGA 2RC4A 3LYXA 1W0UA 2Y59A 2CW0F 4M3GA 2LYCA 1XMAA 4YOFA 2IAIA 2HP6A 4DJAA 3GSGA 2HFHA 4HNBA 4OPQA 3JRAA 2XRNA 4S0HB 1PW1A 2WUQA 3MXSA 2M7BA 5DTDA 2NNYA 3I71A 1OCPA 3C8CA 1JHFA 3BEBA 3ZFZA 3LAPA 4M73A 3ZMTA 4CHUA 4YFXF 2L2OA 1SVOA 4N4NB 1XJ4A 1MNEA 3ZOBA 3DWZA 2ZFWA 4E6XA 1H5XA 2HZTA 2QPNA 4AC0A 2JQ7A 2L4AA 3P9KA 1K78A 2FQ3A 3CWFA 2DA1A 1IYQA 4L18B 4JXSA 4GHIB 4EERA 1FCMA 2NVYJ 3EYYA 3AGEA 1CK3A 3KYDB 4BU2A 3UE1A 1VQ9I 2Q9MA 4E7LA 1BM9A 5DD4A 2Z16A 4WL9A 4X1MA 3MQ0A 4XLNF 3I3LA 3TDUC 5BNGA 3LY4A 4H6JB 3T1SA 2K9QA 1L0DA 1DU0A 3T5XA 5JVTA 4L9EA 1OYIA 1EF4A 2HQAA 3ECHA 1JTXA 2F2EA 1VF9A 2YU9J 2IS2A 2OQRA 1BW5A 3ZGAB 4D2OA 1WJFA 3REOA 1ZC2A 2KQRA 2ACGA 4BY1J 3ZCOA 2X85A 4PFPA 2ZJRF 4AIKA 4WZ4A 1LKXA 1QMEA 4C75A 5FKMA 4CLCC 2L7ZA 2XEPA 3L2CA 4CICA 1IF1A 1UB9A 1GV2A 2ELHA 3ROUA 1P9QC 2QQ8A 4NUBA 4GDBA 5F1GA 1X1CA 5HLHA 3S1MJ 2ZC5B 4P6ZS 4O8GA 2Y2GA 4P6BA 5HPIA 1XJ2A 3F1PA 2BHZA 3A1YA 4II3A 1TT5B 2DBBA 4M71A 4CSWA 4ZYGA 4UUSA 3UNWA 2D02A 4ITVA 2GZWA 3AL0B 2ZOHA 3D9YA 4ZDLA 4RYEA 2ID6A 1U0JA 2LOOA 1HD8A 3H0GJ 1SFKA 2KP6A 5GTIC 3K4MA 2HOSA 3ML6A 2JA5J 2K40A 5FO5A 1IYOA 1U8RA 2PDRA 1MD0A 5GLBA 1U8BA 5B5EC 2DDAA 3D72A 2DK5A 3E5QA 1OPCA 3FYZA 3MBZA 1MMNA 1MZUA 1CEFA 4P9UA 3WTUC 1D7EA 2KDKA 4KZ5A 3BR2A 1FR6A 5F0CA 4I7HA 4BE2A 2V9AA 2DYRH 4X6AJ 2VJ4A 2HV1A 3GECA 2MFZA 4YIRX 4MLOA 1QPIA 1ZN2A 1MPLA 1NY0A 4L0LA 1TWAJ 5EVEA 4C9YA 4R8HA 4O5VA 3MWMA 1XMKA 3LSTA 1D0ZA 3A0RA 4ESPA 2M9HA 1TS8A 2XFSA 3BJ6A 2Z99A 5EECA 3KIOA 4RB1A 3DF8A 3LFUA 2UZKA 2ISZA 3IS2B 5CEDA 2P5LC 1PYVA 2V9VA 3I59A 4ZZLA 2AQEA 1FCNA 2EA9A 4DMZA 5F1JA 5FDHA 2K7LA 1G3SA 5A8BA 3Q7VA 1HSTA 3QU3A 4XORA 3BWLA 3OYJA 1S3JA 1WJCA 3BTLA 4C30A 2OCEA 1SKFA 2Z2MB 3DTEA 3H1CA 4CA0A 5AJGA 4BMWA 4G6QA 3OY9A 3GTPJ 2YU3A 5CVUA 3L2QA 1HCRA 5FASA 2VLAA 3COAC 5TGTA 2V1AA 3PSIA 5J47A 2QF7A 4A5NA 1IV6A 3AAFA 2JA2A 2MABA 5JYOA 2ZMEB 3KSGA 2QMIA 3D0SA 1HOMA 1R1TA 1PWDA 3K9TA 2Y2KA 1VQLI 1HQCA 1MJAA 4OONA 1T98A 3HIFA 3JVVA 1V4RA 2EX9A 1DQUA 5E2GA 2RDPA 2VV7A 2ZNZA 4A3GJ 4S2LA 5J40A 2YR2A 1VETA 3N4IA 4Y3IA 1WWXA 4YRVA 3RIRA 4BBRJ 2DMUA 5GL9A 3NARA 1W1WE 2VBWA 3E98A 1TWCJ 2WC2A 1IYPA 4IVNA 4IUKA 1ODVA 3FBNB 1ACIA 3PO2J 4JXVA 4RBOA 1K4SA 2O99A 1TNTA 1X1DA 3F0CA 3HUOA 2EFUA 1T56A 2PU4A 3KYEA 2CWEA 1SFEA 5J4YA 4GNUA 2ZQDA 1NK2P 4L5JA 1Y56A 3LSRA 4UQIS 3BWGA 1K6YA 3B6CA 3OWTA 3CMYA 1ESUA 1ZLKA 4XXRA 1J59A 3BM6A 3IH4A 5M1AA 3U4LP 1JJ8C 5F04A 1HKSA 1I5ZA 3IRQA 2QA4I 3B6AA 3GTLJ 2VKVA 3T1RA 3GVBA 4LFUA 4B93A 4EXOA 2BXZA 1KGSA 3FMSA 4BXXJ 1RGYA 2V2FF 4OIRF 2FXAA 4XSXF 2W1TA 2V8FA 2I5UA 3WTZA 3G1OA 1UWNX 1VTNC 1YRNB 1RKTA 1TQIA 4ZH4F 5J8FA 5HX9A 1MZBA 3WGGA 4AIHA 2LP0A 1OCTC 2FF4A 3DEUA 5J3WA 2RREA 1OJLA 2JWTA 1H0MA 2BOLA 4CDGA 3MFKA 2PR6A 2R7RA 2OSUA 3FKIJ 1HC8A 2OTJI 4FUWA 3IQAA 2PJRB 5FL3A 3HRUA 1WRJA 4ZRRA 4FETA 2JPCA 4MBKA 4B3AA 5EPHA 4EJUA 1MBFA 1AWIA 4B4CA 5E2FA 2GXBA 2L4MA 3OPRA 5KSCA 2JK3A 2Y0SA 4DDSA 4GCVA 4S2MA 1D3YA 5M5YJ 3CF2A 2PR5A 1OCRH 4F93B 4KICA 3LCEA 3ISGA 4M4XA 3LFVA 4Y17A 5E79C 4O6JA 5U47A 5C4XJ 3FZVA 2F5FA 1WVRA 2H28A 4G8XA 3JRBA 4L0YB 3NBLA 2P4WA 1TC3C 4KIGA 1IKIA 2M8GX 3CDHA 1DJAA 3JRCA 2R5YB 2GQQA 3K4NA 4BHCA 3CMZA 1BJZA 3LNQA 3NJAA 1NHAA 1F9IA 3FXMA 3HLBA 4M74A 4ESFA 3LR5A 4IO9F 2HGCA 1MMAA 3KE2A 1IO2A 3O2PE 3C7JA 3A02A 2HPIA 1GHMA 4PZJA 4Q47A 4G3WA 1MNMC 3NI9A 4Q0IA 3CHWP 1IRFA 1IXSB 3L2WA 3F1NA 1T33A 3F8MA 1GSXA 4BQOA 2HOAA 2WGWA 1B72A 4WX9A 4F52A 2Y91A 3KP3A 3WTXC 1SFXA 1DP8A 3LICA 1TW2A 2VC1A 5FB2A 3NRVA 1XSVA 2PLYA 1O3RA 4I99C 2IGOA 1BL0A 3HJIA 2ZSHB 3W2AA 4A3FJ 4MBHA 3VPRA 3PQKA 2V1BA 3OPPA 4AIDA 3NDEA 3A0HC 3OYMA 1E4DA 3BG7A 4YFKF 2HXIA 4RAZA 3IV5A 1FIKA 1RESA 2MH2A 4ID4A 2R4GA 4EJOA 2WK0A 2BVLA 3HLWA 2G7UA 2ZL1B 1YSQA 3SH9A 3GR2A 2WAQA 2IPQX 2XKOA 2ZO4A 2A49A 5ICEA 2L3DA 1MH3A 2KHMA 1Q2QA 3UKGA 2L01A 1ZKGA 2QYOA 3C7VA 2QENA 4EM1A 3CESA 2QKLB 2JVGA 4Z6YA 3DWKA 3JREA 2QJ7A 4E70A 1HLUP 4ZYDA 4CH7A 4KZ9A 3HUMA 3VOLA 2HOEA 3HLGA 3OOUA 2QHKA 3OV8A 2DOFA 2XV4S 4OOYA 5DF9A 3UMDA 1REPC 2VQGA 3VYSB 2RQPA 4GGGA 3UR3C 1YG2A 2XPUA 1P0ZA 2HR3A 1S6LA 4PUSA 1VQ7I 2KDOA 5EZGA 5E18F 2GOMA 5K7HA 1LPQA 4NC6A 5F6FA 4PAUA 4EETB 1P7JA 3PM1A 4LV0A 3DW0A 3HM5A 4X1EA 3CCRI 4OLGA 3PNVA 3CCMI 2BBYA 2Z2SB 3PNYA 1S0WA 2PYRA 3WODF 5DM6F 1OT9A 2Z5UA 1QZZA 3ZRGA 4AYBN 3C5AA 5HS7A 4BHPA 1UG0A 3QPTA 4WXCA 3HOZJ 4UA6A 2BW3A 2E19A 3LR4A 2M8EA 3U2RA 3E6DA 4BQNA 3GTGJ 2GNXA 1F5TA 4JOMA 1QZYA 1TS7A 4XLEA 3DBHB 2DA3A 3OPLA 1IAWA 5G4ZA 2GIVA 5IT5A 5KHDA 3BCBA 2CH0A 5D8KB 3SJMA 4YWZA 3IF6C 4DE1A 4XRSG 2XPVA 3KP4A 4RAFA 4UUSB 2XAHA 1YTYA 3F8NA 1CF0A 1LSWA 2WZXA 1WJDA 3WHCA 3BLSA 2FQ4A 3Q1FA 2Y79A 2Y75A 5C4JJ 2PAVP 5ERIA 2W3DA 2VUMJ 3E0YA 2TRTA 3OR1C 1XKZA 3O86A 3W2WA 1YKDA 4JGQA 2EB7A 1U5TC 1BLPA 3CUEA 1YLYA 4V2FA 4XKWA 1F4KA 1ZR4A 4EJWA 4BXFA 4O3MA 3BP8A 4CCJA 1B9MA 1G3WA 2ECBA 2FA5A 5IT3A 3CC7I 3LUQA 1S1YA 4E3MA 3I56I 3AGFA 2XSDC 2H1LA 2B9SA 2INWA 2ME0A 3IHUA 4HA8A 3QP8A 2X6XA 3GMEA 1Z3XA 3TBIA 1P4AA 4XKVA 5F1FA 4ZJ1A 4BBTA 3BY9A 2PMZN 4ZAMA 2E1NA 3RPUA 4Y13A 1R5ID 2XR0A 4W1UA 5D3OA 5GAHJ 1X1PA 5FRNA 2LKXA 5LRSA 2ZB9A 3C30A 3MD2A 3NOUC 1YLPA 4UUVA 3T12B 1FP2A 3N97A 3BJNA 3O8HA 1NZUA 3DAVA 1T6SA 3I59B 3VE3A 1K4FA 1D1AA 1U2WA 2Y0MA 3ELKA 3MKYB 3D4FA 1BSGA 5FFXA 4FSFA 1VQQA 3ESWB 3CCQI 2ZQ8A 1EJ9A 4C6YA 3C18A 4ZTJA 2J3TC 4U88A 3FM5A 4N1HA 4PJNA 2CMPA 3FWEA 3O5YA 4HZFA 2IEKA 3P09A 4WM9A 4ZC3A 3HXLA 1TF1A 4I2OA 3SH7A 1KA8A 2UV0E 3C4OA 2XSSA 4JPMA 5FD5A 2CUFA 2CUZA 3SEQA 4M6XA 1G59A 1S67L 1T2KA 1QA6A 4K91A 3S15J 4OQGA 3T4OA 2VPLA 3NOTC 5IYDJ 3JRFA 4FCYA 4OPRA 5H20A 4FTHA 1LNWA 2A3SA 4R70A 3G34A 3VWBA 4ZJ3A 1E3PA 1FNNA 3BLMA 1CQTA 2QSHX 2K3FA 4PM8A 2LKPA 1SANA 3S2HJ 1WKMA 2GM4A 1VETB 2E71A 1I2SA 4CQHA 5BQTA 2A6TA 3KEYA 5EFWA 1OJ5A 1J09A 2W82A 3BQYA 3G6OA 4BXUA 5IT9K 5FEGA 2IVMA 3CJNA 3WU0A 4BUPA 1V9YA 2V7FA 1LFUP 1OT6A 3QP5A 4LK0F 2VGLM 3OYEA 3QPHA 4XKBA 1MC0A 1VEUA 1WHUA 5HOOA 2IT0A 3C2WA 1HBXG 4HEFA 2HTJA 3QYBA 2ZQ7A 2JA8J 1LSXA 4IUHA 4L9GA 1TL8A 5HNHA 2OAQ1 3V67A 1XSXA 3ZN1A 1IXRC 2M7AA 1K56A 1Y54A 5CXWA 2XAFA 3PJRA 3VV4A 3SZTA 1K57C 2OUMA 1QVTA 2EX2A 2A24B 2H94A 2E1MC 4XLPF 1FT9A 1K55C 3LIDA 3MXRA 4B43A 4IQJA 4ASNA 3FG8A 1XGMA 4JF4A 4B47A 4P5OA 5FLXK 2C5WB 2IWCA 1XD7A 2JBFA 4G7OF 2UXNA 3ZQGA 4UNOA 4X53A 2W1TB 5FI2A 5ICFA 3CPTA 2EV6A 3VDXA 1BLSA 1BOAA 4DF6A 2K4BA 2R7FA 2O9BA 3OL4A 4CYCB 4QLCU 3ZMUA 3J80K 2XQZA 2OC6A 1LDJA 4M9ZA 4ZYAA 1DJCA 2KIFA 2X4HA 1LLBA 2QJ5A 1YMXA 3K4LA 2X6OA 3B02A 3F8FA 3T50A 4GS9B 4D7NA 5LGUA 4EJVA 2B5RA 3L7HA 5F6AA 1BLHA 3LQQA 3UNGC 3UB7A 1O4XA 4BD0A 4OAYA 4AVZA 3CCVI 2R5ZA 3CCLI 3VFHA 1XCVA 3UB5P 2XGEA 2VGKA 1XGOA 3ZMVA 1YJWI 3S16J 5FLVA 2QM3A 2ZQ9A 2RQQA 3JSOA 4KFCA 1AKHA 4M9SA 1SHVA 4U0TA 3LY3A 4HNTA 3G6EI 1H88C 5GHXA 3GUDA 2O9CA 2M1BA 2ZFUA 2ZKZA 1KE4A 3HOYJ 4HEA2 1D8JA 2BZTA 5FKKA 2Z6CA 2EH3A 1IUFA 3EETA 1YLJA 3AGDA 5FQ9A 3R7WA 4BQMA 3LFKA 2W57A 1VQOI 4R23A 3MEXA 5F27A 4C3IJ 1GSVA 2RL3A 5BMZA 4HH3A 5IHVA 3ZNYA 1WI9A 4B8XA 4UB8C 3MF0A 3J7AO 2Y2ZA 3KYQA 4OWRB 3RPQA 2QKPA 5D6EA 4OQIA 1GCEA 3E6CC 2PQ8A 4YIFA 1XC5A 5A91A 3WWXA 1OCOH 2IBDA 1LDKB 5KCMA 3ZG5A 4JF5A 3GTKJ 1K6SA 4XOPA 3LIEA 2BY0A 2VL8A 3BT9A 5EG0A 2HVSA 2ZMVA 3MZHA 4I0BA 3BFDA 1FSEA 4JGPA 1WJAA 5LEKA 3K70C 2CV2A 5CQEA 3PIOF 2QSGX 1ACFA 1Q2PA 1RP5A 2PI0A 2J9OA 2V20A 2RAEA 1TWHJ 4XMYA 2Q8KA 1JGGA 1K4EA 3QP1A 1MXOA 4KQOA 2ZJPF 1JWZA 1E3HA 1S7OA 4IRHA 3BR3A 4F7ZA 5GTHC 2F6CA 2WGWB 4LV3A 2HPBA 3JYIA 2DMPA 4FX4A 3K70D 1B72B 2L54A 2X0LA 1JNUA 4LPZA 3UB8A 2CS3A 3BFFA 1KGEA 1K4TA 3MQQA 1VQMI 4XN3A 4OPZA 2DOEA 5HFOA 2COMA 3G1LA 4RDUA 4RB2C 4JP0A 1X1AA 3PIPF 2R0QC 2GJ3A 3A3DA 2KLIA 1OR7C 2XK1A 3WU1B 2DCEA 1G68A 2JN6A 3M2KA 2KISA 4OIQF 4C2MJ 3AL0C 3H7WA 2XD1A 1MJBA 2JKTI 3TW6A 3JRDA 3GRJA 4EBPA 4G3VA 1SFOJ 1LUJB 2EIJH 1XGSA 3QYFA 2LH9A 3Q81A 5E1ZB 4HQEA 2XUBA 4A12A 4F91B 4IHTA 5EVID 2ZMAA 1SAUA 2L7KA 4IQ4A 5F0HA 3W3CA 4GYGA 2WGVA 3HUGB 4BBVA 4RAGA 3KX2A 1RCJA 2YSRA 3BR5A 3T8RA 1ES2A 4Y7PA 2QQ9A 1B4AA 2W4SA 2CQNA 1T08B 3A4CA 4BJTA 2IJLA 2MLGA 4XLCA 1F1ZA 4Q48A 4F3QA 2GLOA 1MY8A 2LBFA 2DMQA 4KITB 4IRGA 2EWVA 1MDMA 1USSA 4LLLA 1QBJA 4FHTA 1FIPA 4KMUX 3RKYA 2OZUA 4KJZA 4IEDA 5FQIA 3BC8A 3HPHA 1W4MA 3TO6A 2G2WA 1ERQA 4LMYA 1G6NA 4Y52J 1LI0A 3HTUA 5FQKA 3IHAA 5CX7A 2FE3A 1A36A 1KU3A 3TJZC 3Q82A 3T4LA 1W0TA 3FF5A 4H8RA 3JCUC 4L9VA 2HKOA 1W63M 2R78A 3UDIA 1MIJA 1XFNA 2CJJA 4S04A 4P0MA 2BW3B 2OV5A 3HG9A 2JUGA 2XAJA 4E6WA 3IXDA 4M3KA 2KRCA 1QRYA 5FROA 1GLNA 3E3VA 1IOUA 4BQQA 3M07A 3J81Z 2Z33A 2CGPA 2X01A 2K4JA 1DPRA 2A5YB 3S4XA 3RZDJ 2NRAC 1WE4A 2Y9YA 3IXHA 4R1GA 1QHGA 1ZKJA 2K9SA 3GFMA 3S1NJ 4OMZA 3EEAA 2OAZA 3U1KA 3J7AY 4ETZA 2OF7A 4XKCA 5FAQA 3I0TA 1F98A 3ZQ5A 4LLNA 3O3VA 3A0SA 2ZMEC 3HPGA 3SFIA 3FXQA 4F55A 3OYDA 1KQ8A 1A5JA 2Y2LA 3W4PA 3BTJA 3L9FA 4V2GA 3BR1A 4IHQA 1RIOH 5DF7A 3CCYA 4UVCA 4A6DA 4PM7A 5CGXA 1JUPA 2HQ5A 2OD5A 3JR9A 2E1CA 1Z6FA 3IKVA 2QUFA 4HX8A 5TJJA 1Y0NA 2W25A 4MNRA 5E43A 3OR2C 3SW1A 1PVEA 5M3FJ 2I72A 5J8XA 2ZC7A 1FYKA 3GBGA 2J3WA 4IOCF 4DZPA 5CYVA 4X68A 4QJGA 5KK1A 3CQZJ 1AOYA 2C6YA 4E7SA 2EILH 3KETA 2AXTC 2VT2A 4N9KA 1HVBA 1D1BA 1MWSA 5HZHA 3E6BA 2VT3A 5KVRA 1Y28A 2KOIA 4ARZA 1I1SA 5CVIA 2AO9A 4FISA 2H8RA 3IAS2 4CCOA 1J9MA 4UXNA 1B9NA 1ZH5A 1LB2A 3W2ZA 5L3DA 3HOWJ 2HP9A 2XGDA 2CO5A 1GHIA 3HHGA 1XA1A 4M6YA 3PAEA 2R7QA 1R23A 3VP0A 4XL9A 2LD5A 2G7HA 4OINF 1G3TA 4BY7J 3WRZA 3CMAI 3F1OA 1XJ6A 1KVMA 4X1LA 4E3LA 1ETWA 4F94A 3M8JA 3A01A 4JGRA 4WYYA 3V7SA 4ABZA 1H3QA 3MQOA 5GHYA 2XFTA 2HU9A 5HDGA 2BHYA 4B48A 4HV6A 4R3AA 2M0CA 5FJ8J 2R7TA 4HOBA 2OV7A 4LIVA 1B8IA 4U87A 4XQFA 2P81A 4XICA 2EX8A 4RVAA 5HWTA 3T4SA 1MJ9A 3UO9A 3RTYA 3S7NA 3V8KA 3KCCA 3BOQA 2K02A 1QVUA 4MIMA 2IGMA 2PT7A 3M7GA 3EUHA 4HNVA 4I98B 1EH6A 4XUXA 1Y8QB 3E7LA 3UDXA 2O3FA 1T0FA 5TR7A 2HYFA 2CQKA 2LK2A 5ILSA 3BCAA 4X25A 3GFJA 4EUVA 3BJAA 2VONA 4X0GA 4KENB 3GDIA 2FZ0A 1W63Q 2NS7A 4I3IA 4Y15A 3LR0A 2LF7A 4IHVA 4B4ZA 3LA3A 2VQCA 1F36A 2RGVA 2V1XA 1SFUA 3MKLA 3RYRA 1JUSA 3H82A 3JTGA 2G0EA 2H1KA 4QHCA 1Z7UA 5DCFA 1VEUB 3MAJA 5DDGA 3RI4A 1FQGA 4UA7A 3ERMA 3QNCA 1XGJA 2HPMA 5KNLA 4CCMA 1G3YA 4P85A 1KONA 1WI3A 4DIQA 1IZ1A 4LCLA 3P9CA 4LENA 3FK6A 1YJNI 3IP4B 5K7FA 5A90A 1S8NA 1T8IA 3ZNTA 2VGJA 5CVVA 2X02A 1ON2A 1ONVA 3LI9A 3ZXSA 5L3EA 4I3JA 3EQLF 4FCFA 2E7WA 4EEPA 2UUZA 3E0JB 4XM3A 5ILUA 3LMMA 2Y9ZA 2BY3A 4K0XA 2A5WA 1W7PB 2M5WA 4AIJA 2K5CA 4KA4A 3ZN0A 2JN7A 1YI2I 4PGGA 3L7WA 4L9TA 1XDSA 5LHHA 4E3OA 2Y2QA 2LTPA 1JT0A 1ZREA 1DP9A 1BI1A 2GXAA 1UJ8A 3HTSB 3B47A 1PP7U 1M1EB 1ZTRA 3VP2A 3MZDA 3OYGA 2OU2A 3K10A 1IN5A 1U78A 5E2EA 5LFAA 2X6WA 3CC4I 4NBQA 1OPXA 4EBNA 3BFGA 1TQMA 3T1XA 4N9IA 2JC7A 1QMFA 4CLCD 1WYBA 4KZ6A 1IW7F 1Y6IA 3K2AA 1ZHFA 2DFIA 2KZVA 3BLYA 3F8BA 3V4GA 1STZA 2EINH 5LGNA 2Y55A 5AQ9A 3WTYC 1GA0A 1Y8RB 4N9LA 1PUFA 1AKHB 3IC7A 2L7FP 3JVUA 3H92A 4R6LA 2EIKH 2FBIA 5A2QZ 2HGVA 3GQZA 4OQHA 5F64A 4NXGA 3DWLE 5F69A 1RC9A 2Y30A 3R7WB 3WS2A 1SKOB 2JKRI 1UG2A 4OVDA 3S14J 4KZAA 1X4PA 1FR1A 4I6ZA 2KLOA 5FDSA 4NEED 2E34A 3TDZC 4A0YA 1MMGA 2GA1A 4IJAA 1Y39A 2L7MP 2P74A 2IRFG 5DFYA 1ETQA 2XAUA 4NQWA 3TGNA 5D5VB 4OAZA 1JTGA 3OS2A 3HZJA 3TW7A 3V5MA 1K6RA 5MC7A 1RPWA 3FMRA 4ON0A 5G18A 1H8ZA 4EVIA 4KYWA 1SVLA 4KG2A 1N9LA 2P9VA 3LA7A 5FKNA 3IH9A 2DA2A 1FP1D 3PUBA 1HKTA 5CHUA 2B7EA 2MLKA 1BR4A 3CUQA 5EEAA 3UPOA 4FD8A 1EH8A 1J5YA 2BASA 2HF6A 3RTRA 4D0PA 2COBA 3T1BA 4Y7NJ 2B63J 2HDQA 2ELKA 2RCXA 4R4SA 1I3AA 3QWLA 1RNLA 4PSWA 2DFHA 3LSMA 3D3OA 2JKTM 4PCQA 5D5XB 2FU4A 5EGOB 3MKWB 1BZAA 3TP3A 5EDNA 1FYLA 1ON1A 3VOYA 5EOOA 1IDZA 4U0XA 2HDCA 4XLHA 1FOXA 3CCJI 4ENMA 4JBAA 1P9WA 1BR2A 4ENKA 1OQYA 1PUEE 3HUNA 4LG0A 3OOVA 3S7PA 2NUPC 2HVRA 4Y0TA 4YG2F 2E2HJ 1LHYA 4UV8A 1OCZH 1Z6TA 5HS8A 2FOWA 4D9JA 3Q7ZA 1GVJA 2YS9A 1B59A 3F21A 5EEHA 2A05A 5D8LB 3JRGA 4E3IA 3S3MA 1XJ3A 5J4VA 3NY4A 2VIXA 3SS3A 3B33A 1YS7A 4LLOB 3LEQA 5HDKA 4ETSA 3OSGA 1U6GA 2PBDP 2KIMA 3PQJA 1T39A 2JCHA 2M4KA 3T8TA 1FOFA 4HLXA 5BPDA 1XX5A 5M5WJ 4L9FA 4S2NA 5HD3A 1VNDA 1XS9A 3E97A 3ULQB 1JKRC 3W2VA 1JKOC 1G5UA 2H8WA 4UQIM 2DFFA 1TS6A 2F48A 4KIBA 2ZLYA 2HEOA 2GWRA 4PHTA 3D5RC 3R61A 4DOZA 2W1RA 4IHWA 4N0BA 1R5GA 2XHKA 4UEYA 2MH9A 3ASNH 3QPLA 3BTCA 2I8DA 4XRSA 3HRSA 5LBRA 4XK4A 2XGCA 1P4WA 2XA7M 4CJNA 1R9TJ 2X1CA 3PNTA 2ELJA 2CMNA 2ZM0A 2Y48A 1JXSA 3PBOA 1K79A 1YYVA 2HVQA 3EYIA 4PDKA 1TDLA 1KYZA 3N6IA 5LEJA 1BBYA 1L0OC 2IGKA 2D01A 4HOIA 5HLIA 4II7A 3WU2C 1UELB 4DBRA 4E7JA 5FAOA 2TDXA 2R7DA 5IPAA 3IH2A 2STWA 4LB6B 2HYGD 2O9AA 5EEGA 1RGZA 3TSGA 1N25A 4HSRA 2J7VA 5KZHA 3EUAA 2Q2EB 5KIZA 4FX0A 4ZDOA 3I58A 4LOCA 5JI6A 2JA6J 4I5SA 2X6YA 1GHCA 4BJPA 1IN4A 5EV0A 3KP2A 1U3EM 1ESIA 1K83J 3LR3A 5GLDA 4B9OA 1X2NA 1YE9A 1TP4A 3V8JA 3VP1A 3DU5A 3T0YA 1FSYA 1LEAA 2EFNA 2LREA 4C2TA 1QQIA 3ZG7B 3HKZN 3JPUA 4NB5A 3ZQ7A 4WCGA 2XASA 4CZCA 1HF0A 1K54C 2ETHA 1FSHA 1V5EA 2VV6A 3RXWA 3JRIA 3ZQQA 2BYVE 2R7SA 2A6EF 3UN7A 2NXNB 4A5RA 3WGIA 2J80A 1H8MA 2HZ5A 5HWVA 4EM0B 4A5MA 3ISPA 4AUXA 5BPIA 3CMMA 1YM1A 1F43A 1ITYA 1IFQA 4M6VA 4WEJA 4XRMA 1APLC 3DXJF 2BGCA 4G9YA 2GDNA 1HW2A 4M3FA 1LVKA 4C3JJ 3FXKA 2PBIA 3H5AA 3QPSA 1YW7A 3OYLA 2P6SA 1V3FA 1CQAA 2DCFA 2QGUA 2WAFA 4BEHB 3F1OB 5DJTA 4XR6A 4FH2A 4U7DA 3A01B 1ZHHB 1K6OA 2ZJQF 2IS4A 3DPTA 3T1QB 4EUZA 2IWDA 1LL9A 2TCTA 3NCKA 1FTTA 3VB2A 2IA0A 4MFEA 3T4TA 4OQ0A 1TW3A 4Q8IA 3OYCA 4JBFA 4LLGF 5A93A 3GLXA 3ABMH 4OP8A 4EEFG 3S2WA 4D1QA 4YELA 5J6XA 1F2KA 2DQRA 2L0WA 4PJJA 4OP5A 1W5CC 3L00A 3K0LA 3WTWC 3H36A 2DA5A 4DYCA 2EFWA 4XUZA 1QNTA 4MO7A 3K2NA 4BE0A 4PM6A 4DYQA 4KT5C 3ZYTA 5KMWA 3NOPC 4XOTA 1JE8A 4L9NA 1XCBA 2W0NA 3VE4A 1YHQI 5LLQA 2E2IJ 2JT1A 2VBZA 2PJPA 1NH3A 2DA7A 3N8RA 1TTYA 5TRDA 3V42A 4LB5A 1D0YA 2A61A 3DLAA 4AYBA 3UPNA 2OPTA 3HRTA 3S7QA 1U9OA 2QQAA 2M7UA 2EV5A 2HDRA 3OL3A 5H2FC 4PFOA 4DQ2A 3MKFA 1DGRM 3IX3A 2L9NA 3O8GA 2VA0A 2K3PA 2Q1ZB 4I01A 3HLCA 3A0BC 4DKIA 2ZJ9A 1VB6A 1Y0UA 3A3FA 3MFXA 5CGWA 4CXFA 5B3SH 2LB5A 4EQQA 3HGYA 5CTNA 2EFPA 2DJIA 1K78B 3HCYA 2XPWA 2NVUB 4U0WA 3D5LA 5HAQA 2VJIA 3ZMZA 4E7KA 5FATA 4X69A 3CO7C 3RYPA 5E20A 2WZZA 4KG6A 1RUOA 2QYBA 2K2NA 4B1RA 4GXOA 2ZC3B 2KPMA 2P8TA 4I09A 2EJRA 2HS5A 1G8XA 1Z1DA 3CZ6A 4HF1A 4HJ3A 3K4CA 3FKJA 1MSEC 3H9JA 1PRQA 1U5TA 4EV4A 2XIGA 2FMLA 1KGFA 2VZWA 4S2JA 4EBLA 2L9VA 3DKYA 1U60A 4PJMA 1F9NA 2LY1A 3TRCA 1ZRCA 2PMZA 4OPYA 5E1XA 1YIJI 1N9OA 3I4NJ 5DCMA 5EM0A 2KZGA 5AVEA 3HLEA 4ZJZA 2R7OA 2V9KA 1QGPA 1IG7A 1NLYA 1ETXA 1NRFA 2P7JA 5C44J 4P96A 3OBFA 4HJ6A 1MGTA 4OOMA 2IA1A 1OLTA 2VN2A 2X9DA 4QD4A 3FZCA 2DNSA 3RJUA 5M5XJ 4N1XA 1YITI 3V3RA 4CGZA 1ZR2A 4LV2A 2EPFA 3HGGA 3FXRA 4KISA 2R7XA 1JT6A 4IF4A 3TOBA 4A3IJ 2JKRM 4JLFA 2XAGA 3VEPA 5HNFA 4KZ3A 1SD6A 3E5UA 1BT5A 4Z9QA 4J00A 3EQUA 2DOAA 2Y69H 4Q4ZF 2PBYA 4Z2YA 1ZG6A 3C2HA 1FCOA 4QU3A 4MN5A 4KQRA 1S9HA 4JXGA 3GW2A 1N9NA 1KVLA 1YQAA 2R7ZJ 2H6BA 1WCMJ 3PAGA 3GF2A 4A3CJ 5C3EJ 3BRMA 3V7CA 3LSKA 3F1PB 5EJCA 5AVFA 5TISC 3M4OJ 2J5OA 3I4PA 3EEHA 2P7VB 1WYCA 2LY9A 3GTCA 2JSPA 3LEZA 3CJMA 4F92B 4QY5A 1D06A 4EU0A 4IXAA 1DP7P 1S6RA 1Y1WJ 1V54H 2ZXJA 1R4MB 3CUQB 3GYHX 2NVTJ 4MEZA 2EZIA 4HBTA 3M8EA 2DTRA 3LI8A 1H9TA 1YOVB 2Z3YA 3G30A 2ZXWH 3Q7VB 4LD5A 2EBIA 2LY2A 1FPQA 3S3OA 5DUIA 3SDBA 3IKTA 1PZOA 1S4RA 2L0KA 3LIAA 1PDNC 3ZQCA 2WY8Q 1J0RA 4FT8A 3HOTA 1H8YA 3PL8A 1VI0A 1NWZA 4H0EA 4Y4RA 3BZ6A 3CLQA 3HOXJ 3N8SA 5TBMA 3UMEA 3DTKA 4LV1A 4WXDA 1O57A 4WK8F 4PM5A 2J3TD 4N92A 3TL4X 2XH9A 4MLLA 1EI5A 2W3EA 4K08A 4UVBA 1V9ZA 1FSWA 1PYYA 2L4RA 4DXBA 3R6SA 5CPRB 3RQ4A 3CJQB 2GX5A 3CUEC 4A2UA 1HW5A 1OFCX 3CP8A 2DXIA 4YFMA 5CVRA 3LIFA 3CDLA 4KN7X 1X2MA 2O0YA 4CYDA 4BYYA 5E3OA 2J8YA 4RX2A 1USTA 1K38A 4XONA 2CW7A 2X51A 1R22A 1MH4A 3MZ8A 1MKIA 5M3MJ 2OOLA 2W85A 3RJPA 2NAZA 5E8GA 3MXQA 5HPFA 2AS5F 2E5ZA 2F4IA 4EJTA 5ILVA 5K7ZA 1S7AA 1Z91A 4OU0A 4ETXA 4GB7A 2K27A 3C2GA 3J81K 6PAXA 5GAGJ 3GTOJ 3VYUB 1YJ9I 4PGHA 5JR3A 1N9BA 4OOLA 4Y0OA 2NOGA 3G2ZA 3MJQA 4WZ5C 4DJ2A 1ULYA 1MBKA 2W48A 3FM3A 4HJ4A 4BD1A 2DLLA 2JSCA 2O61A 4CCLA 4F3LA 4DW6A 2KIQA 4KDPA 4IVKA 1WH7A 1IRGA 3AG4H 2DU9A 4G7ZF 5DM7F 2KIUA 3F8CA 2VB6A 1D1CA 3CAXA 3M1EA 5DS9A 1W5DA 1JKQC 2VX8A 3NC8A 2PX9A 2FOKA 5HDSA 5CGSA 1RKWA 3CF5F 4D7MA 1WSUA 3VFFA 1CF7A 3BG9A 2O03A 3I5UA 2V4JC 4BE1A 1FILA 3FC7A 3E4PA 3H3UA 2DK8A 2EA2A 3TMOA 1QHHD 3FHZA 4DJ3A 1OISA 3DQVC 2M45A 1P4XA 2D1HA 1ZRDA 2EWWA 2Z2LB 3A0VA 3WG7H 3BZCA 3HRMA 3IWQA 1OTEA 3EOIA 4P1WA 4LRZE 4KUMA 5B1AH 3IX8A 3E4QA 2QZ8A 1XP4A 3DLLF 3BPXA 1IN8A 1XPBA 2Q9NA 4BDYA 1X3ZB 1YSPA 4KIFA 5HS9A 3IL2A 1TVFA 1MKMA 2CU7A 4C2UA 3MZEA 1DDNA 3KSHA 3SOIA 1YT4A 4QB8A 5L07A 3UE0A 3DPLC 2ZXIA 4E6KG 2BVMA 4UY8I 4H6JA 1DP3A 4U0YA 1ETOA 3JAMK 4KG5A 3S1QJ 2VPRA 2QVOA 5ICGA 1ZQ3P 4RB3C 2EX6A 3NIAA 3HREA 3OLOA 2E5NA 5CRFA 3C3WA 2X1DA 1M40A 1X3UA 4UV9A 5GADJ 3NHQA 1D5VA 1IGNA 3WS0A 2LB9A 3LQRA 5HLGA 2Y2MA 1FOKA 1NG7A 3K1PA 2O6GE 3MKZA 4IVIA 3A03A 4Y5FA 4DE2A 3DBAA 4Q5SF 2D1VA 3PFYA 1ALQA 3S2DJ 2K85A 3ZCZA 2DT5A 4XRFA 3WTTC 3S22A 1OR7A 4ESBA 3CMEI 3GCMA 2ZQCA 1RUNA 5EVIA 2ICWG 4HG2A 5DV5A 1VQ8I 4KNYA 2EZHA 1IUYA 4XSZF 1A35A 4HNUA 2XLNA 4E7HA 1YMSA 1ETVA 2HWVA 2ZM2A 1ZELA 4MQVA 1YX5A 3C4PA 1POGA 3G3ZA 3J7YJ 3F1NB 1TLHB 3NDGA 5HVQC 2ACJA 1KOUA 3FPVA 2VKHA 3M1CA 4JGOA 5HSQA 2X71A 1CJFA 3FXOA 4PKYA 4PJLA 3V7RA 2R7UA 4FE7A 1SMTA 3PTEA 5HL1A 2LRDA 3TO7A 4CUGA 2RVCA 3G31A 2WB1N 2KKOA 4U3TA 2HQRA 3TP0A 4P9FA 4GN2A 4IRIA 3ABLH 1XTAA 3KYLA 2NS0A 2LC2A 1DRMA 3PXPA 1UMQA 1R4NB 2W3HA 1WQ2A 4GLQA 1T95A 2PFBA 3IS2A 1S66L 1A6IA 2WTEA 2MBFA 2VJ5A 1HXDA 5JVGF 1SD7A 4LGWA 3HOVJ 2MGQA 3I7JA 4O7DA 3ZDJA 2YUSA 1ZYRF 1SC7A 1ES4A 3TOIA 5IS1A 4R1HA 3V39A 5FQMA 1SZVA 4BACA 4RAYA 4GO1A 3P7NA 3JTHA 1SD4A 4R79A 5HAPA 3GZ6A 5F0FA 2QKMB 2DPDA 1UZCA 2O7OA 1YPRA 3BR6A 1Z09A 5IY5H 3KSIA 3BG3A 3K4KA 1O7LA 4HX4A 1JKPC 1BI2A 2PHYA 3PBSA 2JRMA 3W6JB 1ZRFA 4KQDA 2V26A 2P04A 1JI8A 1R00A 2JUCA 2ZMEA 1KU2A 3D5SC 3K1NA 4GYIA 1B1BA 4L5EA 4CZZA 4LRYC 1YIOA 5J8CA 3UY6A 3A3IA 4QWQA 5IYCJ 4HLYA 4HSTA 2Y2HA 1BULA 3I4MJ 4X6TA 4OIOF 1C3BA 5IOZA 5KAFC 5L10A 4XT2A 1Z21A 4R3BA 1YX3A 2FNAA 2JJ7A 4A3LJ 3FPWA 5HARA 1O7FA 2IP2A 4Y3OA 4G6DA 3UPPA 1LDDA 1YLTA 2STTA 3BQAA 1FC3A 1LEBA 2OLUA 3EGDC 3H9WA 1XSDA 2VOOA 3IWFA 5CHJA 5FI6A 4IBRA 3DKXA 5FKOA 1LFBA 3CCEI 2FD5A 5DCMB 5ED4A 4U0VA 4HDVA 3S1RJ 3KEQA 3BECA 3LOCA 2KRFA 1Y4OA 4AVPA 5HDNA 2GBYA 1DU6A 4UUTA 1E17A 3IT9A 1L0EA 3K1MA 1EROA 2WGIA 3K7AJ 1FTZA 2D5VA 3EGXC 3SS5A 3DEWA 1BIAA 1ODDA 2QQBA 2X1EA 2L9SA 2WKEA 1N78A 1NG6A 4XNFA 3L2UA 4PM9A 5CERA 2EIMH 1MMSA 5AIPA 1EKEA 2HKXA 4EMSA 2WYXA 2A07F 4HF0A 2ZC2A 4MEYF 3PUFA 2LF8A 4B3XA 1C0WA 4IHYA 1XGIA 1XG1A 2YX7A 5H6QA 3IF5A 4RGRA 2NVQJ 1KQ0A 1BC7C 3HEFA 5LD2C 2JVHA 1LQ1A 5IT9Z 4HH2A 2IGNA 1L0FA 3FXUA 4HYEA 2Z9OA 1VQNI 5J1YA 5A92A 1BW6A 1J2XA 4GD6A 1IRZA 1I6HJ 2DA4A 1XDUA 3G71I 1X4OA 1YRNA 4HQAA 2VASA 2CFOA 3QP4A 2H6CA 2W84A 4EW7A 3S8PA 5BOHA 2BY2A 5D5UB 2W1OA 2KL4A 1HLVA 3PBRA 2W00A 4B88A 2B95A 5HLTA 1WPKA 5CEBA 4BHBA 3SZPA 3VFZA 3CITA 1FBQA 1TEMA 4QTRA 1EWZA 5FLXZ 4M3BA 3I55I 4BL0B 2ZOIA 3MS6A 2DT7B 2XGXA 2OAP1 3UDFA 3OS0A 2KJCA 2NS8A 1ZG1A 5EZHA 5FQJA 2MD5A 2ZSIB 3Q5FA 1YFHA 2GOXB 4RX3A 3DEEA 1WZ2A 5TBMB 2OCCH 1NJ4A 4MTEA 3J80Z 1JHHA 4LITA 2ZCWA 1FJLA 1FWZA 3BG5A 1ZG3A 4YFNF 1IN7A 4MN7A 2P7CB 4WUJA 3GVAA 4AWXB 2WADA 5K5OA 2LVSA 5D6FA 1FMVA 1YQSA 5FAPA 3E2LA 3F6VA 2DPUA 1W8QA 4GZBA 4MN6A 3E1SA 4HQMA 3VMAA 3ZMSA 2JZYA 1T19A 4OKPA 1HTZA 3AG3H 5E2HA 3OCLA 1OYWA 4MMNA 1CEGA 4JX6A 1OMIA 4U7BA 1IJWC 5B66C 3ZR8X 1A0KA 2YKHA 1FIAA 2IA2A 1P9RA 2CUJA 4NC7A 3SHFA 2Z1DA 3L2VA 2D2WA 3CO6C 1DP6A 1FEXA 2HTSA 1QO0D 2V0UA 3H5RA 4XIDA 1NRJA 3OPHA 1I39A 2YX4A 3ZVTA 1E25A 4PKYG 5JLXA 2O8KA 5HW3A 3V3SA 4QPQA 1ONGA 3QOPA 1FBUA 3KFWX 3KYZA 3CUOA 4Y0UA 3ULFA 1R6RA 2VKDA 1LJ9A 2FBHA 4RLFA 1VM1A 2V1UA 4CLCA 5HWWA 4D60A 2EFOA 2DAOA 4HESA 4F3LB 1W5TA 2WWYA 2PD8A 4YEJA 4AU7A 1O7EA 3ZG8B 4BNCA 1SDNA 2ZL1A 1R7JA 2DT6A 1ZGJA 1UCRA 5L3CA 2KX6A 3KO6A 2HYJA 4KN4X 4BKXA 3H9GA 5FEFA 2BEOA 3CLOA 3DCFA 4MDZA 2ZC4B 3T4KA 1S7EA 1NYYA 1PWCA 3W6KB 4S2OA 4A0ZA 2DTZA 3J7ZI 1VFCA 1CF7B 3VSKA 1PNEA 4P6ZM 3P9IA 5FQQA 1HA8A 2VJJA 2OZ6A 3U2AA 5LHGA 5LRRA 3CPTB 3EUHC 1I5QA 3WS5A 4ESJA 1GA9A 3DFGA 3DPUA 4DE3A 3QP6A 4PMAA 1DY6A 1T0FC 4R4RA 3RXXA 1WH5A 3G2BA 3NQOA 2V1DA 1IEMA 2PEXA 2EZLA 4A0XA 1VQ6I 2HDUA 3ZVWA 5GPAA 2CRGA 3Q07A 4I02A 3H35A 4HIAA 4IBXA 2DQLA 3UB9A 2Y2IA 4G3KA 4MNUA 3KPHA 3HHHA 1K25A 1FZPB 2R5ZB 2LSOA 2UV1A 1R36A 2LMDA 1IC8A 1DPUA 1E3UD 1HKQA 2WA0A 3EWKA 1ERMA 4S2PA 3MZFA 5K5BA 2VLGA 4KZ7A 2P5VA 3M9AA 3T4JA 4D5FA 1D0XA 2CSOA 3U1DA 2YPRA 3PO3J 1SDEA 1HZOA 4IJGA 2EFXA 4IX7A 3T4QA 4WF0A 2XD5A 2UWMA 3QODA 4FQGA 2IS6A 3HSFA 4JXWA 5CLSA 1D8KA 3GTMJ 4BL2A 5CECA 1QU3A 3RSNA 1H8AC 2A3UA 3CCSI 1T1AA 2R92J 3LL7A 5EVIB 2XDMA 3K69A 4H4KC 1KZHA 3GV9A 3KSFA 4C3QA 5EG0B 2DDBA 1GUUA 2JKGA 1SAXA 3QHYA 4RM3A 1S72I 1R1UA 2OQGA 2DODA 3IWZA 2M0MA 2XB0X 2VODA 1IYSA 1TT0A 4A69C 2VBYA 4XBFA 2XC7A 1O3SA 2V79A 1JUMA 1N77A 5KSHA 4CCNA 3HYIA 3OMYA 5DKLA 2P5KA 3S3NA 3ZPLA 5CVJA 1TNSA 2VQLA 2FRHA 1T1BA 5GPCA 3I9V2 4K2EA 2JA7J 2R3SA 3W6VA 5DYMA 2O9LA 1AXBA 2E1OA 1GT0C 2VC0A 1H89C 1GDTA 2HP5A 5M19A 3FKVA 1A31A 4KT6A 4A3DJ 4RM2A 3FISA 1VQPI 3FX3A 1WJBA 1R71A 3H7WB 1TWFJ 1NXYA 2M87A 2MA3A 1KQ9A 2V8CA 2E8JA 4IHXA 3MCZA 3GFLA 2FJ1A 1W8YA 2EXAA 2OJED 3HB9A 4PK4A 2HDWA 1Z67A 2MJ6A 3M8FA 5H6RA 4RGUA 3HOSA 4MQ9F 4HAMA 3HJEA 1JGSA 1N4OA 4X55A 5J7EA 1XB4A 3GTJJ 4QPOA 1MW7A 3TG9A 1LSVA 2N8GA 4HP4A 2MSYA 1AWCA 1ES3A 1EW0A 2RNJA 3CCUI 5E17F 3WS1A 4BAYA 4MEXF 2LBFB 4EV0A 5GAEJ 5FD6A 5DD8A 1JJ6C 1F5MA 5F08A 3KLOA 1MDMB 1MWRA 2WV0A 5J4EA 2O8XA 1K0KA 3EQVA 4AD9A 5JLWA 4BH9A 2FFFB 2RN7A 2MD0A 2DO7A 4RGXA 3PFIA 2ESNA 3F23A 3O87A 2M2EA 3L9KA 4A93J 3OC2A 3CJRB 2I9VA 3HKZA 3ZQLA 5IU1A 2OWJA 2CW8A 3OIQA 1ZG5A 1FYMA 3I53A 3RZOJ 3CUQC 1O07A 3CG5A 2M30A 2O5RA 1OTBA 2K9LA 4OIPF 4XT2B 3SYTA 3HBRA 4Q0HA 3P5JA 4DYRA 1MBEA 1Q1HA 1T38A 4WBGA 2K9MA 3BTIA 4GDNA 3DBLB 3M2JA 5E3LA 3IBJA 5EUAA 4XLAA 5FGMA 1K54A 1Y1VJ 2FFYA 3BFEA 1P2FA 4WN5A 4DN0A 4P87A 4E04A 3MMHA 2ID3A 2ZBKA 1AHDP 5K5RA 1IRXA 2BV6A 1JTDA 2DI3A 1TBXA 3BZKA 3QU6A 1GXQA 4L0ZB 1WA9A 3ZQIA 4ZTKA 2H5SA 1Z0XA 4YIIA 3PBQA 4CLCE 3FWLA 4GD8A 3HL9A 1KU9A 2IW5A 4MBFA 4I3AA 3H5NA 1W36C 2E2JJ 4HHDA 4QPRA 1GV5A 2BE5F 2A24A 4WELA 2PN6A 1KU7A 4ZYHA 2VJWA 4NETA 4EWFA 4S2KA 3CD6I 1UGUA 2HNHA 2XF3A 3HJKA 3Q0UA 4S2NC 1BN5A 1ES5A 2M3AA 3GO5A 1W36D 2QBYA 5FRMA 4OLDA 3ZG9B 2PG4A 5L3GA 1G6AA 4HPQA 3IBRA 5L09A 2FEZA 1W5SA 3BPVA 5BS6A 3WGHA 5HDCA 3V50A 3A2KA 2WKIA 4DDYA 2WKQA 4DZJA 4MCWA 2XDVA 4ARZB 4HBLA 5EF6A 3RQIA 4CYCA 3G4PA 2ZJ2A 3LWFA 4IL6C 3OSFA 1H9GA 1R5HA 2P6TA 3NWTA 4NHJA 1OMEA 4BDZA 3N8LA 1XGNA 2FSWA 1BR1A 2BLSA 4GS9A 2BG1A 2K7SA 4KUKA 1R58A 1VHMA 1JWPA 2VEAA 1EH7A 4EQ1A 3L09A 2XRLA 5HAIA 5D5WB 1IDYA 4KQQA 1XX2A 1XA7A 2Q0OA 2H0TA 3BQZA 4NXFA 4LJZF 1B8IB 1X0OA 5AQ7A 1G4DA 3E4OA 2A68F 1YAXA 2V9PA 1G28A 3N7WA 2FMYA 4IHSA 2J9PA 5IYBJ 3L2RA 2PU2A 3IH8A 1A04A 2LG4A 1E3OC 1KDWA 1TZLA 2QEXI 3AFHA 3PSFA 1IN6A 2K9NA 2W27A 3IH3A 3HVFA 3C7UA 3K2ZA 3TW8A 4RS8A 1J7KA 4W97A 2PRFA 3R4KA 2CFXA 2WAEA 1A6QA 1PJRA 4A3EJ 2IXSA 3S17J 3WTVC 3KEOA 2VV8A 4GOGA 1R49A 5E3NA 4I38A 1QPMA 1XMXA 4AM3A 2JPBA 5DF8A 1DJBA 3IAM2 2JTVA 5F68A 1X58A 4RB0A 5EYRA 2ZQAA 4I76A 2Y31A 4WMCA 5F82A 2QCOA 4WWCA 2EWNA 2VOPA 4PSXA 4N9HA 3HDDA 3H82B 2XVCA 2M34A 4NXBA 3SH8A 4WLAA 1FOWA 2CQXA 2XGNA 1J3WA 5FFZA 2Y0SN 3DKWA 2DW4A 3KP5A 4GJ4A 1UHMA 1Z6RA 2JRTA 5HODA 1L2SA 5EM1A 3GWZA 1OTAA 2WBMA 3DTIA 4FASD 2PMUA 4E4HA 4CLCB 4MFDA 3E5XA 3ERED 3GFIA 2FX0A 2AVXA 3P98A 3MR0A 4A6EA 3BW6A 1KDSA 1SVMA 4C3HJ 2LLKA 3F22A 2V6CA 4GKUA 5F83A 3IF6A 1BI3A 5LHIA 4A3BJ 5EVLA 2VKEA 1U9NA 1ZARA 1S29A 3GZNB 5FSRA 1RI7A 1TWGJ 4HV5A 2NYXA 3WTSC 3PYPA 4BBUA 1BJAA 3FXLA 2J5PA 2XF7A 4UAAA 2JMWA 1BTLA 3FDYA 1I3QJ 3LSJA 2EV0A 3S93A 3HUGA 1DGWY 3FKWA 2OA4A 3BYDA 5DFXA 1B6AA 3RFBA 2E36A 1WFXA 4CO8A 4WMCD 3TO9A 1ZK8A 2NNNA 4E7ZA 3L1PA 3OYBA 1W7FA 2RV8A 5AQAA 3BR0A 1WJEA 3IWIA 2BTFP 2VI6A 2ME6A 3G73A 1D5YA 1IKGA 2Y2NA 3VSLA 3VODA 5CTMA 4MHGA 1GSWA 3CJTB 1G2HA 3GLLA 2Z6DA 1HSJA 1P7IA 2V6EA 3W4QA 2JE5A 4EGYA 3BY8A 4II2A 3OZHA 4UA9A 3H9QA 2W3GA 3NAUA 3LSIA 1FX7A 1BIBA 3LSHA 2G2UA 4X56A 4EGZA 1UHWA 4LRXC 3KP7A 4HI4A 5JFRA 5L2FA 1PUFB 3PBNA 3FHNA 1WJ5A 2M1CA 1MWTA 2WAQN 3IUOA 3Q9VA 4NK3A 2AQFA 3LAJA 3WG9A 3CC2I 3LSPA 3BROA 3KZIC 3DP7A 3GX4X 3VOEA 3LIBA 4KUOA 4BGDA 3D1NI 4WF2A 4JF6A 4DRTA 1Z77A 3GMWA 2F4OB 2LKSA 4UB6C 4CPKA 1P6RA 1GVDA 2A69F 2HZDA 4NNJA 3Q3SA 1CI8A 2KT0A 1S4SA 2FH5A 3QP2A 5DTKA 4Z1WA 4NDLA 3VP3A 2DRWA 4KZ8A 2G9WA 5M18A 3CTAA 4NQWB 3BQ8A 1BA5A 4O0PA 1ERDA 1T1CA 1MNDA 2ZMFA 1UFMA 3ABKH 3KZYA 3QNBA 3ZGKA 5KAIC 5F5YA 3B73A 3Q0VA 1OJGA 2P9VB 2H0YA 2ZC6B 1ZLJA 3HOUJ 2ESHA 1AU7A 1VQ5I 4HY8A 1FBSA 1I1GA 3O6BB 1WGXA 2XB5A 5LBQA 3OYIA 4CCKA 2VBXA 4KMFA 2EZKA 4OMYA 4DE0A 2CUEA 1MBJA 2L9RA 1IELA 5EOEA 1J75A 1OCCH 3I64A 3DU6A 3OIOA 4HBUA 1X3WB 5CJ9A 5EE8A 2R9WA 1EA3A 2E7XA 1E0EA 5DKKA 3WE3A 3O3KA 3MKEA 5J1UA 1LL5A 4LIUA 4LG0B 2HJEA 1Z9CA 3UE3A 1I27A 2EQRA 3G1MA 3H3ZA 1OYYA 3R0AA 5BOXA 2B18A 3NULA 4WZ5A 5DTSA 5GLCA 5D4RA 4PJ0C 1MMDA 5E8IA 4G6TB 1I2WA 1BOBA 4M9XA 3ZG0A 4HDUA 2IWBA 4BLMA 5GLAA 2XSJC 1BLCA 2CG4A 3Q9SA 1Z3YA 2KRHA 2CQ7A 1JWVA 3GZ5A 1MBGA 1TS0A 2LFBA 3FV7A 5I5LA 5CKTA 1K57A 3MSHA 5HD5A 3QOEA 1YW9A 4RA7A 4LK1F 2WKPA 1D1JA 3ZMDA 1LE8A 4HF2A 3QQAA 1K55A 1YLWA 3K3CA 3LO7A 2DMWA 2CYYA 3W8KA 1G6OA 3WRTA 3U21A 4O01A 3IXBA 3ZQHA 1MSFC 2F5VA 2D45A 3FMQA 1O3QA 4UHUA 1ETKA 1K7AA 3MVPA 3W4OA 2VK3A 5AONA 3SS4A 1YLZA 1ENHA 1N75A 4GDFA 3NWSA 5B1BH 5ICCA 5LGTA 2L5QA 3RPUD 1PI5A 2EXBA 5F1RA 1GHPA 1FY7A 3RKQA 2RKHA 1NTCA 3ASOH 2EFQA 4MGRA 5L3BA 1GXPA 3HSRA 3GXOA 2OLVA 2L1MA 5FA7A 1PI4A 4G7HF 2PMHA 1X1BA 2GAUA 4E3NA 4YINA 3SDGA 2VQHA 1CGPA 4A3KJ 3MFDA 2OWHA 2ZD8A 4L9JA 5DJUA 1TQPA 2WKRA 1JVJA 2NOJB 4ME4A 4BJ5C 3ITAA 1BI0A 5DEQA 4FH4A 1Q1VA 1RETA 4BWIA 2KDZA 4S05A 1M6KA 4GHIA 4HX7A 4DBQA 2XROA 3G32A 3X2QH 1E2XA 1PW8A 2HQNA 4BJ6C 4EATA 2LR8A 3KLNA 3G35A 4R38A 1NZOA 2VGLS 2WKHA 4IOAF 3LA2A 2V1ZA 4ENNA 1TDGA 4XLFA 1S1ZA 2F4MB 1W7PA 2QBYB 2A2LA 4V19K 1O3TA 1FLIA 2E8IA 4NKPA 4JKTA 3F3XA 4QY6A 3ZQFA 3F6OA 3JW4A 1IXCA 3N05A 3SEZA 3NECA 3OYKA 1FOYA 1I50J 2R7WA 1LT0A 2WB1A 5D4SA 1PZPA 5G4YA 1HDPA 4IEJA 3GEZA 2HI3A 3SFZA 4BS9A 1UHSA 3VP4A 2JKFA 4ANJA 5I94A 2ZBBA 3G2YA 3S7OA 4DGWB 3LGOA 1L0GA 1SD5A 3F9KA 2C6WB 1DUXC 2OBPA 1VZ0A 4M3DA 5DVAA 1V5FA 4EESA 1PP8F 3IXGA 4GRIA 1ONHA 2HOTA 4N4OB 4ZBEA 4UVAA 3TKYA 1VQ4I 2HDDA 5JYPA 1YS6A 2MC4A 2W3FA 1K56D 3FIWA 1HDDC 1NLZA 3PHYA 2AHQA 3MN2A 5GHZA 1I6XA 3OYHA 3BDDA 1SCWA 3EPZA 2CC1A 3KYCB 4EM2A 3KP6A 2OTLI 4K0WA 4Y2FA 2QLZA 3RH8B 3RKWA 1RR7A 1W7PD 3IWOA 2E60A 1SKOA 3CP2A 4G12A 5FLMJ 4RMNA 3IHBA 2V1NA 2E35A 2DMNA 3K4JA 4P55A 1RRJA 4Q0JA 2A6HF 4ZDXA 3R60A 1OTDA 3BY6A 4ZYEA 5J1RA 3ICYA 2GIZA 4JYKA 1NYMA 2VXZA 3RDIA 1RR8C 2K31A 1NK3P 4G94A 1UAAA 2GZAA 3WE2A 4E7IA 5CHMA 4JX4A 2MW8A 2ZNYA 1K61A 1Z05A 4E3JA 3E6MA 2B02A 3S1YA 3BG6A 1MBHA 3QRFF 2Y2PA 4GW9A 5K5QA 1ZTUA 2Y8HA 3I54A 3ABUA 4RQ9A 5CQGA 3CDIA 5TFQA 3TE8A 1KYWA 1PIOA 2B0LA 3ECOA 3K4BA 1ETYA 2KJBA 3R0JA 2CV1A 9ANTA 3KZZA 3HSEA 5EGOA 3OYNA 1XFQA 4B09A 3A3JA 4B4XA 3OIPA 4J01A 2W7NA 2HDSA 2DYSH 3OOPA 3VOZA 4KZBA 1JTYA 3HC7A 5EVIC 4M3EA 2MYSA 3FBIB 1XXMA 3RCOA 1KE3A 3IF6B 1LFPA 3BFCA 3ABTA 4KZ4A 2MG4A 5IOYA
chains in the Genus database with same CATH topology
2FBKA 1R1VA 3UE6A 2QWSA 2F5EA 3PBTA 3BJOA 1U5TB 2VE8A 2QWWA 3V8LA 3SXYA 5A2QK 2P08A 3N4MA 3QAHA 2ISYA 4GCZA 2PYPA 2V0WA 2FNPA 3ZP5A 2M7VA 2HJ9C 2F5CA 5L8MA 3TOAA 3RKXA 2XA7S 3KX0X 4WXHA 2EA4A 4HP9A 3CI6A 2GXGA 2F5DA 4AFIA 3NEUA 4JQFA 3U9GA 4NXEA 1J9IA 2VKSA 2XKPA 1YW8A 1ZAOA 4UHTA 2XAQA 3OCNA 2JHEA 4TV7A 1BC8C 2ADUA 1LVAA 2Q2EA 5K1YA 3C1DA 1P92A 3DV8A 5AIQA 3B42A 4HW0A 5L3FA 4M72A 2EK5A 3SQNA 5JHUA 4IPAA 3IRRA 1YO5C 2H27A 1BYWA 1OKRA 4YNRA 2NUTC 3F72A 2L02A 3C38A 3JSPA 4G7OF 2UXXA 2D02A 5DUKA 4I0AA 2VE9A 2GA2A 1UWPX 4WEKA 2W24A 1P97A 2AXLA 3UB6A 1RZ4A 2H09A 3PR6A 4I39A 5C5KA 4ENJA 2PD7A 1ZGAA 3EDPA 5HDDA 4FOFA 3MZYA 3JAMZ 2K86A 5E1WA 2YKFA 2LDUA 4EEUA 3P01A 4RGSA 2MC3A 4BQAA 1L3LA 4MTDA 1EV7A 1OTIA 4DNCA 3K3DA 2LNBA 3TQNA 4L5IA 1LL8A 1YLFA 1HW1A 5HL6A 1XN7A 1SMYF 4OOIA 4ZZDA 1TD5A 4JK1X 2RC4A 3LYXA 2CW0F 1XMAA 4YOFA 2HFHA 4HNBA 2XRNA 2NNYA 3I71A 3C8CA 1JHFA 3LAPA 4M73A 3ZMTA 4CHUA 4YFXF 1XJ4A 2ZFWA 2HZTA 2L4AA 3P9KA 1K78A 2FQ3A 3CWFA 4L18B 4EERA 4GHIB 3EYYA 1BM9A 5DD4A 4WL9A 3MQ0A 4XLNF 3TDUC 4H6JB 4L9EA 3T5XA 5JVTA 1OYIA 3ECHA 2F2EA 2OQRA 3REOA 4AIKA 4CLCC 3L2CA 4CICA 1IF1A 1UB9A 2ELHA 5HD3A 3ROUA 5HLHA 4P6ZS 4O8GA 5HPIA 1XJ2A 3F1PA 4ZYGA 2DBBA 4M71A 2ZOHA 2GZWA 3ML6A 5FO5A 1U8RA 2PDRA 1MD0A 3D72A 2DK5A 3E5QA 1OPCA 1MZUA 4P9UA 3WTUC 1D7EA 2KDKA 4I7HA 2V9AA 2HV1A 3GECA 4L0LA 1ZN2A 4R8HA 4O