3MQIA

Human early b-cell factor 1 (ebf1) ipt/tig domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
90
structure length
90
Chain Sequence
HATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Determination of Functional Domains in Early B-cell Factor (EBF) Family of Transcription Factors Reveals Similarities to Rel DNA-binding Proteins and a Novel Dimerization Motif.
pubmed doi rcsb
molecule keywords Transcription factor COE1
source organism Homo sapiens
molecule tags Transcription activator
total genus 12
structure length 90
sequence length 90
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01833 TIG IPT/TIG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mqiA00
2BSSA 4GQ9L 4HWEL 8FABA 2VL5B 2D3VA 1JP5A 2NX5A 3KPOB 5DRWB 1D5MA 1NC4B 3HE7A 1VFOA 3HB3D 2ZUQC 5D2NE 5IFAL 5C8JB 3L3KB 4MJ5B 2DQGH 1A6VL 2JF1A 4P2RB 2O5YH 1ULVA 2OXGA 3DWTA 3QUXD 1RIVL 1ZSDB 1RY7B 3ABZA 3P77A 4JM4L 2DBLH 1YEGH 4CKVX 2JJUA 5D9SB 3FQUB 1MCRA 3ZKXC 5H37G 4HF5L 3WIHH 4XCCL 3C8KA 1ZLVK 2X9XA 2IPKB 4DKDC 2I07A 5IF0B 2WP3T 4LLUB 5TDOB 5GJTH 3UAJD 3H9SE 3FMGH 3U4EA 4OZGB 1JWSB 5JW4N 5FECA 2D7TL 2RBLA 3SDXA 4IOFD 1BQSA 3HS0B 5JMRA 1MNUL 3BPNB 4DEPB 3KPSB 3HMXH 3MGTB 5GHWL 2R2BB 5C09D 3GM0A 1J0ZA 1NLBL 1VEPA 4JCLA 4HJJL 3L6FB 2PW2A 3RVWC 1UC6A 5A2KH 2X4TA 3DO7B 4Y2OA 2DLHA 2PUQT 4S1DC 1PZ5B 1XT5A 3KLAA 5CCKL 2MWCA 3RFZC 5DJCB 3KNBA 2A0LD 4EI5B 1B2WH 2A38A 4UU9A 1JHLH 1BBJA 5MEQA 4ZSOA 3WKMH 4H0IA 2AS5M 3LS5H 3QT2A 1V7NL 3LCYA 2EEDA 1HILA 2OSLA 4HWBA 1NCAH 3QG6B 1Z3GL 3WYRA 3TN0A 3MLSL 3SGEH 3ARXA 1TNNA 4U2YA 3P9WB 4Y8AA 1S5IL 5DRNB 1I9IH 1YYMH 3ZMRA 3D85A 2VXQL 3ZYOA 4JKMA 3SO5A 3D9AH 3VWJC 3KPLB 3LQAL 3ULVH 2UWEB 3RIFF 4HQQL 4OAWA 1FORL 3RVXD 5ITBL 1N5AA 1DQLL 3LRSB 1PG7W 2G5BA 2C4FU 1FV1B 5JQHC 5I71B 4PJ5A 1DBBL 3RY4A 4APQD 5DMKB 1CE6A 1FL3A 2W9LA 3S36L 3N06B 2ORBL 2ZG1A 3D2UB 4NQDD 4PJCF 3BGMA 3QDHA 4L8BA 4UDUB 3VW3L 4XNQB 2BHYA 1MJUL 4I48A 1IGMH 4YJZL 2P8LA 1A5FL 2LU3A 2EIBA 1YMME 1BFSA 2HT4C 4NO5A 4IMLB 5C0NC 4JPIB 3UO1L 4RISL 1HI6B 4QXUL 2DDQH 3U0TA 3W9EB 3O6ML 1RJYA 3K80A 3EUUA 4EN3B 4XZUB 2E6JA 1GHFL 3FN3A 3WIHA 3QQ3B 3NPZB 4MXVE 4CN1A 1UCBH 2V7HA 1HN1A 3SDAA 4OZFB 5HI5C 4C56A 1RVFL 4O51A 3MRHB 3B83A 1DE4B 1VFAB 4RFEA 4IRJB 2O5XL 3E6FA 4J1UA 2IAND 1S7VB 3TA3A 1FYHB 3HMXA 2C7UA 2YOCA 2WWMC 1MUJA 3VH8B 2FWOA 3QQ4B 3MRNB 4K8RD 4GMTH 4N1HB 4DVRH 2A6IB 4NPYA 5D7LB 4FQ1H 3G04B 1CTOA 1I1RA 1OGTB 4XI5C 2HN7B 2X4RB 5E7BA 3RIAK 4A2MA 3ARZA 4PGZA 4PTUA 4HCRL 1CICC 2Q1EA 4MNGA 3G5YA 1A7QL 5I73B 4KROD 4B5EA 5KS9B 2G75A 1II4E 3D18B 3X12B 2JK5B 4I4WB 3RY6C 5I66B 1GZQA 4RMWA 3TO4A 3GIZH 4GW1B 4MA1C 1IL1B 1BVZA 2WBKA 3L3HB 2ITDB 1LO0L 4C58B 4NQXA 5AZ2L 1J1PL 4LEOA 1XR8B 5D7SL 4JQXA 3QA3B 4YAQA 1H3XA 1IC5H 2HJFA 2E6PA 3WE6A 2AV1B 1JF5A 4GRWH 5BV7B 2HKHL 3MRGA 4HKZA 3UTSB 1AGCB 3STZA 5AD0A 4P2QD 3VFTB 4LSPH 4JPKH 2F15A 1FLRL 1KCSH 4MXVF 3X14B 3T0ED 5T1LB 2OR8A 1AXTH 1T0PB 4FQCH 4GJTB 3PG2A 4AYFA 3OXSA 2AABH 1A6ZA 1RK0A 1G9NH 4Z95L 3DIFB 5C6WH 5HYFA 1VKXA 1BZ7A 2HFEB 3AFLA 4GAGH 4TNVK 4NQDB 4GKZA 2ZP0T 4ZFZB 5TE6H 2PTUA 3QEUB 1PYWB 4IRZL 1OCWH 3C5ZD 4UNTA 3D69B 4LQFL 4WHYH 5D8JL 5CZVL 1EHXA 3ROOB 1F02I 3VD5A 1J0HA 5IJKC 2AVGA 4JJ5A 2FEEI 1ZV5A 3UDWA 1AC6A 5I1DA 1YY8B 4AMKL 3QQ9D 4MNQA 5DGQA 3O6LL 1OPGH 4MDJB 3DV6B 1BQUA 3G6AB 1WUNT 3ZDXF 4U1SB 3P4NA 2NNAB 3P0VH 3B6SB 2JJSC 3WL9A 3CIQA 2ATKA 3TZVB 2R2CA 1SMAA 3NA9L 3C5SB 4WNQB 5KW9H 5JLZA 4NFBA 1BIHA 4NBYB 4NDMB 5C0IB 3MODH 1CVRA 2F53D 3EOAA 4L4TA 5GISH 3MBXH 4JZNA 12E8L 2RFXA 5BOPA 3KXFD 1CL7H 1Z5LA 4UTBL 4XVTH 1EERB 4M43H 1Q9LA 1WITA 35C8L 3SE9H 1CVSC 4J3WA 4PJDA 3AROA 1MFCH 1YEHH 2RAMA 1KN2L 4JKPL 3BN9C 4HUUA 5FGBC 4RWYH 1U8LB 5FM5O 4POZC 5KVGL 2E9IA 1MCOL 2BXYA 2NXZD 4ZXBD 2HWZH 4F57H 1T6WA 1I1YB 4DGVH 1ZHKA 5ALCL 4RAHA 4RQQA 5C1MB 2ZWLT 4M7KH 2ESVE 4J8RB 1MHHB 3OKOA 4BA8A 5C08B 2LV4A 1S7SA 1YDPA 1ZANL 2CK0H 2R56L 5C07E 3IFNL 1FH5L 4KHXH 1A6UH 3T3PE 4P2QB 5HVWA 4ZUUB 5KG9A 1KENH 2NY2C 1A6WL 3UTZB 3LQZB 2W0FA 4QY8B 1R3HA 4Y5YB 1NUGA 4EKXA 5GGUB 1KCKA 3BD5A 4Z76A 1YJDL 2G2RB 4G8GD 2QBWA 3BP5B 1QSEE 4WEBL 2VAJA 3QHZL 1JFQH 1FCGA 3LS4H 5CMAA 4G6FD 3WIIH 3RHWK 3MV9A 2LU4A 2D7TH 4LVHB 1SYSB 2L7UA 4WGVB 5K33A 3TIEA 4QTHB 2GTZA 2Z8VC 4HZLB 3CX5K 3FFCA 4JFOB 2WUBH 5DUPH 1K2DB 5H94B 2DMCA 5AYUL 5GZND 1IFHL 2HH0L 3RJQB 1FSKB 5KSAA 3B3IB 2WBJD 3BYYA 2NZIA 2W9DL 1LWRA 4LSRL 1RK1B 1PQZA 1NH6A 5A2LH 3QO0A 3I9GL 5CCKH 2GHWB 4IIQA 4HIHA 4Q74A 1IGCL 3TPUB 3BXNB 5I74B 3IDIA 1KIQB 2Q20A 2NY4C 4H8WH 4P4KD 2F19H 4YBHA 3TYGL 2B1AH 4G8EA 4EQ2A 4LSTH 4MXQD 3WFHA 3OXRA 1JNLH 1Z3GH 3S97C 3AY4C 3RHWF 5DI8A 3MRCB 4WWKA 2XNAB 5FUCE 1P7QD 5I30H 3U0PB 5DK2A 3IXAB 1F3JA 2F53B 1LK3H 4LDLB 4BJLA 1EEZA 3T3PF 1E4XL 3VGHA 2OJZH 3REVB 4PJ7E 4Y4FB 1LK2A 3KXFB 5IJVA 3P30L 1B4JL 3SGDH 1L7IH 4GKSA 1CD8A 1QPPA 3O9WA 5EBWA 4Q9QL 1EO8L 2EDHA 5I71C 2CRMA 2DTSA 2JLLA 4ZS6D 4JFDB 4MQ7A 3FRUB 3MRIB 1FZMA 1HXYB 5H35B 3EO1B 4LDOB 2F5AL 1A5FH 5LBSH 2QSTA 1KFAL 1QACA 1IAIM 4L9DA 1U8NB 3RGVA 1ZTXH 1VGKB 1F11A 5DRXB 5B38B 4KK8D 2DLIA 2NXZB 3FQTB 4MNHA 4NO0D 5FYJD 4R3SB 2XZCL 1MRCH 2DQTL 4I77L 4P2OB 1TZGH 5AUMA 2R9HD 2NW2A 4M1GL 3IRPX 1RZFL 2HKFH 3O2DH 5LG1A 3K74B 3T77A 3HB3C 2JB5L 5DSCA 3VXME 3ALXA 5D7IE 3PWLB 3MRJA 1I9EA 4ODWA 3F7VA 4PJCA 4CVZB 3QUXC 1FVDA 2RIKA 3QDME 4OFIA 5I1LA 2BSTB 2YR3A 2DTML 4IRJC 1NFDB 4F3FB 2FX7H 4NZUH 4Q9BA 4BFBD 5JNYA 5LQBL 2VWEC 1Z9SA 1C8PA 1RUKL 2F8XC 1HOCB 1IQWL 3IDGB 2CRZA 4DGYL 4XXCC 2EYSB 3I50H 3Q6FB 1JF1A 5DEGA 1WCQA 4PJ7F 3CFEB 4OJFL 3MJ9L 2AJVH 5CEZE 3QG7H 1NDMB 3MLTB 3P40A 2WBJB 1M7DA 1K85A 5FUOL 2W9EL 3BRGC 1NUFA 1QEWB 1BQHA 1GCFA 5I73C 1V3KA 3BKML 3V6ZA 4M6NL 4P4KB 2A0LC 1F5WA 1VERA 3DETD 5AZ2H 3VFOB 4ISVA 2IH3A 5TJWK 4BQ6A 4UT6L 2H3NA 5C0GB 1HIMH 1BD2A 1WC7B 2DWDB 1FAKT 2OP4L 4N0YH 2EE2A 4QHKI 2CDEB 4Q6IA 5BV7C 1I9JH 1F4YL 3CDFA 3RL2A 5D7IF 4ZUSB 4EUPG 1ZLSL 3RVXC 4LIQE 5FA4A 1UKSA 3RTQB 4KJWD 1OTUD 2BK8A 3QPQD 4R90L 2C9AA 4APQC 4WI3A 4R7DA 4YEFA 1YN6B 1OB1B 3LIZL 3C9NA 4H5SB 3ARGB 3EYSH 3RVUC 2BVEA 4QRUB 3O2DA 4H1LH 2WZPD 3T3MF 3RJDA 4PYGA 1F4AA 1WAAE 4D94A 3MLWH 4YBQD 5HVHC 2XQBL 3VXSE 4X6CE 2PO6D 2FIRT 4JFFB 4OT1H 3QIWB 4J7RA 4XXDB 2AV7B 3CX2A 4D8PB 4U1NA 2ARJB 1EMTH 1UB6B 3HI1B 2Y36L 4HV8A 3QXAA 2IPUK 4PUBL 5CBEB 4WV1A 5D71L 2I9LA 1LO4H 4R96A 4DGIL 1T04A 5KSVB 1YY9D 3BH8B 3GHEH 4D9LH 3GSWB 5FYLD 1U36A 5L8KB 4UTAL 1SVZA 3BZ4A 1P5UA 3VGGA 1BQHG 3TBWA 4FP8L 2CIKA 5KANG 1FFRA 1NAML 3AREA 3U36A 1HSBA 1M7IB 1QRND 5L0QB 1JE6A 3O8XD 2V2WB 4X6FB 3MBED 4RNRA 3QPXH 1MQKH 4WVRA 1NGWB 2R4SL 4EI6B 5IEHB 3VG0H 2FSEB 2CRIA 4XP1L 3UYRH 3Q48A 1QYGL 1MCWM 2GI7A 1KTKE 3WS6C 1PKOA 3WNOA 2PW1B 4Z6AT 3ARFB 4MXWH 4XPBL 4G43B 4KKBD 1FE8H 1MY5A 5EOCH 2P8PA 1FFPB 4KROC 2R2EB 5MEPA 5ISZA 1CE1H 3U9PL 3PWVB 1DLHB 3STBA 4MA7H 4NNYB 1IM9D 4DTGL 5F1NB 1WAAF 2VLKB 4NBXB 1LDPL 3Q6GL 2HVJB 4GRLA 3O2WH 5DD1H 1MF2H 1YEDB 2AJ3A 2DS4A 2J4WL 4PGDB 3GJFB 3U7YL 4U6TA 2HVKA 3FTGB 4X6CF 2VDMH 4KMTL 4HC1L 3ES6A 1EUUA 4M61B 4OZGF 4JFYA 1P4LB 5CEXA 3E3QE 1T1ZA 2XKNA 1AY1H 1U8QA 2JELH 3T65B 5DURD 3CLFL 1YNTB 5DJXB 1SBSL 3RWGA 4DZBB 4Y5YC 3C8DA 4RWHA 1MCHA 3DHMA 4H1LA 4KKLD 3PQYA 4U2ZA 1NFKA 2IPTH 1WFOA 3UBXI 1GZPB 3VFRB 1AO7A 4BQ9A 1UH2A 1CDJA 4OLXH 4AENA 2B20A 2Y07L 4UT7L 4BZ1H 4LHUG 4HAFA 5E9DA 2LU7A 2XT1B 4GUPA 2HYMA 4W68A 1OAUL 2EDBA 3RVTD 4LVHC 1A6AB 1YNLH 3C5JB 3DX7A 5IB5A 1ZA3B 1MHEA 2HH0H 1MEXL 4NJ9H 4QRSA 1P84K 2ZKHH 3QDJD 4UV4L 3F65A 1UYWH 32C2A 4NGHH 3I9GH 1NANH 3AS3A 3PWNB 5FDWA 5HY9B 3QQ9C 1GYAA 1NCWL 4XPHL 1T03H 1G7MB 5DT1H 2PR4H 3ARSA 1B0RA 4UIMB 5T3XE 5EU6D 1PEWA 2UY6A 1J5OL 1RZKL 5B3NA 1XF3B 1BFVH 2BXZA 5TQ2L 1WWCA 3BESR 2IBZY 3VGDA 1Z9MA 4R7NA 5IESL 5DRZA 4LOUD 1IBGH 1MJJA 4P23D 1QRNB 1MIMH 4LKXA 2WQ8A 1A4JB 1T20A 3O8XB 1RJLA 3DROB 5E8DL 3PV6B 3BIBX 1HYRC 5I6XB 2B1HH 5CGYD 3D39D 4MQXD 4KZDH 1LEIB 3ULUD 3VWJA 5J06A 4LSVL 2LTQC 1FGVH 3TJEH 2N7AA 4Y4FC 2MCPL 1FNEB 3O3EB 2H1PH 1KTLB 3D3VA 5TFSL 1VGEL 3T4AB 4FFYL 1J8HE 5IVOA 3FOMB 5BQ7B 2QHRL 1KFAH 1RHHA 4NKQB 5AWNL 4TRPL 5GXBB 2XPGA 5C9JB 3MV11 1E4KC 1ZT4B 4OLZL 2BVQB 4G9FB 4MZ2A 5T3ZE 1P2CB 3QUMH 1IM9B 3R0NA 1NBVH 3QEQD 1A6TB 3SQOH 5HHPB 2NXZC 4ZXBC 2FHFA 3BP7A 3NCCB 5T5FL 3H42H 5BRZE 5HHMD 5C07A 4JVUA 1JZ3A 1JMZA 1XF2B 3TV3L 3LMJH 3MYZA 3GDBA 5KVFL 3WJJA 4P3CL 4WW2B 3V0WH 4UT9H 3MJGX 2Y6SD 1OLZA 1C1EL 1LP9E 3CLEH 3EO9L 4FXGB 3MFFB 1QSEA 4RAUB 5E6ID 2P4AB 5JW4Q 5IB3A 4AH2A 5GGTH 3N85L 2P46B 4TOYL 1I9RH 4JN1L 3U1SL 3FB8B 4BKLB 5JOFA 2HLAB 4X99A 4X7FC 4OZ4B 1IQWH 1I8LC 5JDSA 4YHLL 4NN6B 4RX4A 1NEUA 1QSFE 2X6MA 3F5WB 5T1KA 1HHGB 1P4BH 1IGTB 2IANE 4UBDD 1MFBH 4PREB 3DSFH 4YFLF 2H32H 3QSKB 2K7QA 5C0DA 2QADB 4ODTH 5JO5B 5GZNC 1YPZF 2VAAA 2WBJC 1X5XA 5GGRY 3HZKB 1JF6A 4FZEH 3V5HA 1HQRA 1EHLL 1U2CA 1QFWI 4WW1A 3GJEA 3IKCB 2R1WB 5ACZB 4PJEA 1ORQB 4YX2H 3WFBH 3TWCL 4P4KC 2DYPB 3RY6A 4IDLA 4OKVA 1CF8L 1MIEH 1FO0H 2AJZA 2GJZB 4JPVL 1QPXA 4U49A 1S7WA 1KTDA 4U0RB 4PJ7A 2ESVB 2YS4A 3L3JB 1T89A 3KPNA 2J8UB 1CFNB 5E8EA 4QRQB 5IMKA 4I3SL 1N7MH 3BPCB 2LFGA 4L9LC 1RZ8B 1CGUA 5BS0E 4AM0A 1D7FA 3VD4A 3OJDB 5CGMA 4PJXE 5J57B 4TUJA 3SBWC 4YHOH 3QUMA 2QKIB 3RTQC 3LIZH 3HC3H 4AL8H 1B4RA 5FHAH 2OK0L 4ZS6C 1A47A 3T0EE 4DVBA 3QUZD 4PJHE 5GRXG 4X6BA 4X7TA 1T83C 4RGNB 3H3BC 2RHEA 2B0SH 3LN5B 3WO4B 1LNUA 3GI9H 2ADFH 3MUJA 4N9OB 5D7JD 1JVKA 2FD6L 5HHMB 3UPRA 3RPIA 2Y36H 3WEXA 3P11L 1WF5A 2R9HC 3QIWC 2K7PA 3BI9X 5D7IA 5L2KD 5GGTA 3BHBB 1UWEL 2V5SA 3DVNA 5D71H 1JPGA 2XWTA 3R06B 3A6BL 1KACB 4L3AA 4KDTC 1VSCA 4X6DE 1BJMA 4UTAH 4AT6B 5CP3H 4OKDA 1IEAA 1K8DB 4U6XA 5CJQH 3VJ6A 3CSGA 1J1OL 3QXTA 1R3KA 1GGBH 4PJFB 4L8CA 4HZAA 2VQ1B 43C9A 4LGSB 3BQUD 5TE7H 1QBLH 1CK0L 3ZTNL 1N6VA 2H32A 1RFDH 2AEPH 4OUUB 4U1KA 1JGEA 4XH2B 1TQCC 1UVQB 2A83B 2PETA 4QYOB 3SKUD 1EGJL 1MSPA 5EBMA 3Q5TA 1MPAH 2P5EB 4Z77B 2EYRA 5GSVA 3SEPA 1KLFA 4PJBA 1RZIA 1IAKB 4PJXF 4XMKH 1BFOB 2H26A 3AU1B 4QXTA 5HGDB 1Q38A 1QBAA 2WIIB 5C0JA 3ARFC 1FO0A 3FO9A 1RUMH 5FGBA 1PSKH 1CBVH 1QLEL 3LEXB 5D1QD 2ZSVA 3SKOB 3OR7A 3TNMA 3O41B 2O5ZL 1G6RB 1RI8A 1R3LB 3FT2A 4KMTH 5DHYA 3ZO0A 1P1ZB 3OGCB 3PDOA 2P5WD 4HMCA 3U82B 5DJDA 3TNNB 5EBLA 1N59B 4L5FL 1J1XH 1U3HB 3CDYA 3P0GB 4K3DH 1JPSH 3KPOA 4NO2B 5DMGD 3EDKA 5GRVL 2Q8AH 1CCZA 4X6DF 4L29B 4LBEA 3L3KA 4MJ5A 3RNQB 3U0WH 3VXMB 2YK1L 4NOFA 3KPPA 5DS8A 1DBJL 4ZO7A 4S0SD 4U1HB 4M6MH 4KZEL 4C55A 2DQCL 25C8H 4KJWC 1OTUC 1IT9H 3QDMB 3QEHB 1JHKL 3QPQC 4FMFA 4PJ9A 3MA9L 4ORGB 4PYHA 5GJSL 4YHKL 2Q87A 3WJLC 5IB2A 3VXUB 1CT8A 1OAUH 1WAAA 3FQUA 4KWUA 5EIIA 3MV01 2KPNA 4L4JA 1A1MB 4X4ZA 4KK5D 4J23A 4K71B 4ZAKA 4OZFH 3VXSA 3P9MA 4G8GE 4X6CA 4LPYA 5H8DA 5KVEH 2X89A 3MRFA 3MYJB 2OJEA 4OZGA 2R1YA 5D7JB 1ZGLM 1AJ7L 4YEEA 4YBQC 3HS0A 5HHOA 3IT8D 3FB5A 5CP3A 2PO6C 3MRMB 2MQ3A 3BYTA 3MV7E 4LLQA 2R2BA 4ZG1A 2ZOKB 3W11D 1BJ1J 1Y0LB 3HCVB 1O7SA 2A6JA 2EDRA 4YZFE 1L0YA 2IBGA 5IFJA 3T8XB 3X3FL 3V4VH 5F3BA 4HWZB 4WTXA 5DJCA 4ZUTA 4U1MB 3RWHB 5BJTA 4LLVA 4Y8DC 3RA7L 2GAZB 5TE4L 4HMDA 5AG8A 3OAZK 2NY6B 1M1SA 3AY4A 4M1CC 3RL1A 3HHRB 4R26L 3QCVL 1KCRL 5JOPE 1F4WL 1AP2A 1G0DA 3O8XC 4JFEB 4RFOH 3MBEC 3HNVH 4OCRH 3QWQB 2A77H 3TFKC 5I6XC 1CDGA 3T2OA 4WJ5B 1KNOB 1U95A 4AEHH 4W70A 1FC1A 2WP3O 3KPLA 4G6KL 2QHRH 3LN4A 1JGLH 4XBEH 4RZCB 5KVDL 3LRSA 3HUJB 5EO9B 4OLZH 5DYOB 3RGHA 2J88L 3VFUB 2ADJA 5BV7H 5DMKA 1RIUH 5E2WH 2JCCE 4PRID 1L4IA 5FYKD 1BZ9B 2AQ1A 1ZS8A 1AIFB 4UDUA 2DWEA 5D1QB 1WWWX 3N1GC 1SEQL 4C59B 5I8CB 5CD5D 3BUYA 4XWGL 1EIBA 3EGSB 4AG4H 3WS3B 1JL8A 1D6EA 1J86A 1JIBA 3B43A 4M8VA 4MCYB 3WLWD 4X4MA 3T2PA 4JPIA 3IFOB 5EC2A 1ZHNA 3EO9H 1XGYH 3WFCH 1JZ2A 3W9EA 1KJVB 4FTVB 1W2KT 3UMTA 1T1WA 5L8LB 3GK8L 1IZKA 4XZUA 4OZHE 3LH2H 1ETZB 1VB9A 4W81A 3EYQD 3FO1B 3MLUL 3PDGA 4YZFF 3SE4C 1IGYB 3QQ3A 4LEXH 1H3PH 4XBGB 1UZ8B 3DPBA 3QUXA 4OZFA 4ZNCD 3CZFA 3TT1L 1AXSB 3WXWH 4KKLC 1XH3B 4H88H 4NIKB 3TBSB 5K9QI 4ZPVB 2BNQE 1S7VA 2E7MA 2MHAB 3L7FB 2P8MB 4NUJA 2SEBA 3VH8A 3RVTC 1JBJA 4OF8A 5BCAA 3K8KA 4XXCA 4Z0BL 4I5BA 2A6IA 1QLFA 3PHOA 3DYMA 1XF1A 4U3XA 1T21B 3DNKA 3X13A 5C09A 4MA3A 3HNSL 3QWOB 3MMEB 5GGQH 2JCCF 1OP3K 4BZ2L 1ZA6A 3X12A 1N3NA 3HAEA 1EJ6A 1RPQA 5KZCB 1NGZB 4F7TA 1UJ3C 4KAQH 3CDGB 2I9TB 4QF1A 3L3HA 5EB9A 4X9GA 5HYJE 2HFFA 4LOUC 4P23C 4W6WB 1XR8A 4U0RC 4HS8L 3ECBB 5ERWB 2FHCA 4P46B 1YPZA 2OM5A 5FA3A 4MQXC 1CLZH 1AGCA 4XVSL 2C4XA 4WUUB 2DIJA 2VABB 4M7ZB 4XX1E 2XV6B 5GRJL 3EOTH 5FO7B 1MWAB 2EXYC 1UM4H 3FRPA 2Z31B 4APQA 2BNRB 5LXGH 3H3PL 1S7RA 4NQDA 5EZOH 5LAXA 2J8OA 3QEUA 4G6AD 5E99H 1PYWA 4RGNC 1T6VN 1CL7I 3MJ8B 3CFCL 5IKCB 3GHBH 3MGAA 5KN5B 4FOMA 2V5RA 4TULL 3VMOA 3H9HB 3QISA 5F1OB 3DTXA 4P9MH 2BJML 2V17L 4LVOB 3QUYB 5JIHA 1CLCA 2EKSA 4JLRA 3GJFK 5EOQL 1BAFL 4EOWL 1JZ5A 3L3IA 3PWPD 1YY8A 1X3DA 3CMOL 5DQJB 1S9WB 4P5TD 5SX4H 3OKMB 4FFVD 2HT2D 4MDJA 3DV6A 3KG5A 1FVCA 3O4LD 3G6AA 2NYYC 2ZZUT 1R3JB 5ESAA 1G7JB 3SE8H 5E6IC 4D3CH 3B6SA 2WUCH 4CDHA 3M1BA 3T0WA 2RB8A 1OAXL 1A1OB 2IANA 2O26U 4WTWA 1RZ7L 2BSRB 2GCYA 4ZTPL 4UINL 5IMMA 4Y16D 1GGIH 1PG7X 4Q0XH 4XCFH 3BKJH 2WQRA 4KHTL 4XCEB 1XGTB 2QEJA 4UBDC 5IW6B 5IQ9B 4Y5XC 3B2VL 4TPRL 3EZJB 5HBBA 4YLQT 4OCMC 1FNHA 1FYTD 1K4DB 4YBLB 4R6UA 2QLVB 1DBML 4P4RB 3LKPA 3WS6A 3G6JE 3HLAB 3MOBH 3ARDD 1CLOL 1FLTX 3ZYIA 2X9WA 3DECA 1ZGLP 2IJ0C 2IFFH 1W0WA 2D4DA 4Z7QE 4LPXA 3WNLA 5TQ0L 3MJ6A 1A7OL 3CVHB 3V0VB 4YDLB 2R0KL 4C54A 2XYCA 3QCTL 4G3YL 3FO2B 5E08H 4LSDA 3RI5K 3JTSB 3QAZB 4L8SC 4JJHA 3RWJB 3ZE1E 3I2CL 1NGXA 1IAOA 1U3HC 4XCYB 5FF6B 3RDTD 1OQOA 1SYVB 1MJ7L 1REIA 4K7PL 4KY1L 4P2QA 1LP9B 3W2DH 4PRHD 1XF5B 3T0EA 4AK1A 1HHJB 4RAVA 3JUYA 1UACH 3RX5A 1EAPA 1KN4L 3B9KD 2NY0B 3OKEA 5DMIL 2G2RA 5LGHH 5KOVC 3BP5A 4R4FL 2DIBA 3K46A 3CFJB 1YA5A 4AEIH 3P4OB 1N4XH 3QUZC 2APWA 3RNKA 3HG1E 3V5DA 1QUNA 4K71C 3SGDI 1QSFB 3S35L 2PF6A 1C08A 1SYSA 5FHBL 5J89A 3P0YH 3OAZH 1ZVYA 2FYYB 3CFIC 5C0CE 5D7JC 1NMBL 4HZLA 1RUAL 3LZFH 4U3CA 4FXLA 1K2DA 4NYLB 1KCUH 5TPWL 2YMXL 3PWPB 5HI4D 4CDGC 1URLA 3C08L 3CVIL 5I8OH 4P5TB 3HC0A 4MA8L 3MOAL 3QDJE 3INUL 3O4LB 4UV7H 4FZ8L 4OZIE 4Y19E 1UJTA 1ZEAL 1MOEA 4OQTL 1FAIL 1H3GA 4Z7QF 4L4VE 1HSAA 3DX6B 3HMWH 3BQUC 5IM7B 4MB4A 4OFPA 2NY6C 3DGGB 4YDKL 3I6GB 4YDIL 2GY5A 3TM6A 3L5WB 1BP3B 1CU4L 3BWAA 4NHCH 2HTKD 2F5BL 4ZS7H 4JRYE 1Y18B 2F53A 4G6KH 4K7PX 4YR6B 2VIRA 4YXLL 3MLVL 4XPTL 4N90E 5BS0B 3KXFA 5I75B 2EEAA 1I75A 3RAJL 4OCXL 1GOHA 4P57A 5CFHA 2XXMB 3OPZH 3RY5A 3ULUE 3S98A 1PY9A 4HDIA 1G84A 3UTTD 1HXYA 1T7YA 2F58L 1E4KA 2NW3A 1Q9KA 3H3KA 4PJHB 3S35X 1SJEA 4NUGL 5MP6L 5B38A 3TJHC 3DRQA 4HK3J 5D1QC 3JWDL 5KJRL 1X5ZA 1F90H 3FQTA 4ZXBA 4OD3L 3NFPB 3NVQA 4RDQG 1NDGB 5LWYH 3BEVB 2NY3D 4N0UB 4Z18A 1Q0YH 3RWDB 1MI5E 4F33A 4LCWD 4WI8A 3CDCA 5I1IL 5DMGC 4LPCA 5FYJH 4F7EB 1YNKH 5DEFB 4OZIF 3GSNA 1I1AD 3TT1H 4G7VL 1QBML 1QR4A 4CVZA 1VPOL 2BRQA 1T3FB 4G8GA 4JN2B 1DSFL 5BVPH 1OP3H 1I8LA 4YUEH 5F9JB 5CSZA 4MD0B 1XFPA 2XFXA 4Y2DD 1BBDL 3QRGL 2CKBB 3E0GA 4KK5C 4O9HL 2UUDK 3EOBB 5IW3A 5J3HD 2PYEE 2P43B 3S3JA 1LE5B 4IRSD 3RWCB 5CUSH 3HPLB 4QTIL 4QXGL 3Q6FA 5DHVB 5JHDE 4ETQA 3MRDB 4Z7VE 2WINB 5DQDL 5BW7C 4P59L 4RMTA 3ZKMD 4JFXB 5IFHH 4HFWA 4CAGA 3CH1A 4A6YH 1NDMA 1MFAL 4OD1L 5IHLB 3AUVA 1VCAA 2A9NH 2WBJA 3ULUF 5E2TH 2H8PA 5EN2A 1JGDB 1MCPH 1NL0L 2IAMB 3GMMB 1P6FA 4PJGE 5E2VL 2KZ1B 1W72B 5DXWA 5C0BE 3TPKA 1PBYA 5FV2A 4P4KA 1T7ZA 5SWQB 1V3JA 4HKXB 1ERNA 5SWSE 4DZ8B 4UQ2A 1KOAA 3MGOA 1TTGA 2EH8L 4R8WH 1PG7H 1P7QA 1XF4B 3X3GH 4DCQA 3FT4A 3RWFA 3KPTA 2DWDA 4Y4HB 1EHNA 2D7OA 3MNZA 4FQHB 4EQ3A 2ENYA 4J3OC 3U4BL 4L9LA 5DVLA 1BOGA 5GRJH 2X1WL 3ETBF 5F1KC 1MCBA 4J3SA 3GJFH 3SBWA 4ZUSA 3BAEL 4M6AA 2JCCA 4YGVB 1G6RL 4BZYA 5IOPB 2FGWH 2A6KA 2HT3D 4KRPD 3NACH 1LO2H 2APFA 2MKWA 3IU3A 2DQFB 3K2UL 3UTTB 5F7KC 1YN6A 1OB1A 1T83A 1JTTA 5IIEA 4H5SA 15C8L 4PB9L 5A3ID 1VEOA 2P42B 3JZ7A 2PCPB 2VZSA 4QRUA 2VDRL 2R39A 3ELAT 4GW4A 5CD5C 3AMLA 4NO0A 1HH6B 5EOTB 4PRPE 3RVVD 2Y5EA 3QJHB 3VFSB 4Z7VF 4LVOC 1Q72L 2AQ2A 1QLRB 4M7LH 3QUYC 1KG0A 4M62L 3WLWC 4GG6F 3K0WA 4XXDA 9CGTA 4D8PA 1K8IB 3S4SA 1UB6A 5EU5B 2XA8L 3CFKA 2GUOA 5L88H 3BKCH 1OGAD 4HMEA 2ICES 4KDTA 5INDA 2DN7A 2EDWA 3I6LE 5L2KE 4YDVB 5E8NB 1LEGB 3THMH 5F71A 4ODSL 3CXDL 3OHXA 4WY7L 5CEZL 2FX9H 4D0DB 5E6ZA 1SY6H 1ZGLA 2VH5L 4IS6B 4ONHB 2B8OT 3QYCA 4A6YA 2YD3A 4XNMB 5FYLH 2YPLE 4Y88A 5DUBA 4YIQA 1NCCH 2GJ6E 4GXVH 1NJ9A 2I5YL 1HWGB 1A3RL 4WU7B 2ZCLH 1I8IA 3D6GA 4YBLC 1E6OL 5DVMA 2IMNA 4Y1AB 1A9EB 5IT2L 3DVGB 4X7DC 3SDDD 3U46B 4BFEA 2R2EA 3VE0B 3FONA 4NZTL 4TTGA 3WXVH 4NNPL 3MLXL 4YK4C 1DLHA 4PJAB 3HI5L 4NM8H 1NANI 1WIOA 4NNYA 2R0KH 2EDDA 3NTCH 4G3YH 5F1NA 2X41A 1G9EA 5AEAA 4IOIB 2HVJA 2Z35B 4YDLC 2G60H 3OAYK 2LQRA 4KGJA 4QOKD 4V2CB 5BO1L 4LIQL 4BK4A 3FTGA 3VFVA 1NQBA 5D70H 2VZ1A 4I3RH 3OKLA 3EHBD 4OF3A 1JYWA 1IAIL 3CNKA 3T0AA 3VFWA 2P5WE 4OZHB 1XIWD 3NCEB 3JTTA 1MRDL 1YNTA 2C1PB 5DZOA 3MRLB 5JXAH 1T5XB 4G8IB 3LN9A 4ZFGL 1E4XI 3BIKB 5D5MB 1PD6A 1YMHA 3O6FD 1PGRB 3WJLA 3BN3B 5IV2A 4OF0A 1FDLL 5IROC 1RQ5A 4HUXA 2OTWB 2BNQB 3S7GA 2Z93B 1FZJB 3S88L 3R4DA 2D31A 4GH7B 1I3GL 4HPYH 5MI0B 3GBLA 3KYNA 4U1JA 2AXHA 4LGRB 3OF6D 3HR5B 1ZA3A 5F3HB 3OKNA 2YMXH 1FZOB 2OR9H 4GS7B 2CLRB 4E41E 5FOJA 4L3EE 1AR1D 2PO6A 3OZ9L 5F8RC 5I18L 1RULL 1B0GA 5HY9A 3PWNA 4NQED 4P5TC 1G7MA 4FFVC 4HBCL 4FS0A 3CJJA 2HT2C 3O3BB 1OGAB 2F8OA 1SY6A 5A1AA 1OARH 1VADA 4ZQKA 2DI9A 3EYVB 3EYOB 4MJ4A 4EBQL 1MREL 3HC4H 3S5LA 4KK6D 4WFHE 2R0LH 4LLDA 5I76B 1I4FA 4PP2A 4JG0H 3SCMD 1QRNA 2G9HA 4D9RE 5HYJB 3IGAA 3O8XA 1F13A 4Y16C 1ZLWK 3MBEA 3QIBB 3QDAA 1YQVH 4F9PC 3RAJH 4I0CC 1TVDA 4CNIB 1OAQH 5I75C 1LO5B 3A6CL 3O3EA 4XPGH 3T4YA 3GMPB 2OQJA 1QFUL 4XNZC 3P4LA 5HPOA 3FKUS 4XX1G 5HVFB 1PFCA 3D5OF 1RU9L 5MP6H 2VDOH 3ARDC 3MLRL 5I19H 1T5WA 2YA2A 3MNVB 4RRPG 1ZVSA 3MJ7B 4OD3H 4NC2B 3GMNB 5D6DC 1I7ZB 1MH5B 3U2SB 1IM9A 3E6HB 5HHPA 1IJ9A 1OAKH 4LCCA 3VFNB 1ZT1A 5EU7E 3SY0B 1AGFA 1LD9B 5B8CB 2GFBB 1CGYA 3S37X 4HLZH 4ERSH 1KEGL 2ZUTA 4JG1L 2UUDH 2IH1B 4S11A 2H41A 1QSVA 4HLJA 5FFLA 1U8KB 4HD9A 1DUYA 2UZYB 2VXUL 3HPJB 4FXGA 2VKXA 3NABL 2EXWD 3K4AA 3MFFA 4MMXC 1QKZL 4MWFB 3CSYB 5DD3L 3BJ91 2CXGA 4TN9A 4NSKB 3B9KC 3F6IA 2R69L 3O6FB 1CGVA 4MJIB 4NWUH 1OF2B 1IMHC 4ZOEA 5DTFB 2CDFA 3WFEL 3QB7C 3NZ8B 3QHFL 3BD4A 1JHTA 1HHGA 4PV9A 4OCWH 5T3XL 1A7NL 5C2BH 1S8DB 2V7NB 3LHPH 1MFAH 4X6EA 3R1GL 3QDJA 1XCQB 3HFMH 3OKDA 4OZIA 4MVBD 4XP4L 5IVNA 1FJ1A 3GKWH 3G6JB 2GITA 3HE6D 2VLME 4YC2B 2VISA 3ARBB 2IAMC 5EU6A 2R1WA 5ACZA 2FBJL 2UV3A 3PNWB 5EH1A 5DJYB 5DJ8A 1MRFL 3KPQA 3BO8B 4PIRF 4G6ML 1UJ3A 3IJSB 4QEGA 1ZWIB 4OLYL 2IALA 2HTLC 4P23A 3X11B 4P99A 1KB5A 4R0LB 1U6AL 4Z9KB 2HTKC 1S9XB 5I16B 2J6EA 1AKJB 1CFNA 3KPMA 3NCJH 3D39A 2E9WA 2X4QB 4MLIA 2R4RL 5IHZA 5SWZD 5F88A 4UQ3A 3BMWA 5T3ZL 4EDXA 1CFSB 3OTTA 1MCDA 2QQLL 3L5XL 1U92A 1KB9J 3OJDA 2X9YA 3LKQA 5E56A 1EVTC 1KCVL 4DN3H 3RWIA 3CFDA 4ODHH 3IXTA 2VDQH 1I3VA 4M93C 3M17B 2OCFD 2CPCA 2Q6WB 3ZL4L 1H3TA 4YE4L 4GFTB 3HG1B 4WO4D 3BP4B 3O3AB 5KOMC 3ROLA 1D3CA 3LN5A 4GW5B 3QEQA 1M7XA 4HEPG 4K2UL 3FQWA 1IC7L 5C0CB 1AFVL 2AXJA 2NY3C 1KJMB 2ADGA 1JRHL 3W0WE 4BFIB 1KJ2B 1RURH 4IBLT 3D0VB 4GKNA 3IF1B 1I1AC 1E6JH 3U9UA 1SM3L 5E6IA 4Y19B 4X4YA 1FIEA 4XNYH 5CEYB 5F1IB 3DUUB 1CGTA 1A1NA 4TVPL 4L4VB 3RRQA 3VRIA 4L4TD 3OJVC 1M05B 2VSCA 3EO0B 4CW1A 4K8RL 1EJOL 4AJ0A 2VITB 5DZLA 1QFOA 3UJIH 1F3RB 4Y2DC 2H9GB 5D7KD 3BGAA 5DLMH 3V52L 4RA0C 4M9PA 4GG6A 4MMZC 4JY5H 5J3HC 2ZNWA 2Y72A 4WFGD 4CADB 4IRSC 4K3EL 4Y5XA 4JRYB 3DUHA 1M71B 1WT5C 5ESQA 5FM5M 1TTUA 3OAYH 2BDNH 2C1OB 4WU5A 2AJSL 5T5NF 5BZDA 2NY5C 1F8TL 4G8FA 4NJAL 3GO1L 2AEQL 3AU1A 3H0TB 5FKPA 1AE6L 3GSOB 4NNPH 1GAFH 3K3QA 2WIIA 3C2AH 4V1DD 4L8DA 1IZJA 5HYSG 4CBPA 1CGSH 1OSPL 4LRNL 4NKOB 1OAZH 5EU3A 3P9LB 4XNXL 3ZT6A 3SKOA 1A3LH 2P24B 4XPFL 3O41A 3QWRD 5DWUL 4Q7DA 1R3LA 1IAMA 4NQVB 3OGCA 3QP3A 1GGYA 3KGRA 1N0XH 3KPRE 5IEKA 1H15B 4L8SA 5I2IB 3ALWA 1N59A 1ODAA 4I0PD 2ED9A 1DUZB 4M8QA 1HH9A 1NKOA 4PRAA 5SWZB 5I1KH 4YHZH 4LCUB 2VLRD 1G7IA 3MV9D 3CU1A 1E27B 3SN6N 3BZFA 1JYXA 2HT3C 1FDLH 4KRPC 1KELH 4G42B 4ZFFB 4U4BA 4JVPA 1ZHLA 3V6FA 5IMOB 4N8CL 3QUZA 1WZ1L 3GSVB 1J12A 4WO4B 1KC5H 5A3IC 4UZGA 4BH7B 3PHSA 1A64A 4N0RA 5MI0C 4LPTA 7FABL 3MYJA 2PYEB 4XTRD 5D7JA 3RVVC 1HDMB 3O11A 3S37H 1T1XB 2BSED 1BLNA 1UWGH 1JGVL 4WRLA 1L7TL 4HFUL 3GSUA 1JYNA 4M7JL 2Y7QA 5L2KA 5JR1L 4F37F 4LU5H 1WVZA 3ILQD 5IGXH 1Y0LA 3EJYD 2CKBL 4KQ4L 4XC1H 2YEZA 4DKFH 2NQCA 4NO3A 4KV5F 3C6SB 4NC1C 4X8JA 3CZJA 1SVCP 4HWZA 4OB5H 2EZ0D 5F9OH 2GAZA 4P5KB 4ONGH 4OCYH 1BGXL 1UXSB 3BQUA 4FQXD 5L9DL 3NBNA 4HS6A 2GSGB 4MDIB 4XWOD 4JRXD 3ZE2E 5SWSB 1F6LL 3W5MA 2YUVA 2CJUH 1TCRB 5E2UL 4N0FB 4MAYD 4U0QB 3FO0L 5ID0B 2HJKB 3A6CH 3FFDB 1W72L 3TEUA 1V7ML 3WD5L 1GH7A 4LRIC 3N0PB 4LFHG 4UI2A 4KKNA 1WISA 1FN4A 4JY6A 4HUVA 3QULA 2VLJE 2ZG3A 3G5VA 3HUJA 5TDPB 5EO9A 4XAKE 5C9KA 1XR9A 4NZRH 3ZKQD 1Z0NA 3BDYL 3DRTB 3QFJE 2X4UB 4OCNC 1AGBB 4O2CA 5FK9A 4WHTA 1JN6B 2LAAA 5HTSA 5D1QA 3VXNA 1T2QL 2YPKB 1MWAH 4Q2ZB 2DQIL 1TZHB 5CAYB 3IJHB 1U8PB 5DJZA 4OBRA 2P5WA 5FYKH 1MVUA 1PKQE 1S3KL 2HRPL 3MRBB 3MROB 4MCYA 3ZSSA 5B8CC 1TJHH 4KI5D 2KBGA 2OMBA 3GSNL 3EHBC 3DXAD 2YN5A 3HI6L 5I1JL 5K9KA 1N5YL 3V6OC 5DD3H 1XIWC 2VXVH 5JW4M 1IILE 1F6AB 4H20H 4YHIB 1GGTA 4X80H 1CQYA 2RCSL 1WBYB 1T1YA 3MOQA 4PFEA 4DN4L 3KYMB 4XBGA 2FATH 3S96B 1UZ8A 4ZUVB 3MZGB 1AXSA 3V4PL 1ED3B 1XH3A 3GBNL 4KKCD 1G7HB 1JPFA 1KYOJ 1P7KA 2VOTA 3O6FC 4X7SH 4XP9H 2EIEA 4KTDL 4ZPVA 2Y25A 3ZE2F 1EK3A 1A7NH 3FCTA 3GUTA 2ICEA 3L7FA 1KUMA 1TVBA 4D0CB 3O2VH 2J1KA 1MQ8A 2EDEA 3UZEA 3BT2L 1D5IL 1CXLA 1NCDH 3KAAA 2YPLB 1MLCB 4K94C 5T1MA 3MV8D 2GJ6B 5FOBB 4OI7A 1X7QA 5BW7A 1DLFH 5BVJA 3B8SA 4F15B 2A1WL 4QO1A 4WTZG 5EO0A 4HUMB 5TH2A 5EIQA 5ALBH 2FECI 4PGCB 1R0AH 2E27H 1R5IB 4YC2C 1NLDL 5EPMA 2DM4A 4ENED 5AAMA 3L95B 4X9HA 2GKIA 2VZ3A 1ZHBB 1D9KD 4KK6C 2V9QA 4M3JA 2XKUA 3FQXB 3IFPA 5C0AE 4FQXB 3SKMA 5SX4I 5CHNB 5FGCE 3CDGA 5T1DL 4ELMB 1S7TA 1LE9B 4JRXB 5C70A 1N2RA 3GMRB 1N64L 3WUWB 1XGPB 1BOYA 5ERWA 3WUWG 2GY7B 4A2LA 4JCMA 4U7MA 5ACMA 4JPWL 3NZHL 4QHNB 4R97C 1DBKL 4OTXL 4E9LA 4OGYH 3CVHH 5HGBA 2J3SA 4JR9L 4WUUA 1FHGA 4M48H 3QNYB 3QIUB 1T0NA 5FO7A 4ODXA 1AQDB 3O3DA 3OKKA 4I9WD 3TCLA 2VMFA 4PRIA 2JIXD 5CJOH 2ZUXA 4K2UH 1A14L 1HNGA 1NEZB 3G5XB 1BECA 3M07A 3JWOC 1YEEH 5CILL 5CINL 2Q8BL 3H9HA 2AAVA 2VTFA 2R8SH 4CRPA 3QUYA 3VRJA 1FL5B 5F6IB 1DBAH 5L6YH 1JPTL 1X5AA 3DXAB 3GIVB 5HXMA 3C8HA 4WHCA 5B39B 1OLLA 1QG3A 2CKNA 4LAQL 3Q1SL 1R3JA 4TVPH 4CMMA 1G7JA 3GB7B 4DQOL 1A02N 3MUGB 3SJVE 5CJ5A 3BRDA 2DQJH 5DD5L 1A2YA 2B2XL 5EO1A 1UM5H 3MXWH 1IGJA 4YWGL 3V52H 4YQXH 1HEZB 1IKFL 5HI3D 5E95B 4K3EH 3V0AC 5IP4A 4PS4L 4ZUWB 2ICCA 3A6OA 3FJTA 4XCEA 1RUQL 2VXSL 1XGTA 4PGEA 5IQ9A 4YO0B 5CKGA 4FRWA 4HHAA 1BX2B 2MFNA 4YPGB 1J05B 4ODUA 2R0WL 1QA9A 4QRPB 2FR4B 2WSKA 3HRZB 4PJIB 4XC3H 4MVBC 1F4XL 1TVHB 1GGCH 4GAJH 2VN4A 3HE6C 1X5HA 3W39A 4F7CB 3JV6B 3QUKA 2DQEH 4XPFH 3HZVA 4I2XE 1IM3B 2Q76A 1TPXC 5KSBE 2O61B 3UJJL 3FQRB 4R4BB 4U1IB 1AGDA 2XWBB 2DKMA 3CVHA 1WZKA 3IJYB 3LKRB 5EZLB 1UENA 1X5YA 2DIAA 4RIRB 1T4KA 4LLWA 2CLZA 3LKNA 5EFIA 2NX5E 1XGRA 2GTWB 2IQAB 4GAFB 5DFWH 1ADQL 3WO3B 4WDIA 4TUOB 4XCYA 1OP5K 3WHE1 3GNMH 1SYVA 4QOKE 3GRWA 1QVOB 2E8ZA 3S3PA 1ZAGA 5JW3H 2D9QB 1XF5A 4LPWA 1HHJA 2A74B 3EFDH 4CVXB 4WCYL 2AK4B 4U33A 4IDJL 4NT6B 4KPHL 1NAKL 4JM2F 5DD6B 1S9KC 1VFBB 1W0VB 2JB6A 4WO4C 3QXUA 3WKNA 2AJXH 1L7TH 3SDXE 3RVWD 1WJ3A 3MCKB 3LQMA 4HK0A 2XWJB 1P5VA 4OGXH 3U7WH 3TIDA 1R3IH 5C0RL 5EUOF 3IAQA 3BDXA 3PWPA 3IDXH 5ADOL 5FCUH 3UZQA 4P5TA 1EX0A 1MCIA 4TSBH 2GEEA 3O4LA 4NN7C 1CR9L 1CFTB 3C87A 2P47B 1FBIH 4PRBA 3W9DA 3NPSB 1UB5B 4MHHI 1R6VA 1MHPL 2OZ4L 3AXLB 5IM7A 1WLHA 1ONQB 2A2QT 4GKOA 3DGGA 4DAGL 4MX7A 2F54D 1C12B 3CK0L 1KT2B 3HRPA 4OUOA 4Y16A 1IC4L 1MLBB 3DHJA 1Y18A 4F9PA 1CTNA 1HE7A 1T2JA 5GIRA 1FYTA 2YD1A 1LEKA 4GRMB 5HGHA 4U31A 1LDSA 3BP6A 3M8OH 3WHE0 5ICZB 4F8QA 2NTSP 2ZPKL 5DJAA 3WSQL 2Y23A 3ARDA 3F7PC 4N68A 1GC1L 1S9VA 2ERJB 5KANI 2ITCB 3DUSA 5C0ND 3IDJA 5CP7A 5D93B 5D6DA 2ICWB 5IG7A 3VI3E 3VD7A 1ZVHA 3RU8L 1D5ZA 2X7LA 1I1CA 4JQIL 1NDGA 4OFYD 8CGTA 5IBLD 3IFLH 3BEVA 4XPAH 2X4SB 3RWDA 4QRRD 2IMMA 1OAYL 5HI5D 3UTQA 3QZWA 4N1EA 3EBAA 3W0WB 4UB0H 4D2NA 2B4CC 3RDTA 2G5RA 5ANME 1I7RA 1P4IL 4F7EA 3DX9B 3V9FA 2NR6D 5SV4A 3IS0X 4PRHA 2QR0B 5F9DC 5C2UB 4GXUN 2WWMD 2EECA 3HNTL 3FT3A 1D5XB 3B9KA 4OBSA 3V4UH 3QI9D 4K3JL 1KJ2L 1HZHH 2A73A 1ACYL 5F7EL 4JDVB 4YHYC 3NFSH 2R2HB 2D7QA 2QSVA 4LNRB 1CICD 4TSCL 1A22B 1LE5A 4ONFL 1BPVA 4XTRC 4TTDC 4LKCB 3DURB 4I18B 5I1HL 4JFXA 2ZJSL 3AB0B 2XRAH 2NY1D 4MNGE 1T0MB 1MFEH 4OD2A 1B0WA 3ILQC 3EJYC 2WK2A 4F58H 2AGJH 3C6LD 1X6NA 2PN5A 4F7MB 3H7LA 1JGDA 4QCIA 3VXOA 5LVEA 2X44D 3PGDA 2NY5H 3VDAA 2XN9B 4UDTB 3V8OA 5CIPH 5SWQA 1E28A 1KB5L 3QO1B 4FQXC 3ULVE 4N8VB 4DZ8A 1CQKA 4M4PA 2UZIL 2V2TA 4XWOC 3VXTB 4FQLL 1DBKH 3KPRB 4JB9L 1XF4A 3ULUL 4PG9A 5E5UB 2EEBA 4OLVL 3UC0H 1CXHA 4MAYC 1KBGL 1YN7A 2IGFL 3FQNB 3VXQA 4NP4L 3V2AR 4AY0A 4WEMB 3GBML 3KR3H 3WCYA 1K5NB 5IOPA 4XP6L 4H25B 4WI2A 2WAHA 3MCLL 1TNMA 5DZNA 3TBVA 2DQFA 3U30B 5HDQH 1QQDB 3UTTA 1GOGA 4XMPL 4ALAL 1YUHB 4QHLB 4LLYB 5TF1H 5J1TC 3HZMB 5GGSB 1PKQA 5EBGA 5HPMB 4K23L 1UA6L 5EOTA 1A21A 4BH8B 4X9IA 2CGRL 2R29L 4Z0XB 1JPTH 1YEKL 5F6IC 4MNQE 4KI5C 5EULV 5HHVH 3SKNB 3WV0A 4LCWA 2LVEA 1R5VA 4XRCA 5E0QA 3O0RL 2QQKH 3IYLW 2K9UA 5HGAB 1BJ1H 2I60H 3DMMD 3KJ6H 1I1AA 4W4OC 3K4DA 5CD3B 3B4NA 1I85C 2NMSA 4NQSB 3DI3B 2CMRH 3PL6D 1Y6MR 5HJ3A 5KSUA 3ZE0F 4JZJB 5EZIH 3ULVF 3QI9B 1FGNH 2MQCA 1AXIB 4UIKL 4MAUH 4IS6A 3UYPA 4Y2DA 4L4TE 5CBAB 4H26A 1UZ6E 4IRSA 4PRNA 1WT5A 5IVZB 1WFTA 2DD8L 4EJ1C 4JHWH 5EA0L 5F9WB 2NY1B 3NIDF 4AZ8A 5I15L 1DFBH 4PJDE 5D1XD 2N7BA 5IB4A 5CIPA 1NC2D 1UM6L 1OP5H 2VLJB 5IBUG 3LQAC 1INDL 5KTEL 3UBXA 5IWLC 3MO1A 5I1AB 3TCXA 3CUPA 1KLUA 5T33H 1G6VK 3VE0A 4IJ3B 3BW9A 3QFJB 4YDJB 3A67H 4HG4K 4GRWE 4J2XA 4KJPD 2YKLL 2DKUA 2OL3B 2XZQL 4HXAH 1NC4D 1KCLA 1H9VA 3DX8A 4P2RD 2HMIC 4QHUB 5CJ8A 4HJ0D 3VFMB 4LP4A 1HNFA 5I9QB 2HJLB 1I7UA 3ORJA 2D0HA 4FNLL 1J18A 1KPRA 2C1PA 1UKTA 4OCSH 2FIKA 3NFNA 3MTRA 1KJ3L 4OM1L 4G8IA 4KJQD 4BUGA 1NMAL 3S34H 5J1AB 1BVKB 1QFWH 3B9AA 4JKWA 1F97A 2VDPL 1NUNB 4RFNB 3PHQB 4YNYA 1AHWB 1H3WM 3MV9E 3I85A 2OTWA 3KPSD 2BFVL 2Z93A 3QXDA 2YZ1A 1AQKL 3FFCE 3PWUA 3C60B 3HR5A 5D2LB 2HAZA 1L6XA 1FZOA 3FHAA 3U7AA 3T1FA 3F7YA 3RX7A 1GPOL 1WEJL 5GS1B 1Q94B 2A9ML 4ODVH 2R1XB 1Q0XH 2H2PD 3SPVA 4EI5D 3LEVL 2D03H 4K94H 4YPJA 1DQDL 5E8PA 1OGAA 1FNLA 3L1OL 4JDZB 3DMMB 1CZ8L 3EYVA 4KVNL 1ZE3C 4ZOCA 2FJFB 1IRAY 3AC0A 3PL6B 4GRWF 4DAGH 1DL7H 4FXKB 5IR1B 3UBXG 1FPTL 5C0AB 1A0QL 5HYQA 2FJGB 4FQIH 3VU2A 4K55A 3G08B 3PE9A 5LCVL 1SJHB 1KIUA 1G7PA 3LV3A 5EUOA 2Q7YB 1XEDA 2OTUA 5HD8D 4FFZH 1N8ZA 2DMKA 2R0ZH 1VACB 2VXTL 4LRIA 3D2UD 2FZ3B 3L5JA 4JO1L 2Y5TB 5EU4A 1I7TB 3BZEA 4AIZA 3LEYL 1C7SA 4RMUA 3L7EB 1NC2B 1OT2A 4OSUH 4JRWA 5FO9A 3ARWA 1DDHB 2X40A 2ERJC 1KGCD 5IBTL 1BIIA 4JQIH 3GMNA 3PWJB 2P7TA 4O4YL 4M5YL 4EN3D 4LLMB 3VFNA 4PJ8B 4HH9A 4XNUH 3LKOA 1A7RH 4QOKA 5M94B 1MHCA 4HT1H 1OVZA 1QNZH 3RPKA 1ES0B 2FO4B 1DEEB 2PTTA 4P9HL 3GMQB 4JFZH 3V7MA 1AC0A 3JWOH 2BRRL 3JV4B 1DQQB 1U8KA 4IRJD 2ADIB 3GI8H 1M6OB 1XIWA 3RQ3A 2PXYB 3QH3A 3DGCR 6FABH 4PJCE 4UAOB 3SKJL 4MWFA 1KF9B 1FCCA 2UYLB 4HUWA 2V5YA 4PGJA 4JEGB 5ID1B 3BVNB 3OB8A 4D0BB 3DSNA 1NBZA 1FRGH 2X4NB 3O6FA 4ZFOA 5D7LD 4MJIA 3TT3L 1EO5A 3BSZL 3CPLA 5E6YA 3G5ZB 1Q1JH 1DQJB 1NAMB 1SHMA 2AK1H 3WHXB 3OF6A 1DN0B 3KS0J 4Z8FH 3QNZA 3UTPE 3S9DB 1XCQA 3VXRB 3VFGL 1T66D 5K9OA 2P49B 5J11B 4Z7NF 4NQEA 1WBXB 2FGZA 3F58H 3SDYH 4KMLB 1FG2B 3JWNC 4YHMH 1K6QL 5F7DB 4F80A 2ARWA 4PV8B 5LGJA 3WFDL 1JNNH 2Y9RT 5EORH 1EDQA 4XP5H 2FEEL 5DJYA 3BH9B 1XCTA 4Q9RH 3BKYH 4I2XB 5JMOC 1SJVA 2EDOA 2VDKL 5D6CB 4NCDA 3NH7L 3UTSD 4S10A 2EDXA 2APXA 5ENWA 1BD2E 3OGOE 1KBGH 3MRRB 5TDNA 3SCMA 3X11A 5T1LD 1HCFX 4ZOBA 8FABB 2XTJD 1SMOA 1T2XA 4KTEL 1D5MB 3HE7B 1KEML 2CSPA 5E1AA 1CFSA 5INCA 4FQJH 4POYA 4JGUA 5IB1A 1NFIA 4S1SH 3RVUD 3FOLA 5L7XL 3P77B 4LF3A 1BQLL 4G6JH 1CLYL 1WV7T 4YXKL 4UILL 3U30C 2LABA 2RR3A 3C8KB 3MRPA 3E8UH 2I07B 2DLGA 4UUJB 1GVIA 4N1CA 3ARUA 1QOKA 1YJDC 1J0YA 3V5KA 2VR9A 3BP4A 1JGUH 1HINL 3RUGF 3U4EB 5JOEA 1I8MA 5F44A 3SDXB 4DKEL 4TUKH 5ANMA 5IBLC 2IQ9L 2J5LB 2Z9TA 5JIKA 3TZVD 3ZYJA 1RJZA 4NKIH 1FZKA 4X7EC 4WIQA 1BEYL 2X4TB 2XI9A 3NAAH 1UQSA 5E00B 2IG2L 1TETL 3N9GH 4JDTH 2NR6C 2VE6B 1S9YA 5CSBA 3B2UD 4J6RL 3KNBB 1NSNL 1EZVX 1IAII 4EEEA 5CEYA 4UU9B 1BBJB 2PYFA 4KQ3H 4ZSOB 5MEQB 4JZJC 3IVKA 5FYKU 4BSVA 4NM4L 1M05A 3MLZL 2AXFB 3QI9C 1HILB 2OSLB 5DD0H 5K9JH 1CFVL 1CD1B 2VITA 2AJYH 1IARB 3FN0L 2X4PA 3TN0B 5FUZH 3D0LA 2NTFA 4U6VL 3SGJA 4XVJH 4Y5VC 5FKAA 1V8HA 3S36X 1BM3H 1Y6KR 2C3HA 4G5ZL 1GXEA 4MCZA 4GSDH 1M71A 5IVXB 3WN5C 1TITA 2C1OA 2CQVA 3ZDXE 1CIUA 4ZD3H 4OAWB 3AAZA 4F9LC 1INDH 4O00A 5F9WC 2NY1C 1N5AB 2G5BB 4PJ5B 1FIGL 4O02H 3ZTJG 1U93B 4BFGA 1FL3B 2YHGA 3C6LC 4S1RH 4Z7OF 3HE6A 2VR4A 4KI1A 5IHUH 5ISZE 1W8OA 2EDLA 4OM0L 3BGMB 4L8BB 5BMFL 2YWZA 2XZQH 2Z4QA 1EXUA 4GT7A 4I48B 2FX8H 1ZMYA 5C08D 3P9LA 4JY4A 2DM7A 1LMKA 3LDBB 4WFEE 3FAWA 4NO5B 3RIAF 3CFBA 4WGWB 4HIXH 3O6KL 1RUPL 3GRWL 4LSQL 5I2IA 1S5HA 5E4EB 2XTJB 1OT1A 2V6HA 5I9QC 5SWZA 5HSFA 2EIZA 3PABB 5DGRA 5J1SC 1YYLL 1NMAH 2E9JA 4MLSA 1UH4A 4UMGA 4Z5RA 2HFGL 1XGQB 3SDAB 2JJTC 4C56B 4O51B 3PQYE 1E27A 2JTDA 2ZUYA 4LSSL 1H8SA 2B4CH 1AO7E 4G42A 3E6FB 2BFVH 4J1UB 4HUNB 4LLAA 3TA3B 5E9DE 4RFNC 2FLRT 4ZMAT 1AHWC 4OF5A 2C7UB 4HIIA 1X9QA 1MUJB 4WO4A 5A2FA 4JHAH 3MLYH 5I1CH 1WZMA 4OV5A 4NPYB 1U8IA 4HSQA 4X5XA 4QXWA 5GRUH 3MREA 4XHQA 4PTUB 3L1OH 1XAUA 4TNVF 4MNGB 4YFDB 4JO2H 3G5YB 4U6HA 3MXVH 1S7UB 1C5BL 4YHNB 3DMMC 3EW3B 5B4MC 3TC9A 3T08A 4Z7UF 2B5IB 2JJVA 1GZQB 3PL6C 1KIRA 3TO4B 5J8OA 2ZUWA 4HXBL 4O58L 4PLJD 4P5KA 1DCLA 2DLFL 2FB4H 5GGVH 5JUEH 4MDIA 4NQXB 3EJZC 4LEOB 4Y4FD 1GJIA 4CU8A 4LAJH 5MHSD 1K4CA 1J7VR 2VR5A 4YAQB 4F8TA 3QDGD 3WE6B 1AD0B 4N0FA 2DQHL 4QWWD 3MRGB 5ID0A 1NKRA 3STZB 4JFDD 1MCQA 3D3VE 2MPAL 3KHOA 3KYKL 3MR9B 4JZOB 4LP5A 2M8XA 4K9EL 5D1XC 1RK0B 1FG9C 5J6HB 4N5UA 1VKXB 4JFPA 5FV1L 5TDPA 4R4ND 3V79C 1BZ7B 4V1DA 5JQ6L 4GQ9H 4HWEH 4P2OD 1RHFA 3DRTA 1ZLVH 2X4UA 1AGBA 1YQ2A 4NQCD 3ARQA 5IFAH 4KJPC 2Z91A 4Q2ZA 5AZEL 2XACC 4HS3B 1A6VH 5MEND 1INQB 3QWRA 2RGSA 2YSSB 1GIGL 1F2XK 4C83B 1RIVH 3V95A 5A16A 2PNDA 4JM4H 5I1DB 2Y06L 4I0PA 4MNQB 1KB9K 4HJ0C 2XG5A 4HF5H 1JYVA 4XCCH 4ZTOL 4KRLB 4MSWA 3Q2CA 1SEBA 5JHLL 1P7HL 3P4NB 4XB8A 2NLJA 4UAOC 2ATKB 2VLRA 1AH1A 4KJQC 5E94A 3JV0A 3S96A 4AIOA 1U58A 2QTEA 3Q3GB 1MNUH 1ED3A 4NHUA 5JLZB 2X70A 5GHWH 3UP1A 2WNGA 1SQ2N 4RGOL 2Q3AA 4Z7WB 1NLBH 1XZ0A 3PIQB 4HJJH 3BPNC 4DEPC 5DJ2A 1DP0A 4S1QL 1RZGA 3EOAB 4ZDHA 4PGBA 4JZNB 2RFXB 1D6VL 4JO4L 1DN2A 1VA9A 1Q9LB 1K6QH 2H2PC 3JSSA 1V7NH 3TBYA 4U1LB 5CJXC 4EI5C 2EC9T 5EZJA 3MLSH 4PJEE 4LNVA 1JRHI 4HUUB 4JO3L 1S5IH 2VXQH 3L95A 1LQSR 2LE9A 3LQAH 3QCUL 5J6GA 3TGXA 4FQXA 1I3UA 1FNSL 1ZHKB 2GYSA 4HQQH 5CHNA 3T2NL 1FORH 4DK3A 5K9QG 3Q0HA 4RQQB 4U6YA 1V3LA 2D4FA 1DQLH 4JRXA 4QRTA 5ITBH 3QBTB 4YFEA 3OKOB 1DBBH 1CG9B 3S36H 1S7SB 3QDGB 4KVCL 2ORBH 1YDPB 4MAYA 3RTQD 4HK3N 5HD8C 3MRKA 2CDGA 3HE7C 5ADPL 5KG9B 3VW3H 1MJUH 1KV3A 1X5GA 2VLLA 2W0FB 2OL3L 1R3HB 2FNBA 3ARGD 4LCIL 3QNYA 1TJIL 2F9BT 4WHYG 4Z76B 1X5JA 3H9SD 3WDHA 3UO1H 1AQDA 1C16A 4RISH 4QXUH 5EWIL 3O6MH 5CMAB 4PRDA 2AW2A 4JFFD 4NQCB 3QIWD 1GHFH 1NEZA 2XG4A 2YBRA 3F12A 3TIEB 1EV2E 2GTZB 4E42A 4EN3C 4FABL 5MENB 3FFCB 1RVFH 2VERN 1BEYH 3GSRA 2J5LC 4MD5B 2E7BA 2O5XH 1TCMA 4JFQB 3DXAA 1RSFA 3QO0B 1FNGA 1R5WB 3CC5A 4HIHB 4IIQB 5B39A 3LSOA 1U0QA 1U3YA 1QO3A 4PJEF 1NCTA 2XQYG 4W4OA 1E4WL 1I85A 4QKXB 2WM0A 4EZMA 4G8EB 5F72S 3WFHB 3NOIA 3OXRB 3T3ME 2VDLL 5I8KL 3GGWB 1RZKC 1S7QA 4U6VH 5DI8B 3RUGA 4HCRH 3MACL 4WWKB 4M3KB 4DK6A 4NWTL 4Q97A 1A7QH 3OKYA 5DK2B 1F3JB 4IHOB 5FIEA 2CUHA 3VGBA 1EEZB 3ARFD 4PJBE 3MV8A 2NY7L 1LK2B 5IJVB 3NIGF 2F74A 4GKSB 1F58L 1TJGL 3HRZA 4S0TD 1T66C 1T22A 3O9WB 1JZ8A 1LO0H 4E0RB 1J1PH 5IWLA 4PR5A 2VLKD 5D7SH 1FZMB 4PLKD 1YMMD 1WIPA 1F00I 1CN4A 3RGVB 2HKHH 1MCLA 2YPVL 1D9KA 4MNHB 3UX9B 2AJUL 1FLRH 1KXVC 4LSQH 4M5ZL 5ESVA 4R4BA 3IJYA 2H2SD 4EUPB 1H0DB 3LKRA 5AUMB 1BREA 5IW1A 1J0JA 5D2NB 4Z95H 4TSAL 3SHSA 3OBAA 2IQAA 3SOBL 2XTJC 1C5CL 3KHQA 2F8VA 2DQUL 4IRZH 4HUKB 1QVOA 5DSCB 4LQFH 5D8JH 4P2RE 5CZVH 2X05A 5I1EL 3MRJB 4ODWB 1WIUA 4PJCB 1FVDB 1MCSA 1BFTA 2B39A 2A74A 4DW2L 3MNWB 4CVXA 3GSQA 3VFPB 2AKRA 5DA0B 3H9SB 3PGFL 4QHMA 3ISWA 3ULSA 3NCBB 4NT6A 5H2BA 4AMKH 3TA3C 3BEWB 2JIXA 2BMKB 1MFDL 5DD6A 3O6LH 4MB3A 5JORB 3BFOA 4OZGE 3OX8A 3Q5YA 4MYWB 4PJBF 1JF1B 3OMZA 5HHOE 1IGIL 2XWJA 3NA9H 3ALPA 4J4PD 4Z78A 5JW4R 1K3ZA 4HAGA 1M7DB 3N1PC 3TZVC 4HPOL 2I24N 1BQHB 4JVWA 4ORZC 4M1CD 2APTA 1RZJL 3MUHL 1IGFL 4HCRA 3VXPA 2EDTA 3B2UC 1KYOK 5FM4A 2P1YA 3CGTA 1JPST 1BVLA 4X5WA 4S2SA 2QL1A 1QRKA 12E8H 1UB5A 3TFKD 3L3OA 3BE1L 4ISVB 4UTBH 3AXLA 4O5LL 2MCG1 1ONQA 3S6CA 2IH3B 35C8H 3VG9B 2H3NB 1BD2B 4JQXC 1VHPA 3F8UB 4YHPA 1HHIA 1KN2H 1JV5A 2X4OA 4JKPH 4Q6IB 3M45A 2HA1A 1T7WA 3RL2B 5KVGH 1V3MA 1MCOH 5MERA 5J9PA 2VKWA 4G9FD 5FA4B 4YXHL 2L7JA 3IETA 5ALCH 4Z7UA 5ICZA 1WSST 1INEL 4R7DB 2GSIA 3N1QC 1YMMB 4C57C 4JAMA 2ITCA 2GK0A 1ZANH 1RMFL 2R56H 3IFNH 1FH5H 3G6DL 4PY7B 3GM8A 4WUKL 1A6WH 4OCLC 2IADA 4M03A 2A6DA 4X4ME 3V7AE 3EFFA 3DV4B 3OG4B 3PP3K 5DO2D 1YJDH 4F2MA 2ZCKL 3IU4L 5FDYA 4U1NB 2MOVA 4WEBH 3QHZH 4HV8B 3QXAB 1NGYA 2VZVA 1GRWA 3DX9A 2I9LB 4LHUB 4R96B 3K8LA 2QR0A 4ZFOL 5ACLA 3BZ4B 1PLGL 3MA7A 3D25A 3JVGC 5AYUH 3RBGA 3TBWB 1IFHH 2CIKB 1YECL 2VWEE 3AREB 3U36B 1CDBA 1HSBB 3PDDA 3RWEB 2W9DH 4LSRH 4OLUL 3DI2B 3LKSA 1DTUA 2QADD 3PP4L 4JDVA 2R2HA 4QNPF 1HKLL 1IGCH 1H5BB 1FSKC 4GMSL 3SGKC 4RNRB 5D7LE 2VC2L 1N6QL 2UWEF 4M1DL 3NN8A 3TYGH 4BQBA 5DUML 5I74C 1KIPB 5C09E 2VUYA 3I02A 4HWBL 1G9MC 1I1FB 2DYPD 2QHLA 4K7FB 1F42A 2P8PB 4JO3H 5KS9E 4F7MA 4XBPA 1Z9OA 5MEPB 3VA6A 4GAYB 5EC1A 5I1GL 3T2NH 1ORSA 4OIIL 2ESVD 4P5MB 3T2QA 1E4XH 5AYQA 2AQ3A 4PLJC 3P30H 4QGTA 1B4JH 1MCWW 4GRLB 2AJ3B 4N8VA 2H6PB 2HVKB 4LK4A 2F54A 4Q9QH 1EO8H 2GJJA 3MLPA 4XAWL 1YPZE 4JFYB 1DQML 5C86A 3UTSE 5CEXB 2EXYD 5HHXL 2F5AH 4QWWC 1T1ZB 2OL3H 4FQ2L 2XKNB 4EIZC 3PGCA 2ZUQB 3RWGB 2DB8A 4G7YL 3BGFB 4RGND 3WNNA 3CSBA 1K5NA 1HHHA 3WDIA 2XZCH 2CLVB 2DQTH 4I77H 2VJXA 3PQYB 4H1LG 1JWUA 4R4NC 5F7NC 4NQDE 1AO7B 2H45A 4HH8A 4M1GH 3U4AA 3AS1A 4AENB 4P2OC 4JGMA 1RZFH 3PJSB 1YEGL 2YXFA 1F4HA 4G9DA 1W8NA 4GUPB 5GGSA 5I17A 3QRFM 3WIHL 2JB5H 3PUCA 3DX7B 6CGTA 5IB5B 5GRZA 1MHEB 5GJTL 4QRSB 3GMLA 2NYYD 4Z0XA 3FMGL 2Z92A 4OFYA 32C2B 7CGTA 4DUXA 1J0KA 1J9CT 2D7PA 5D1ZD 4QRRA 2DTMH 3VRLF 5FDWB 1W0YT 3SKNA 3HMXL 5IVXF 1B0RB 1E4WH 3W5NA 5KS9F 4IIQC 5LQBH 5FB8A 1FFOB 4IOSD 5HGAA 1RUKH 1A6PA 1J11A 4DGYH 5CD3A 4NQSA 4OJFH 4JZJA 3MJ9H 2OTPA 4U3HA 3QI9A 5DRZB 2P5ED 1B2WL 4YGAB 1OY3B 1JHLL 5FUOH 2W9EH 4LKXB 4ELKA 1T20B 3GSXA 3WKML 5GZOD 1RJLB 3LS5L 4NKDA 5TGBB 4Y5VA 3ZHKA 1CICA 4PBXA 1NCAL 3BKMH 3U6RA 5F93C 4M6NH 5BOZG 3VWJB 5GSRA 3WN5A 5IVZA 2VSDA 1KPUA 1I9IL 3D3VB 1UXWA 2Q86A 4F9LA 1OSZA 2VUOA 4V2BA 3D9AL 2D2OA 3ULVL 1RHHB 4UT6H 3C6LA 2XPGB 4HX1A 5SX5K 1EH9A 2OP4H 5ILTL 4GG8A 3RGVC 4I13B 4WEUD 4X98B 1F4YH 1U3HD 5KBNC 3VD9A 3BP7B 3TYFA 1ZLSH 3OR6A 1IGML 4PD4J 5C07B 2DOCA 3LB6C 5C08E 5D2NC 4R90H 1JUFA 3EDDA 3VXMD 3FB6A 4QT5A 3F62A 1Z2KA 3QR2A 4L3CA 5I1EH 1ZOXA 2HJLA 4P2QE 3QDMD 5DDHA 4LCYB 2DDQL 1G7QB 3VXUD 1QSEB 4DW2H 4KUCD 3O45A 2JJTA 3PGFH 3ARGC 3BPLB 2C3VA 5F89A 5J1AA 4U1GB 4HIJA 4C4KO 1BVKA 1TFHA 5JOFB 1UCBL 2XQBH 4X99B 5I8EA 5ITFA 5JDSB 5H37H 5ICXA 4FQQA 5IJKA 4P3DB 2MNUA 2XXCB 3F6LA 4PUBH 4GQPH 5CEZD 1A4KA 4NKMB 4DGIH 5D2LA 3AS2A 5C0DB 4GMTL 2DICA 4HGMA 5D1ZB 4DVRL 4FQ1L 4WI7A 2JJSA 2VAAB 4NNXB 4FP8H 1HCVA 1HQRB 1NAMH 3MJ9A 1CFBA 3ZDYF 2NY6D 4WW1B 3GJEB 2QV2A 4JDZA 3DMMA 2EYTA 3I6KB 1G7LB 2YC1A 3NIFF 2FJFA 5L0QC 4JFED 2R4SH 3PL6A 4OKVB 3VGAB 4XP1H 1K3IA 2AJZB 3T0XA 1QYGH 1G9ML 1S7WB 1LHZA 3VG9C 1KTDB 3GIZL 1JTPA 4PJ7B 1A7BA 1UGNA 4XPBH 3G08A 3P73A 2F53E 2E5EA 5E8EB 2Q7YA 2R15A 3U9PH 3KXFE 1VACA 4LMQE 1WBZB 4AM0B 5FAAA 4DTGH 5EIVA 3PP3H 3TF7C 4M9OA 2ZCHL 5E5MB 2Y5TA 1RD6A 1I7TA 4LSPL 1LDPH 5DJ0B 3Q6GH 5D1XA 4JPKL 3TJHD 2ZOLB 1KCSL 1NC2A 4N5EC 3OV6A 2J4WH 1U8MA 2XA3A 1AXTL 4FQCL 3U7YH 4DVBB 2AABL 4HC1H 4AQ1B 4PLKC 1G9NL 3OWEA 1C5DA 4GAGL 5GS0L 1LNUB 2VL5A 3PWJA 4FTVD 1UT9A 5TE6L 3CLFH 1IKNC 1OCWL 5E70A 4LLMA 1SBSH 5DRWA 3IU4H 1NC4A 2H2SC 3RPIB 5C8JA 4P2RA 5D7IB 2BC4B 1QD0A 4H0GA 4LARL 3DVNB 4WWID 4KJYB 3B5TA 1EEQA 1JPGB 1ZSDA 2XWTB 2Y07H 4UT7H 4NBZB 3VA2C 5D9SA 3VWKD 3T0VA 4Y4KD 1OPGL 2IPKA 5IF0A 4U6XB 4LLUA 3NCFB 5TDOA 1MEXH 5GRVK 43C9B 1NFDE 3BVNA 4UV4H 3P0VL 2H32B 1JWSA 2X4NA 4U1KB 1HKLH 2HP4A 1JGEB 2CR3A 5KW9L 1NCWH 4XPHH 4W6XB 3KPSA 4XT1C 2ZSWB 3MGTA 4MJ2A 4LPVA 4M1DH 1H5BC 5EBMB 1J5OH 4X0KB 3L6FA 1RZKH 2EYRB 5GSVB 5TQ2H 3DO7A 4LHJB 3MODL 1RZIB 4EDWL 2XTLA 1VEMA 2W38A 4J4PC 4X8XA 5GISL 1PZ5A 3MBXL 2H26B 1Q9WB 1WK0A 3WNMA 2QQNL 4QXTB 5SV3A 4EI5A 5CJXA 5IESH 1CL7L 4XVTL 2BY0A 5C0JB 5KZCD 4E5XB 1FG2A 5F7DA 2VZUA 5E8DH 2I25N 3SE9L 1J10A 1MFCL 1YEHL 1CXEA 5DVKA 3QG6A 2ZSVB 3OR7B 4P46D 3TNMB 4LSVH 5DK3A 2BVOB 2MCPH 4NCC1 3FT2B 5DRNA 4RWYL 5FO8B 5DHYB 5TFSH 1VGEH 3VD3A 3PDOB 4FFYH 1DQMH 2HWZL 4F57L 4WUUD 2UWEA 3MRRA 4DGVL 5AWNH 4FQ2H 2WWKO 5DMYA 2BHUA 4TRPH 1NPUA 1IVLA 2CK2A 4M7KL 1FV1A 1Z9LA 1EUTA 2IPUG 4G7YH 2Z31D 2BNRD 4HC1A 2NY2B 4BQ8A 4LBEB 1QP1A 3D2UA 2CK0L 3KPPB 4JHZA 5DS8B 4KHXL 1A6UL 3BGFC 5T5FH 4XVUD 1A7PL 1KENL 4XNQA 4PJ9B 1NFDF 5J13B 3EYUL 5IB2B 3TV3H 1CT8B 5KVFH 4P3CH 4CMHB 5EIIB 3VMPA 3QUYD 4IMLA 1MCCA 4UUJA 1U9KA 1CDYA 1O7VA 4ZAKB 3VXSB 4WI9A 3P9MB 1C1EH 4X6CB 1JFQL 1HI6A 3NMEA 3LS4L 3MRFB 4WW2C 4NFDA 4JGJA 5FYJE 2OJEB 3WIIL 2R1YB 4EN3A 4K7PY 4JFFE 5HHOB 4XCNB 5T3XD 1ZK9A 3FB5B 3N85H 4TOYH 1NGQL 4JN1H 3U1SH 4LLQB 5DO2C 2D7MA 3RIFK 2L4OA 2WUBL 5DUPL 3FHQA 4YHLH 3MRHA 2A6JB 1DE4A 1JMXA 1VFAA 4IRJA 2BY3A 2OBGA 3VWKB 2W07A 1MY7A 5E00A 3OG6B 5IFJB 4Y4KB 2NY4B 2VE6A 4NN6C 4MQTB 5F3BB 4ZUTB 5BJTB 4LLVB 1NCUA 1WGOA 3QQ4A 1NBQA 1H8NA 3MRNA 1OTTD 5HHNB 4H8WL 2F19L 3RL1B 5SX5H 2AXFA 2B1AL 2BVUA 5D7LA 4LSTL 1VDGA 3G04A 1CD1A 1MVFA 5CJBA 4AEEA 1OGTA 1JNLL 1EHLH 1AP2B 1OD9A 2HN7A 2QADC 2X4RA 5DFTA 1J8HD 1CXIA 5I30L 1U95B 3TWCH 5IVXA 1LK3L 5KS9A 3LN4B 1MAML 5ETUB 1HXMB 3D18A 1CF8H 2OJZL 2JK5A 1EEYB 4JPVH 4I4WA 5T3ZD 5I66A 1L7IL 2ADJB 4M7LT 1U93A 5ILTH 3QXVA 4GW1A 1IL1A 5CZXD 3K1KC 3FZUC 1CD9B 2ITDA 2R23B 4I3SH 1ZS8B 5BRZD 1I8KB 2C3XA 2DWEB 2FRGP 2VLKE 3QA3A 5LBSL 1UWXK 3BUYB 2AV1A 2AXGB 1ZTXL 1FFNB 3UTSA 1D6EB 1X5IA 3VFTA 2WLYA 3JWDC 3X14A 5EC2B 1ZHNB 1QTYT 1MRCL 2OI9B 5T1LA 3WJJC 2OK0H 1TZGL 3V7AG 1T1WB 2NY0D 3DIFA 2HFEA 1X4ZA 2HKFL 3O2DL 3PABA 5JPNB 3LD8B 4ZFZA 2YN3A 1XGQA 3QUXB 3LVEA 3BPLC 3CZFB 2FD6H 3D69A 1QSFD 4OZFG 3ROOA 4U1GC 3WO4C 5ECJE 3P11H 4LVEA 2DLTA 3QFDB 1UWEH 4TVPD 4NUJB 2SEBB 1UG9A 2FX7L 4NZUL 3A6BH 1LO3L 3VH8G 4OFKA 5LKNA 4I5BB 1MCNA 4TNWK 1QLFB 3PHOB 1J1OH 1HWHB 4U1SA 4CVWA 3I50L 1N6UA 5D1ZC 2NNAA 3X13B 5C09B 3ZTNH 1CK0H 4MA3B 3TZVA 2AJVL 3QG7L 4KMQA 3C5SA 4WNQA 1S7UA 2XICA 4YHNA 1ZA6B 1EGJH 5FYLE 1L9NA 1N3NB 3L5HA 3HAEB 2YRZA 1G9MH 4NDMA 5FUCC 5C0IA 3HAEG 5FM8A 4F7TB 3VGAC 3EIFA 4LPUA 4QF1B 4URTB 1QRNE 3T09A 4KU1A 2ZUVA 2HFFB 5BS0D 2AERT 4IMKC 2X10A 5GZOC 2WLZA 5FCSH 1T89C 4TNWF 1AD0A 1J8HB 1YPZB 1HIML 3IDUA 2ZCHH 5FA3B 4WI5A 1QLEH 4N0YL 3MR9A 3KYOB 1I9JL 2O5ZH 4JZOA 2E6QA 1U8LA 2KH2B 4KXZH 5J6HA 2MMXA 4APQB 3FRPG 1I1YA 4L5FH 3C09B 1S7RB 4NRYB 5GS0H 5LAXB 4G9FE 5K59E 5BRZB 4J8RA 4LQ1A 1EFXD 1MHHA 5C08A 3EYSL 4HS3A 2YK1H 3DTXB 1INQA 5HVHB 1DBJH 2YSSA 2EKSB 4ZUUA 4KZEH 4LARH 4C83A 2DQCH 4JLRB 3UTZA 3LQZA 3MLWL 2QSCL 1JHKH 4QY8A 3L3IB 3MA9H 4Y5YA 5GJSH 4YHKH 5GGUA 5M7QA 4OT1L 1MCEA 1BWWA 1FVCB 5ESAB 1EMTL 5KVMC 1GL4B 3UEZA 1AJ7H 1FNAA 3M1BB 1LO4L 2M1KA 3Q3GA 4QTHA 3JVGA 3GHEL 3RI5F 4D9LL 2IANB 2W1NA 2IC2A 1UCTA 4Z7WA 4JFOA 2GCYB 3PIQA 4I3GA 3UPCA 5H94A 5IMMB 2YRPA 3B3IA 2WIMA 4KTYA 3SGKA 1ROWA 4EDWH 1RK1A 4H0HB 3X3FH 2IAMD 2XY1A 3TPUA 2QQNH 3BXNA 3RA7H 1OWWA 3QPXL 3EOYG 5C3LD 1EGJA 1MQKL 2M2DA 5TE4H 1KIQA 1L6ZA 3LKPB 3VG0L 2EH7L 4JE4B 4JREB 4R26H 4U1LA 3UYRL 3QCVH 1KCRH 5EU6E 2E8YA 4KROB 1F4WH 3UCRA 5K59F 3OAUL 2HTLD 3MRCA 4MXWL 1FE8L 5EOCL 3LRHA 5AAWA 2XNAA 5KAQF 1W0WB 3U0PA 4Y4HD 1CE1L 3IXAA 4MA7L 3ZHLA 3H8NA 1JNHB 5KVDH 3REVA 4Y4FA 4N8PA 4WW2F 2J88H 2J8UE 5DD1L 3O2WL 4PJXB 1MF2L 1CG9A 1NGXB 3QDGA 3D39E 1IAOB 2ID5A 2VDML 3LOWA 2FO1A 4JFDA 3FRUA 1A7PH 3MRIA 4EUPH 2YRLA 5H35A 3T0EB 3IAGC 3EO1A 1Q9OB 1SEQH 4RAVB 1U8NA 2BX5A 4XWGH 1AY1L 2JELL 3EYUH 4DOHE 1VGKA 1EAPB 5DRXA 2IFGA 3AS0A 3OKEB 4PJ9C 2Y4SA 5J13C 4X7CC 4R3SA 3RNKB 4P2OA 4RGNE 4CMHC 2DI8A 3V5DB 2IPTL 3GK8H 3C5ZB 3QEQE 1EFXB 4NQCA 4ZAKC 1BJ8A 4OLXL 1C08B 3MV7D 3MLUH 4BZ1L 2BOCB 1NGQH 1DEDA 5MENA 5HHME 4J3XA 1YNLL 1OQXA 3PWLA 4X6DB 4MD5A 4NJ9L 3ZT7A 4POUB 4LVNB 2VQTA 2ZKHL 4JFQA 1UYWL 3HC0B 2J8HA 4NGHL 1R5WA 2QSQA 2BSTA 4X4XB 1NFDA 4F3FA 3VWKC 3HTLX 1T03L 1AI1L 5DT1L 2PR4L 2W91A 4Y4KC 1HQ4B 4Z0BH 4PJFE 5JOPD 1HSAB 1HOCA 3IDGA 1DQTA 1BFVL 2ICWI 3H6JA 3GGWA 2EYSA 1A9BB 5JZ7D 3NGBB 3CFEA 3CD4A 3T0BA 3HNSH 2J8UF 4GG6E 3BWAB 3MLTA 3F7RA 1UWXH 1ZT7B 4Y1AD 1IBGL 4IHOA 2APVA 4BZ2H 1MIML 2P5EE 2VIRB 1MAMH 1JK8B 1QEWA 2LTQB 4ZPTB 4P2YA 5J12B 4P49A 2B1HL 4ZNEA 4KZDL 4R2GD 4P57B 3ILPB 1FGVL 3TJEL 2H1PL 4E0RA 1ZXQA 4HDIB 3VFOA 4PBWD 4HS8H 1OW0C 2NW3B 1Q9KB 1SJEB 5C0GA 1WC7A 3DRQB 2NZ9D 4XVSH