3MQIA

Human early b-cell factor 1 (ebf1) ipt/tig domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
90
structure length
90
Chain Sequence
HATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription factor COE1
publication title Structural Determination of Functional Domains in Early B-cell Factor (EBF) Family of Transcription Factors Reveals Similarities to Rel DNA-binding Proteins and a Novel Dimerization Motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator
total genus 12
structure length 90
sequence length 90
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01833 TIG IPT/TIG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mqiA00
3FZUC 1TVHA 1U8PB 1YYLH 2OTPA 3D2UB 1J7VR 1FDLL 4FFWD 1Z5LB 2A6JA 4LEOB 5CGYD 1IGYA 4N0YH 4PJXB 2ZKHH 1QBBA 4JFEA 1FNSL 4BK4A 3GB7B 2NY7H 2J3SA 5KVFH 3TEUA 3T0ED 3F58L 3QCUH 2UY6A 2XQYG 3GUTA 3G6DL 2C26A 5TF0A 4ZDHB 2G75B 1DSFH 3HE6D 4NZUH 4TSAL 3VGGA 4Z7OE 4U33A 4R7DB 2IEPA 4PGDA 1DBBL 3MOAH 3OR7A 4KKLC 1FO0B 1PG7L 5IBUG 3SDXE 5SWSB 4DGYL 3UYOD 1YN7B 5C6TH 3GZKA 2AJUH 3QEHA 4LVNB 5I0ZA 3QQ9D 4EI5A 2R2CA 1BWWA 3KLAA 1OCWH 5TQ2L 1MFDL 4X7DC 3HNSH 2DMCA 2VE6B 3QNZA 2AJ3A 4C59B 2LE9A 1CL7H 1CGVA 3QUKB 2PYEB 2APXA 3KPOB 2AJXL 4XB7A 4Y4FC 4ODTL 3P4NA 4N8PA 4YHLH 3QUYB 4J7RA 2BFVL 1CDBA 3MCG1 3NCJH 5CSZA 3TA3C 2EEBA 1W0YT 4ZPTA 4HUWB 2HFFB 1RURH 4APQD 3ULSA 1U91A 3MUGB 2ZOKA 2JB6A 3FT3B 1IAII 2F19H 1F4XH 5LG1A 3V4PH 3MRGA 5HYQA 5TE7L 2ZPKH 2EO1A 1OSPH 3MO1A 3Q2CA 5FUZH 4EVNA 2A83B 4WW2F 2VO5A 1D9KB 4QOKA 5IMKA 3I50H 5IR1A 2XWJB 1CD0A 2PW2A 5HGBA 3TH3T 2VTFA 3MLZL 2X1OA 1HXMB 3DBXB 3MLYH 2APFA 3WLWC 3UTTD 3X3GL 5DVLA 4PGEA 1D5ZB 1KPRB 1DR9A 4BYHA 3MLSH 3M1BA 5ADPH 4NRYA 1O0VA 3VFRA 5I16A 4J3SA 5CEZD 5F1IB 1OB1A 4FQJL 3G5ZA 1DUYA 4RGMC 5KZCD 1IARB 5AZ2H 2W07A 3WXWL 1U3HA 1S7SB 3OB0H 4O51A 5FUCC 4ZOAA 1WT5C 3QO0A 1JZ2A 1N64H 1EJOL 3SE4C 4P48A 3CFDA 2EE2A 3C6LA 3RL2B 1D7FA 1GXEA 1A8JH 2OZ4L 5IUSA 4EQ3A 4NP4L 4M7KH 1RK1B 3RFZC 5CEZH 3CXDL 3CVIL 3QFJB 4HFWB 4P2OB 4ONFL 2V5MA 3FOLB 1J10A 3ULUC 2YKLL 4R4FL 3UJIH 2LU7A 3O6LH 4HJGB 4WEBH 1MJ7L 4Q9RL 2O61B 4EN3B 5LBSL 4LLVB 1S9KC 2J8OA 2B4CC 3EDKA 3CMOH 4UV7L 2C3WA 1W8OA 4HS3A 2XPGB 2RFXB 3MR9B 2DQHH 1NAML 1JNJA 2NY2D 4TSBL 1JPST 3KWWB 1CG9B 1NSNH 4I5BB 2R2BA 4DWHA 2PR4H 5E00A 3B3IB 1J1OH 4HKBA 1Q9KA 5GQBA 3ZL4L 4EI6A 4F9LC 4JY6B 4OLVH 4Q6IC 1IKFL 5FO9B 4TNVK 5EIVA 1AGBA 3NN8A 3F8UB 1HIMH 3BD3A 2XWTB 3VXSA 2DQUL 4LDOB 5IWLC 5IT2L 1PG7X 1IEHA 3IRZA 3P73A 3F7YA 2NY3B 3SJVD 5B4MD 5GZOD 1KCKA 1T7WA 3RWCB 4H1LB 2GJZA 4YE4H 2V7HB 3S36L 3QO1A 1I7ZA 2EDFA 3V8OA 1QSFE 3JUZA 4JZOB 3RWDA 4N1EA 2ZSWB 3VXUB 5FB8B 1NANH 1CDGA 3WBDA 4NM8L 4R0LC 1IQDA 4WUKL 1G1YA 4WO4A 4NQVA 4G43B 1RMFH 3EOTH 1K6QL 3HS0B 4R4NC 4LASL 4PJBE 1JHLL 1HHHB 2DQGH 4X9FA 5DHYB 4Q74A 3KPRB 1G6RB 4JAMB 1S3KH 3QEQE 4UINL 3BZEB 1UT9A 3D3VB 3LMJL 4O4YH 1SBSH 3C2AH 3TWCH 3GSVB 3KYOA 1IM9B 4K55A 5LVEA 4FABH 2FGWH 1NDGA 5EBGA 3D9AL 2R2EA 3MRMB 2YD7A 3CVHL 3GMNB 1OTSC 3CPLA 5MENE 4OIAA 15C8L 3IDXL 4QRTB 4GG6E 4RQQB 1R0AH 4JCLA 4OKDA 1PDKA 5C0GB 2DIAA 5GHWH 3FN0L 2SEBA 4G8FA 1G9NH 5ALCH 3GKZA 3UTZB 5B38A 3RGVA 1S5HB 4JG0L 5AYUL 4WHYH 1YYML 3SDXA 3RZCA 1Y6MR 4G6AC 4RFEA 3NPSB 1LO4H 1Q9WB 2VZTA 3CAFA 4G3YL 2HT3C 1CD1A 3LV3B 2OSLA 4O2EB 3DETD 4HXBH 2FL5A 2R8SH 1OTTC 5HSFA 1ZGLA 1NCWH 4KAQL 2MHAB 2PTVA 3WUWB 4XNUL 3VXQA 1IL1A 3DRQB 2D4DA 5GSRB 1OF2B 5GGSY 2NZ9D 4XXCA 1T20A 3GSUB 2HJKA 2VLLA 2FX8L 3HC0A 2B5IB 4A6YB 3TIDB 1YNTA 2A73A 5EZIH 4QRQB 4N8VA 2A74B 4MNGE 4KY1L 4KHTL 2BVOB 3VFWB 5D7IF 4OB5L 1NGZA 5ECJE 5LWYH 1TZHB 2AJSH 2OJEA 4IOFC 3DMMB 6FABL 4X6EB 1TPXB 5E5MA 1BQHB 2ZCLL 2CUHA 2G9HA 2XA8H 5KTEH 3DX6B 3P9MA 2GT9B 4XP9H 3T65B 1T0PB 1T4KA 3D3VE 1U3HD 5DJ2A 4EUPG 3TFKC 1WTLA 2X09A 1U92B 3MZTA 3KPNA 2Y25A 5CIPA 3ARGA 4OFYA 3ZDYE 4NNPL 3ARFB 1F4YH 1WTGT 2JJWA 1F00I 3K8LA 1K5NB 3SCMA 1I1FA 4JRYE 1DEEB 2QHRH 4XRCA 5I30H 4LF3A 3IVKA 5F6IC 3S36X 4NQEB 2P44B 3NVQA 4NBXB 2JIXA 4K23H 4UB0L 4XVUD 5E4EB 1TITA 1RIHL 1JWUA 5GGVY 1A5FH 1EH9A 5DHVB 3RY6A 1FL6A 4L3CA 5KVEL 1FSKC 5HHOB 1QRNA 4JB9L 4KKCD 1MRFL 4XNYL 4MAYC 1JGLH 2OCFD 3T09A 2ICCA 3QJFA 1TZGH 1EO5A 1WEJH 3U0TB 2DJSA 1QYGH 1AE6L 1KXTB 3C6SA 3ARPA 3DOSA 4Y5VA 1KTDA 4G5ZH 4JR9L 4V1DB 1BOGB 3PV6A 1YEJH 2Z91A 3LN4A 4JPIA 4X4ME 3QZWA 3VXSD 2EYSB 4KUCD 5BRZB 2QSVA 3SQBA 1JPGA 4AL8L 1M7IA 1IBGH 3OB8A 4Z7WF 4JFOA 4U6XB 3GJFA 4O02H 4D8PB 1A4KA 5GGUB 1MFBH 5I8EB 4R96B 3MUY1 5D7KD 4MGXA 2CDEA 1SMOA 4GUPB 5CD3A 5GJSL 3RU8H 5A3ID 1E4XI 3Q5TA 3VRLE 1JRHL 25C8H 3LQZB 1D5IL 1QSFA 4M3JA 4MZ3A 3WNMA 4YNYB 1CVSC 1H5BA 4IRSA 4QXUL 4YO0B 3OGCB 2HFGL 4ZUSB 4ZFZA 3W11C 5DI8A 4NO2B 4FZ8L 4PJBA 1IAOA 1OAZL 1NBVH 5IVNA 1U8QA 2IADB 1ZTXL 3QEQA 5HDQH 2Z92A 2H2PC 5IF0A 3BDYH 4UT9L 5I8CA 1HOCB 2AVGA 1U95B 4HIJB 1QNZL 2VLRB 3GSOA 4JRXB 4KC3B 4JO1H 2DB8A 4X6CF 4KTYA 5D7LB 4YHPB 2GEEA 5MENA 3BPNC 4XP6L 4GG6A 2X70A 1BPVA 3RGVD 1F6LL 4POUB 1Q0XL 1CN4A 1HILA 2DQEH 1S78C 2Z4QB 2AABL 4C56B 3RZCD 5DVNA 2X4RA 5JW3L 1W8NA 1BGXH 3OHXB 4HWBL 1SVCP 3EYSL 2ZJSL 1N59B 1U8IB 4MCYA 5HVGB 5JQ6L 1B2WL 3KS0J 1JGEB 2IG2L 1AC0A 3LKSA 2APTA 4PRBB 2ICES 1Y18A 1FLRH 4CUCA 2XTJE 3L3HB 2DTML 3SDAA 1CF8L 5DK0B 4NBZB 1CDCA 4X80L 4N8CL 1CR9L 3O3AA 3FO2A 3UBXI 4HBCL 1JNNL 4W6YB 2V5YA 1U8LA 2X1XR 4X7TB 3VWJD 4J1UB 4NRZB 4DAGL 1KOAA 3AREA 4J8RA 3QXAB 4HIXH 1C7TA 2Z93B 4ELMB 4NZJA 1FAIL 5CGTA 2FIKA 4L8CB 3IDMB 4G8GD 3HPJB 4I18C 2VDML 5DQJA 4MNGA 5AG9A 3EOBA 2GK2A 4U4BA 2E7HA 3ZT7A 1EIBA 2WBJC 4RX4A 12E8H 3HFMH 3LHPL 4XCYB 1IGMH 3HA0A 5JDJA 2EDRA 2IF7A 4LLUA 4XPBL 4RWYL 4O5LL 1R5VB 5IW1A 4TTDC 3L6FB 2NXYC 1KTLA 2W9DH 4NQCE 5JA9A 4KDTA 3ARGD 1ES0A 4LLWA 4LPYA 4Q0XH 3MROB 3RRQA 2BMKA 3O8XC 3ARYA 4F2MB 4LVHB 5EOTB 4JZNA 3TH4T 3HUJE 3L3IA 4M03A 2IBZY 4LFHG 3BKCL 4JRYA 2VUOA 4ODXB 3TF7C 1U8KB 5CIPH 3CXHK 1P53A 1JNLL 4JFZL 4JO4H 3VFOA 2MCPH 2MMXA 4KH2A 1OARH 3N85L 4LCYA 4PIRF 3WN5B 5D1QA 1B88A 1KJ2A 2ATKA 3BW9B 5ERWB 5ID1B 3R4DA 1BWMA 5CFHA 1FZOA 4NWTH 1IAIL 3I85A 4XT1C 4GMTL 4PG2A 2UVEA 3FTGA 5EB9A 1A7BA 1PW3A 1C12B 3SOBH 1EPFA 5GGVL 3QUYD 4HS8L 2E3VA 3V4UH 4I77L 4OFPA 4KZDH 4U05A 3GSRA 3B2VH 3R8QA 3W39A 1KJMA 4X4MA 3DECA 1BBJA 1X5ZA 5DA0B 4GW1B 4ELME 5F1OB 4G6KH 4NRXA 5EN2A 4WI7A 3UJTL 5GJTL 5MEPA 1UZ6F 1EHXA 3KJ4C 4NKOB 3AROA 4WU5A 4KI5F 3STBA 2W0FA 1XGUB 2ITDA 2P8PB 1J0KA 4XHJC 2BOBA 2ZUUA 5F7DA 1QSFD 4ZTOL 1K4DA 5DMYA 4HIEA 3TA3B 3WJJC 4IRSD 1P9MA 3GJFH 5I17B 2YRZA 1U6AH 4LVEA 1IILE 5DUPH 4M1DH 5EORL 3S98A 4R2GC 4YH6A 4ETYA 2CDGB 2H2SD 3FT2B 2Y07L 3QEQD 3WIFB 3QQ3A 3UBXB 3SKUD 4KZEL 3NCYP 4OZGE 4G8EB 1R3HB 4BA8A 4Y0GA 2HA1A 1P7QA 2Z35B 2ZUQC 5HI3D 4HIIA 3VI4E 4WY7H 5D8JH 5MEND 4LMQE 3RWHB 3GI9L 4N0UB 2HT4D 3NACH 1FL3B 3U7WH 3GIVA 5DLML 3TT1H 3CSYB 1NGYB 2VAJA 3HPLB 1FNEB 4RGMB 1NBZA 5DQDH 1N7MH 1I7TB 4EN3D 4PY8I 5CSGA 4N5UA 5GRYA 3VXRB 4L4TE 4Q9CA 4WEMB 5HY9B 1A1NA 5FO8A 1UB6B 1XGYL 1JV5A 3QXDB 3ARDC 3O3UN 3E1F1 5IMLB 1KEGL 3JWOL 2MWCA 1U41A 1PZ5A 1PY9A 4G6FD 4U7KA 1XR9A 1NC2A 1BFOB 2E5EA 5I1IH 1DVFA 3ARED 1MCRA 3T3MF 5CMAB 4M1CC 5CWSA 4QNPE 2A9NH 4PGJA 3UTOA 1NGXA 4OF0A 4OLWL 4H5SA 1OWRM 2DWDB 5KOVC 2DRUA 4LSTH 4MMXC 4AK1A 1EXUB 2ZCKL 3B5TA 4I4WA 1LEIB 4FZEL 4WUUB 4MD0A 3RWJA 1RZ7L 3O3EA 1S9YA 1C5CH 1X4ZA 3GHBL 3NFPB 5TPWL 5L7XH 4DUXA 4RX4D 5IFAL 1LNUA 1VFBB 5E8PA 5F9OH 4HZLB 3MRRA 3VXUD 3IJYB 1WC7A 4ZPVA 4GOSA 3FN3A 4M00A 1ZEAL 1MAML 1GOGA 3HI1A 4Q6IB 1ZLVH 2IBBA 2HN7A 4OQTL 4DN3H 4BSVA 3QIUC 3LSOB 1JYNA 4ETQA 1HH9A 4MJ5B 3CZFA 3KPRD 3B43A 2JB5L 5DT1H 4U1SA 4QF1B 4K9EC 3DROA 3CU1A 3V0AC 4JQVC 3D3VD 1GCFA 3U0PA 3NFNA 1Z2KA 2CMRH 3PQYB 1BREA 1X4XA 4FMFA 4M6NL 4NQCA 3THML 3RKPA 1TETL 3T2OA 2IBGA 2NXZC 2GTZA 2VL5B 2YHGA 1K8DB 2X4QB 3MRDA 4JZJB 2VDPL 4OZHE 2F53E 4XVJH 4EOWH 4UBDC 1QG3A 2QR0B 4LHQB 3NZHH 1EBAA 4H25A 1J05B 3EYOA 4WHCA 2JJTC 3HUJA 2GJ6E 5DSCA 4R0LB 4H88H 4LRIA 4GS7C 1DQJB 3GMMB 1MFEL 1UB5A 2ID5A 4PY7A 5FECA 1BQLH 1S7TB 2NLJA 4G9DA 4P9HC 1P5UA 2ADIA 2UWEE 3ARQA 4LIQL 1REIA 4OSUL 4PV9B 1UM5L 1K2DB 2CK0L 3QWRA 5KN5A 5KSAC 1HZHH 2ZSVB 4TULL 3P0YL 5T5NF 3ZYZA 4LSQH 1T7ZA 3MRIA 2IWGA 2X89A 4OV5A 4RFOH 1FH5H 1MFCL 3K1KC 2VXTH 1SVZA 3GI8H 1IC4H 1KJ2H 3VMPA 3CFCH 1C08B 4JM2C 3CK0L 1A1MA 3JV4A 2VWEC 5EC1A 4KRPC 5JHDB 4CW1A 3F5WB 1F8TL 5KVDL 5D71L 3UYRH 1JYXA 3FT4A 2GY7B 4K94L 1VHPA 2RB8A 4GQPH 4HWEL 3TPKA 2O5ZH 4OCSH 5D1XA 3LKNB 4JY5L 2EC9U 4LAJH 2FB4L 5EU7E 3DMMD 4BH7B 2HJLA 3DX9B 4X9HA 5JXEA 5FYKL 1IGIL 1SJHB 2HVJA 4QRRB 2W91A 3DGGB 1RIUH 3WD5H 3TCLB 1K9TA 2ENSA 4OCNC 1ZSDA 4XCEA 5H37G 4KK6D 4OLEA 3TYGL 1A6TA 5H35B 5BV7C 3AUVA 5EA0H 4GAJH 5D1ZA 4DZBA 4GXVH 2V2TA 2VLJE 1CDHA 3U83A 1QHOA 2VXVL 3ARFD 2I60H 5GRJL 1NGQH 3GHEL 4UT7H 1AXSB 5D2NB 1KB5B 4OZGA 1AGFB 4PLKC 1ZHNB 3FQUB 3JWDC 2R0ZL 2VAAB 4YQXH 3LKRB 1OSZA 1T1ZA 3U1SL 2OK0H 1Q9OA 3FQNA 4YC2C 2ADGB 1U8JB 5DRZB 1T0MA 5IK3A 1MCCA 4NHUB 5E6IC 1XCTA 3NA9H 4J3TA 5E2VH 1A6VL 3VFTB 1RUQL 4Q7DA 5C08B 4P4KA 3PWJB 4L4TA 3TO2A 3MODH 1MH5B 3S96A 4YDIH 4OFIA 4JANA 1NFDE 3L3OB 2XTJD 3FO0H 1NC2D 1ORSB 5EU6E 4HCRL 2LAGB 4POZD 1MUJB 4PP1C 1FFNB 5F6IB 5MEQA 2Y6SD 4D94A 4A2MA 4U1KA 1M6OA 5L0QC 1XIWC 4Z7NE 2I9LB 3BUYB 1E4XL 3ME0A 4XXDB 3GGWA 3UROR 3WO4C 3GJEB 4XNQA 3HR5B 1I75A 1LE9B 1FSKB 1IT9H 5JUEH 3FFCB 1T89C 1BP3B 1PLGH 2FWOA 2X2YA 3BVNB 3PGFL 3RPKA 4TYUA 2AXGA 2VH5H 3L3JB 4HMDA 4PJ7E 1RULH 2FGZA 1LEGA 5HHPB 4O9HL 1EEQA 2NY4C 3I75A 3N1PC 2IBZX 5SX4H 4NWUH 1IM3B 1JHKH 1YEIH 2CIKB 1CFQA 2CIIA 5KJRH 3EBAA 3OKKA 4GFTB 5E8DH 4PJBF 1MEXL 2YD8A 4LCUA 2R1YB 4D0CA 5BW7C 5ITBH 3P77A 1FNGA 5E2UL 1W0VB 5T1DL 3HHRB 4NNXA 2H32B 4ZAKC 3MA9H 2OMNA 4TNWF 1YQVH 1DQQB 4CU8A 5K59E 3CH1B 2C4FT 5EZOH 1HYSC 1I7UA 4OCLC 3VFMA 4GG6F 4OZHA 1C16A 2F53A 3MCKB 3TVMB 2F15A 4YEEA 4LCIH 3U7YL 1Q72H 2FEEI 2GJ6A 3TZVC 3T8XB 2QBWA 5ANMB 1KCSL 2IFFL 1K8IB 3QWRD 3U7AA 4DCQA 2BSTB 2UWEA 3HMWL 2APBA 3UBXG 3EYQC 4GSDL 4MQ7A 3OR6B 4Z7VB 3D39A 1L7TH 1CE6B 2AGJL 4FQXD 4I0PA 2X89D 1TVBA 3VFPA 4LBEB 1R3IL 5C0CB 5MP6H 4FFZH 3BP6B 1NL0L 3ROLA 5C07A 3LKQB 4C83A 4M8QB 1WBXB 3V5KA 5TQ0H 1KT2B 3BPNB 5HI5D 1M71A 2EYTA 4ZUUB 1WBZB 3TH2T 2OQJB 3VFNB 2D4FA 1QKZH 5TFSL 3O6ML 4MSWB 2P8MB 1RJCA 1N6QL 4TSCL 4K3JH 3QAZC 3BT2L 2XFXA 4IBLT 5D1XD 1S7XB 4YGVB 3QDJB 2K7QA 1HN1A 5JXED 4P23A 1HK6A 4QYOB 4RDQG 2Q6WB 4YDVB 4K7FA 3ULUL 3BZ4A 4XNXL 5EFIB 1LE5B 4K2UH 4ZYKA 1KCLA 5IJVB 4OFKA 1MLBB 2JELL 1OAUL 1C7SA 1B3JA 4XVTH 3DVIA 5HJ3A 2P8LA 5B8CA 5D1ZD 2CLVB 1AD9B 4WWKC 2XACC 3BIKA 4Z7UB 5C1MB 1N5AA 1T03H 4LLQB 3WNPA 1A6AA 4I18B 3LAFA 5T1MA 2O26U 2VLJA 4JFFE 3KPTA 3D0VA 2PETA 4W6XB 2XNAA 3EJZC 1QFUL 1WAAE 2PXYC 3G9VA 3OJDA 3OKMB 1GPOL 3C5ZC 4KGJA 5MERA 2ADFH 3KHOA 2IANB 4RA3A 4GW5B 2XZZA 4PJFE 3FB6A 5D6DC 1I4FB 4QY8B 3I6GA 3G08B 4XH2A 3CFBB 2NY0B 4RRPG 3D85B 5DD3L 4LLMA 3FZUD 2NXYB 4ZO8A 1NCCL 3E6HA 4OCXL 3JXAA 1N4XL 5LXGL 4JHAL 3B5GA 4L4TD 2XY1A 4NSKA 1HHKB 3O8XB 3MFGB 3GSNB 3GNMH 3MNWA 4YDJA 2JK5B 4HUXB 2HT2C 2ED7A 1NFDA 1IC7H 1MNUL 2AW2A 1KACB 1OGTB 3HNTL 2I27N 4HDIB 4U1IA 2B20A 4MXVF 5EU6A 3MQIA 3ARBA 1CXLA 4X99A 5CZKA 1WIPA 4TVPL 2BX5A 3TN0D 2GAZB 4LLDB 4QO1A 5GRZA 4OZFG 3V0WH 1BAFL 4PRHE 1FNHA 4GRLA 2WBKA 4NHCL 5EZJA 4BQ8A 5KS9E 4OLZH 2IPUK 4JN1L 4FG6D 3QDJE 4QHNB 1AD0A 3HI6H 4AEIH 1FG2A 1NAKL 2VIRB 3VRLF 4PJ7A 1QFWH 3VI3F 1KCVH 2Q7YB 1FL5B 1MHHA 4IOIA 1JPTH 1FRGH 3U4AA 2VZSA 2AK1L 3TA3D 1H3UA 5IVZB 5LAXB 4PUBL 1H3TA 1YA5A 3A67H 4IDJH 3HZKA 2D7TH 5SV3A 4H0GA 2OZ4A 1T3FB 4HUUB 4HJJH 1R3LB 3MYJB 1FFPA 1UJ3C 1BD2E 1UVQA 4K8RL 4P2QE 4R8WH 1OPGL 3MV01 2ZUVA 4JN2B 1CD9B 2EDDA 2IH3A 1GZPA 4JQXC 5FCUH 1MAJA 3Q6GL 2ED8A 4HIHA 4X4YB 3OKDB 4QHLB 1F6AA 2ERJC 3HE7C 5SWZE 5C8JA 2F53D 5DJ0B 5F88B 1L6XA 2ZOLB 4OCRL 5F1NA 1X5YA 4BSWB 4MD5A 3B9EA 4XX1G 2GJ6D 1PQZA 3MMEA 2HTKD 2W0PA 3QB7C 1NAMA 5ESQA 5HHVH 4F3FA 3TPUA 1YY9C 4PJIB 3QYCA 4M4PA 1AXTL 4R2GB 2GYSA 3MA7A 4KI1A 4G7YL 1SY6L 1TCMA 4OD2B 3I02A 3PP4H 2DYPA 1CICC 4OAWA 1BBDL 3GEWB 3D6GA 2D3VA 2ZG3A 5GRUH 3BZDA 3RVTD 3VE0A 3BQUC 3IXAB 5EPMA 3SE8H 2FHFA 1YECH 1Q0YH 3QUMB 5AZEH 1FGNL 3O45A 4DTGL 3KG5A 4YHKH 3KPSE 5GGSB 1U3JA 2HJFA 4IMKC 4ZFOB 1XF5A 3F7PC 4PD4J 4Y2DA 2VDRL 5DR5H 4JM4L 1NFIA 4WFFD 2NPLX 3SGKC 3CMGA 2Y72A 2FR4B 5LCVH 4XCFL 2VDOH 3ARDB 3AS3A 4D9RD 4R3SB 5BOPA 3EJYC 2X9WA 3DURB 1L7IH 2AEQL 1A7QH 4Z5RB 5L2KE 2YC1B 1MRCH 2D0GA 5D96C 1EGJL 3UTPD 3UZVB 4YLQT 1S5IH 4AT6B 4I3RL 2GITB 4U1MA 1D5XA 3OKEB 5INDB 5FK9B 2W0KA 5D6CA 2DQJL 2J4WH 3CVHA 3UMTA 3KJ6H 1V7MH 1KPVB 1JL8A 5IB4B 3C5JA 4FQQB 5E5RB 1XGQB 3PQYD 3BGFC 1NCBL 2VLJD 2R23B 2DM4A 3K2MC 3E3QE 1FDLH 5J9PA 3IFOA 1F11A 4MZ2A 1F3JB 3HUJF 1FNSH 3X13B 4JFFA 2E7LC 4ODSL 4JFYA 1KJVA 4MA3B 3WXVL 4MXWH 3F58H 2FJFA 4ZFFA 1WAAA 3G6DH 2HVKB 4Y5XC 1CE1H 4UU9A 1N8ZA 3LN5B 4PJFA 2ARJB 1DBBH 1PG7H 3CFJA 3FAWA 2DM3A 3MNZB 1E6JL 4DGYH 1F4WH 5C0BB 4LHUA 2CD0A 1S7WB 3ESVF 5DFVD 4JHZA 2X42A 5TQ2H 1F45A 1RQ5A 1V7NL 5DC4B 2VDKH 4WFHE 3N06B 2NXZB 3RUGE 2GI7A 2LV4A 1QEWB 1J9CT 7CGTA 4P5KB 4G6JL 4IJ3C 5IVXB 4ODTH 5EU6D 5L2JA 4JFQB 4PTTA 3ROOA 2BFVH 2YXFA 5GSVA 5DC9B 3S4SA 2FX7H 4HWZB 5JNYB 4AEFA 5GZNC 1EO8L 5JHDD 4ONOA 2DTSA 4GRLD 3TIEA 4G6AD 5KSAB 4TTGA 4PRHA 5TE7H 4P4RA 5FFLA 5EUKA 2ADJA 4X98B 5KS9A 1K85A 5GGRY 3RIFF 2WLYA 1VACB 2EKSA 3DWTA 2C7UB 3ES6B 4EUPA 1MWAB 5JZ7C 1OTUD 5F6HI 5FHAH 3PXHA 3MLZH 5HBBA 4JM2B 2R1XA 1PYWA 3DVNB 1R24B 3EYVB 4K3GA 4KRPB 4L3AA 1R3JA 4PGZA 1MCBA 5C9JB 3RGHA 2CKBL 2Q8AL 1PSKH 4GT7A 3WFEL 4X6FB 1HH6A 3KLDA 1KLUB 3WXWH 3LKPA 3RDTC 4AH2B 2XT1B 1KPUB 4P2QA 3ULVF 2BNRB 1EJOH 4WCYL 1YPZE 4IOFD 5GISL 3EO1B 1KXQE 1FZMA 1NC4B 2AQ2A 1Z5LA 3VW3L 3Q1SL 1PKQA 5SWZA 3BGMB 5FYLL 2C1OA 2OZ4H 2CR6A 3BO8B 3H9HA 4NP4H 4AIZA 3CXDH 3CVIH 1PEZA 4TQEL 3GM0A 5DMKB 4ONFH 3HZYB 4PJDB 2Q20A 3DO7A 1OGAE 2YKLH 3ZT5A 1HDMB 3DGCR 4HGMA 4X5XA 5BV7B 5FGBA 1X5AA 1CFVL 4QRSB 1MJ7H 4Q9RH 4QHKI 3MRPB 5LBSH 4PGBB 5TDOA 3OX8B 2CLZA 1X5HA 2R56L 4LVOC 3ZKMC 4DVRL 3PJSA 5DD6A 2ORBL 1E28A 4HV8B 2HG5B 2P24A 2VR5A 3EDDA 4WI8A 4Y19B 3TO4C 4TSBH 2JCCF 2VE6A 3TBYA 4G42A 5I15L 4WV1C 4LOUC 2QQQA 5FCSH 1KN4L 4ODWA 1MHEB 4QRUA 1V3KA 1B6UA 3QUZA 4X6DE 5BJTA 3ZL4H 4YC2B 5GXBB 1NKRA 1XR8A 5TGBA 1YEDB 1IKFH 3Q6FB 3IB4A 5E6IB 1TCRB 2N4IA 4NQSA 5DA4A 5T1LB 2BY3A 4Y2DD 3KPSA 4FTVB 2HFFA 2DQUH 3SGDI 4YIQA 3V4VL 5IT2H 1J11A 5F89B 3RVUC 5F7EL 4OZIE 2YUVA 5DQ9B 5B39B 1T0NA 2EE3A 1MREL 3MFFB 4H26A 4GXUN 4EIZC 4MQXD 1L4IA 3WLBB 4L9LC 5FGCB 1D9KA 1WIOA 3D0LA 1EUTA 4L3EB 5EO9A 5L2KA 4NM8H 1LD9B 3BAEL 1JWSA 4WUKH 5L0QB 1XIWB 3IDGB 2W60A 1VDGA 1GIGL 5CILL 1K6QH 2D31A 1HQRA 1HXMA 2JJSC 3WO4B 4LASH 4RZCB 1D5ZA 1JHLH 2EIZA 2WLZA 3UDWC 2FEEL 1L9NA 2B7DT 4Y16A 4NN7C 4RIRB 4UINH 3LMJH 5EO0A 1DDHA 1VFAB 2EECA 4HZAA 4ISVB 1HXYA 4OZHF 5CBEA 1D5MB 4DOHE 4IOSD 2NY4B 5F9DC 4Q9BA 4KJYB 3VFSB 3D9AH 4HWBA 1U8HB 3TVMD 5EBMA 5T1KA 3L7EB 3E0GA 4PJ9C 3CVHH 5FF6A 1AXIB 2DLHA 3JZ7A 5JORA 4Y8DC 3QULB 3L3GA 5IESL 1OSPL 1YMMB 15C8H 3IDXH 4NPYA 4PBVC 4MVBC 2FX9L 1I1YB 3P9LA 3DSFL 1G7HA 1T66D 2EDXA 4PRDB 3EAKA 5IB3B 1OM3L 4LHUD 3FN0H 3FRUA 1LHZA 5BVJB 3I50L 4JG0H 5AYUH 1INQA 1B0WA 1MFAH 1F42A 43CAA 4BH8B 4G3YH 1GOFA 3NBNA 2XWBA 1U93B 3RUGA 1F4HA 4QHMB 4LSSL 1GH7A 2AV1A 1W72L 2VOTA 2X4TB 3MV7E 3P9WB 5KBNC 4KAQH 3LRHA 1JPFA 4P2RB 5FA4A 5IOPA 3LPFA 3ZKND 4BELD 2H26B 2Z31C 3LIZL 3TZVB 1MCQA 2GFBA 2XZCH 3T3PF 1GGTA 4L4VE 1I3GH 4BK5A 4JY6A 3V6BR 1SM3L 2FX8H 3LCYA 2APVA 3G5XB 2C3VA 2CPCA 2XN9B 1LP9B 3QDJD 4KY1H 4Z77B 4LLAA 4OBRA 1A4JB 3QQ4A 4OB5H 4M93B 1VGKB 3QBTB 6FABH 3O6LL 4L3EE 4KVNL 3BMVA 3BRGC 4QXTA 1ZLSL 4PLJD 3RTQA 5GIRA 1TTUA 1HEZB 2ZCLH 1EA9C 1T5XA 4AENA 3CMOL 4TOYL 2PYFB 2QSQA 1OP9A 3B2UC 5MEOA 1EZVY 1HSBA 1J0IA 3QNYA 4XZUA 4UDUB 1JI1A 5DYOB 4EUPH 5EU3B 3QAZB 1BD2D 4G80A 1M05A 4LIQE 4H20L 4U6YB 4P2QD 2H3NB 4N9GB 3FMGL 3NZ8B 4JAMA 3V2AR 1NLDL 3BZEA 4GQ9L 1UM6L 4OLVL 1UQSB 4FXKB 2R4RL 1I8MB 5SWZD 1NGPL 3PL6C 3O11A 1PZUB 1YPZA 1BZ9A 4Q2ZB 2DQIL 3BPCA 3L3DB 4JGUA 4UB0H 2NY0D 1RIHH 2UUDK 4GKSA 4XNMB 4U0QB 4FFWC 3SDCA 5JR1H 3WSQL 5CGYC 3CC5A 3V8CA 4WWKB 1S7VA 2EH8L 4ZSOE 4U1NB 5KVEH 1A3LH 1F2QA 2P5WE 1ZA6A 2PUQT 5C0GA 3MUJA 4JB9H 1MRFH 4XNYH 1S5HA 2EEDA 1HHJB 4DVBB 2BY0A 1NFDF 3EOTL 3HE6C 3F6IA 1AE6H 1ZHBB 1GVIA 1GGUA 2PXYB 3C5ZB 1CXHA 1LK3H 2E6QA 4JR9H 3K4AA 4RNRA 4LPXA 1HCFX 4LGSB 3QUZD 4YHIA 2C3GA 3H7BB 5EIIA 3QQ9C 4NN6C 5FYKE 4X6DA 1BMGA 5ESVA 5D7SL 3GSWB 1QFOA 4FABL 4AL8H 4CMHB 1TJGL 4RAUA 1MJUL 5JW5B 4PJ8A 3SDYL 4TUJA 2E9JA 4JPKL 1WJ3A 2PW1A 4PJ7F 1HHGB 3O3DA 5ACZB 4H0HB 4OZIA 1I7RA 2F8VA 3GMLA 3FCTB 1PX3A 2ZG2A 4QRQA 4APQC 3ZE0F 3CDGA 3CX5J 4NKMB 5ALCL 5GJSH 5L2KD 4NUGL 4DUWA 3D18B 5KAQG 3WEXB 3HMXL 2DDQH 3ABZA 2KZWA 3ZTJG 3BPLC 3EGSB 4OCWL 2LU4A 3H9SB 1YEEL 4JE4B 4QXUH 1EEYB 2R8SL 3LEXA 5F3HB 4Y16D 1BF2A 1WGOA 5H2BA 5HGHA 5K59F 5IEKB 1DCLA 5J12C 1ZTXH 4OLXL 4XBPB 4BQCA 2ITCA 2DM7A 4OQ1A 5BVPL 4KK8D 4P46A 4UT9H 1RK0B 4R7NA 3U9UB 5HHNB 3PWNA 1U8OA 3MRFA 3BSZL 3EDFA 1FYTB 5EG6C 2CQVA 3LRSB 2E8YA 4V2BA 3HZVA 2Z8VC 4XP6H 4NQEA 3BP4A 1Q0XH 2AABH 3WS3A 4F33B 3L9RA 3QCVL 1UJ3B 5JW3H 1SEQL 4FXLA 4HWBH 3EYSH 2ZJSH 3O4LE 1QVOB 3X3FL 5JQ6H 1B2WH 1Q9LA 2IG2H 3MBXL 1ACZA 2ERJB 1BVLB 3HE7B 2W59A 5ESAA 5KTEL 3QEUA 4PRNB 4WFGE 2ENYA 3IU4L 1VADA 2DTMH 3MV7A 1CF8H 4U49A 5CP7B 1HI6B 4X80H 4N8CH 1CR9H 4HBCH 5JLZB 1JNNH 4D0DB 4F7TB 1F4YL 1AGEB 4E5XA 4DAGH 5DDHA 2DI7A 4L4VA 5I30L 2NY2C 1CICB 1FAIH 5GS2D 4OQTA 4PRIB 3ZDZF 2OTUA 3C8KB 5DWUH 1ZT1B 4UT6L 1MI5E 2VDMH 1DBKL 5IM7B 1B0RA 1WICA 4YFEA 2YPLE 3IXTB 4PJHE 2P48B 1A9BB 1MHPL 2W65B 3BQUB 3RTQD 1UCBH 3LHPH 3NOIA 1RJZA 1XGRA 4NIKB 2P7TB 3Q3GA 2HFTA 4XPBH 5B4MC 4RWYH 5GZOC 4F9PC 3QCTL 4O5LH 4IHOB 5BXFA 3MV9B 3DX7B 3HG1A 4RAVA 1VFUA 3TNMA 5CBAA 5B39G 2F5AL 2Q87A 4QCIA 3RNQA 1CDIA 5A1AA 1WAAF 3MRBB 3KDMB 2B1HL 3NGBC 4I9WE 2J2ZA 3F6LA 3U2SB 1FLTX 3BKCH 5D96B 5SX5K 3MREA 3VXTA 3QIBB 4JGMA 4YX2L 1DP0A 5F7YC 3SDCD 1GJIA 3LOWA 2VLRA 5FKAA 1OGAD 1LK2A 1FP5A 1G9NC 2A6DA 2XRAH 1FIGL 1JNLH 4IS6A 4JFZH 3D5OF 4MJIB 2J8UF 3BGFB 25C8L 3EDEA 1LVEA 4ZSOA 2PTTB 4QTHB 5E1AA 2P5WA 2WIIB 5E9DE 1IAIH 5FAAA 2YPKA 4E41E 2A1WL 2J5LC 4GMTH 1P4BL 4B53A 4X7SL 2FHCA 5CKGA 5JW4R 1ZVYA 1ZT4B 2BVEA 4XC1H 1A6ZB 4HS8H 4Y5XB 3MGTB 4L8DB 4EI5C 3G04B 4I77H 5BS0E 1AP2B 1KIUA 5EU5A 1P6FA 1IGFL 2MJWA 4MJ6A 1FE8L 3IDJB 4HSQA 3ULUE 5I1GL 5DS8A 5C86A 3PNWA 5D5MB 4YBQC 5KS9F 3DETC 4PJ8D 3VXPA 1WFTA 4NO5B 3V95A 3UJTH 1FG9C 5GJTH 3V5DB 3VFVB 3T04D 1TXKA 2AKRB 3PDDA 2EH7L 4IIQA 1EAPA 4LKXB 3R0NA 1BHGA 3ILPB 4HEME 2WUBH 3MRHB 4IJ3B 1ZOXA 1L0YA 4ZTOH 5CJXA 3DRTA 2YUXA 4XBGA 5DUML 4NUJA 2X10A 3EIFA 1T2QH 4CNIB 2D7PA 1N2RA 1ZA3B 2BVYA 4KRPD 3KYNB 1UH3A 5FXCH 4PV8B 4WU7A 3I84A 5ICZB 1HQ4A 4ZD3L 5GS1C 1JK8A 2Y07H 5GGTL 2BXYA 4MS8D 4PJXF 3VFUB 1OWWA 2BNRD 3QNXA 3VXOA 2EIBA 4HKJA 1LQSR 5E95B 2RAMA 1NC4D 3STLA 4OM0L 3QFDB 2ZP0T 3VDAA 4QTIL 4D0BA 1ITCA 1E4WL 2FD6L 3DV4B 3EYFB 4QGYA 3GI9H 3UPCA 1U3HC 3E2HC 4PD4K 2WINB 4MJIE 1CFSA 4HCRA 1BEYL 2V2XB 4KUZL 4PJGE 2J8HA 4NDMA 1CGWA 4L8SA 2FJHB 4KHXL 1I85A 4TVPE 4GRMA 2NX5E 1UJTA 4JY4A 3QXTA 3RDTB 3OPZL 8FABB 3WFDL 3O4LA 1XGYH 4EDXB 1T6WA 4UTAL 5T5FL 4Y19D 4XGZB 1ZE3C 4XVUC 1KEGH 3JWOH 1S8DA 3UTQB 2NW2B 4NQTA 5I1DA 1SEBB 3HAEB 3K4ZA 3LVEA 4IRJB 2EEAA 4KKCC 2YEZB 1UADC 1A7NL 3DNKA 4AG4L 5ICXB 1BLNA 1BFVL 5JO5B 4OLWH 3UCRA 4LVOB 5IG7B 4B5EA 4JFPA 3IFPB 1QLRB 2ZCKH 4X4ZA 2H8PA 3G6JE 2FRGP 3G5VB 4FZEH 5BZDB 3EFDL 1RZ7H 3TO4B 3GHBH 3GDBA 4PJEE 3OAYH 5TPWH 5HDLA 3S7GA 4PP1D 4WV1B 4BFIA 4BQBA 1OW0A 3KAAA 4L3ED 2YPLA 5A40E 4PJHA 1YJDL 4Y4FA 4Y4HA 5KVMC 1ZEAH 2C5DC 1I1AA 1MAMH 4Y1AB 2ATPB 4OQTH 3VGAC 3QIWA 2OL3L 3GSQA 3RNKB 5ICYB 2CUIA 1CGSL 5DJDA 2YN5A 2JB5H 3GIZH 4HK0A 1TNMA 5C6PB 3HRPA 3BP7B 2DLIA 3O6FB 5A3IC 4M6NH 3THMH 4ZG1A 4RWHA 2C1PB 3EKCA 2NW3B 2VDPH 4L9LB 4RBPH 3ILQD 3VH8B 1YMHA 3DVGB 1J1PL 1XEDA 3A6CL 4ZXBB 1WFNA 3BH8A 6CGTA 3W9DA 5DJ6A 5DURD 5E94B 1V3JA 4LIQH 1R5WA 3O41B 1SJEA 4OSUH 1YDPB 1UM5H 3KNBB 2CK0H 2P5WD 4MCZB 4NN7B 2XKNA 4PTUA 3VCLB 4KVCL 3HPLA 3RUGF 2VABA 4TULH 3P0YH 4P9ML 1VSCA 1NGWA 2R29L 1U3YA 2AEWA 4AJ0A 5E9DA 2AS5M 4E41A 1S9XA 1QSZA 1XH3A 3RGVC 4GMSH 1ZS8B 4PJ9B 3SE4A 3DVFA 3HRZB 1MFCH 1G7JB 3RZCC 4HPYL 2FH6A 3TZVD 4NQUA 3OV6A 1G7IB 2EYRA 4C58B 5L9DH 2KDGA 1RUMH 5BS0A 5BMFL 3CK0H 1CLYL 5FYKD 4ACPA 3AAZB 3MRNB 4Z7QE 1NEZG 2EDJA 1FAKT 1F8TH 4HC1A 5DJ8B 4BZ1L 4UQ2B 5D71H 5I8OL 3EYQD 5KVDH 4OKVB 1FZJB 4HKZB 1T1WA 4YGAB 3LRGA 3FONA 1T5WB 2RR3A 3DUSB 4XP4L 2Q8BH 4M61A 2DF3A 5I73C 3OGOE 4HWEH 3FO1B 3RY4A 3PHQA 1PG7W 3T4AA 3NACL 1RJYB 2KUTA 4XXCC 4JY5H 3TT1L 2DLFL 1RZ8B 2FB4H 1LEIA 3K8MA 4WUUA 3DUUA 5F70A 1N7ML 1S9VA 5FYKH 1IGIH 5C0FA 2Z31B 5J6HB 1RZJC 2BVUA 1INDL 5E4IA 3CX2A 5F9WC 5H37H 1IAKA 1SJVA 2MTPA 3TYGH 2A77L 1QRKA 4PRAB 4S0TD 3WS6A 1CIUA 5CSBA 4OIBA 4B41A 3BEWA 3N9GL 1WWCA 4GBXA 3U6RB 4XTRD 3ZKXC 1YPZF 2VXVH 2E7MA 5GRJH 4PFEA 3VXNA 3GHEH 3MV8B 3PDOA 4Z76A 5CKAA 1WF5A 3ZHLA 4CJ0A 3X11A 4K71B 4NQXA 2FYYB 1MJ8L 3QH3A 4O2FB 4LSTL 4O2CA 4CN4A 1IC1A 2ICEB 3U1SH 3VRJA 1Q94A 4WEUD 5JPMA 3ARGC 1T7YA 3TYFA 3MACL 5HPMA 2A6IB 1T2XA 3RWEA 5HYJE 1IGTB 4JDZA 3OG4B 1IFHL 1ETZA 4PJGA 1S7TA 1A6VH 5HYSB 1RUQH 1ORQA 3O4LD 2NX5A 1KTRL 4OZFA 3W82A 5J6GB 4L8BB 1TZIB 2Y9RT 3GMQB 3PWVB 3PL6B 3DUHA 4WFGD 2DIBA 1P69B 3RY6C 5D70L 1DLHB 4HCRH 4BFGA 4X6DF 2BSSB 5KANI 5HGAB 1U8MB 4Y89A 1A0QH 2YZ1A 2YD3A 4LLYB 1CU4H 1VGEH 1FN4B 4MDJA 3O2VL 1E4XH 4NO0A 5K9OB 7FABL 2F9BT 4XVJL 4Y5VC 1NANI 4EOWL 5I66B 1CFTB 1QO3B 3F5WA 1DN0B 3QUYC 3PGFH 4GXUM 3FO9B 3HE6B 5I76B 4JKPH 5IB1A 5DEGB 1MI5D 1T80A 3G6JA 1BQLL 4O9HH 2YPLD 3A0OA 4ZUTA 4UOW0 4FS0A 4PJEA 4LSPH 1UZ8A 3GK8H 4JRWA 2IPTL 3DYOA 3QJHA 2KBGA 3QIWD 4NN6B 2YPVL 3H9SD 1MEXH 2ESVE 5FYLE 1F90L 5C09E 3TJHD 1KF9B 2FO4B 3X14A 4LSDA 5E2UH 2A38A 4ORZC 3QDGE 3MLPA 5K9QI 3RBGA 5H35A 1ED3B 1QQDB 1IZJA 3EOYG 1NMAL 1N5YL 3FB7B 4IRSC 5CEXA 4APQB 1SY6A 4LNRB 1K3IA 4U6HB 5JOPE 3MJGX 1J8HB 3I3DA 3UYRL 3L5XH 1FYTD 2L7UA 1JGDB 2DKMA 4XMPL 5TH2A 3BPLB 1AGFA 4GAYA 3U7YH 4MDIA 2X4PA 5FM8A 1QD0A 1RU9L 1OT2A 5IW6A 4Z7WB 5FOJA 5E24E 1D5BB 1KCSH 2IFFH 1DJSA 5HGDA 4XCNA 4OT1L 3ZO0A 1A6PA 5D7IE 1MCNA 3HMWH 3H9YA 1ZV5A 3T2PA 4GSDH 4WW2A 5J12B 4E42B 2ZUXA 5HI3C 2BZDA 1AGDA 2AGJH 3FQRB 5E9DD 3UTTB 1G7MA 1E27A 1R3IH 1NJ9B 2HT4C 3BWAB 4YHOL 3BESR 1KFAL 2NY1D 3U79A 1J86A 1NL0H 1LO5A 3V6ZB 3ZHKA 1I1CA 2YBRA 5FO7A 1MH5A 2PO6B 3L3KB 1UXSB 4EN3C 5BS0D 5IVOA 1N3NA 5ISZE 2GK0A 2DI8A 3DHMA 4TNWK 2I60L 2BNQE 3O6KL 4YWGL 3PWPE 1LEKA 4YAQB 5TFSH 1U58B 3O6MH 1EGJA 1CQKA 1N6QH 3SDAC 4TSCH 2DQFA 4GRWH 3BT2H 2F54B 2CXKA 3PABA 1DE4A 1YY8A 3SE9L 4NFDA 4MAYA 4CDGC 5D7JA 1SQ2N 3IT8D 2UYLA 4UNVA 3VRIA 5CLWA 3AREC 3HAEG 5I1LA 4H8WL 3UJJL 5E2VL 4HC1H 3F7VA 3ULUH 4XMKL 2AK4B 1T1YB 2WWMD 4XNXH 4H0IA 1F2XK 1QR1B 4J3WA 3QHZL 1JN6A 2DN7A 3C5SA 2LABA 1XF4B 5DRNA 5F7NC 3WYRA 2JELH 1OAUH 3GMPB 4X6BA 4JKWA 2ICWI 2NY2B 5DJAA 5DUBB 3K81A 3FO0L 5TDNA 4GBXD 2OBGA 4YXHL 1QPXA 1S7QB 1EEZA 4U6TA 1W0VA 5DMGD 5DTFA 4LGRB 2O93L 4XMLL 1O7VA 3J8F7 5IMMA 3O0RL 1GGCL 1QFUH 3CH1A 3DTXA 2GIYA 1GPOH 1HNGA 3F12A 4HS6B 3QIBD 5I2IA 3LD8C 5F9JB 5DJCB 4JDTL 1IGJB 2VSCA 3B8SA 4YFLI 2VXQL 3SJVB 4WJ5B 2CJUH 2P5EB 5HHME 4MJID 5DD3H 2Y23A 1OY3B 1CDUA 1NCCH 4NWUL 4OCXH 4TVPD 3QG6B 5HYJA 1N4XH 2NX5D 5LXGH 1A1OB 4JHAH 3NCFB 5E8DL 1JUFB 5JIIA 3NGBB 4PREA 3IGAB 3VH8G 3P4OA 1Y6NR 3FHAA 2WUCL 1XGPB 4PJCB 4WNQB 2LAAA 1WVZA 1MNUH 1TVHB 1DLFL 5ETUA 3HNTH 4XB8A 2WV3A 3IU3A 3BP6A 3SDDA 2YSSA 2A6JB 4LKCA 1GC1C 1IGYB 4NO0D 2VITA 1QSEE 4JFEB 3PIQA 3RI5F 4OZFH 1KG0A 4PG2C 5SV4A 1BAFH 3GUTB 4ERSL 4NHCH 4ZUUA 5C0AE 1HWGB 2YS4A 3FB5A 5D72L 4YHZL 2J5LB 1S9WA 1R3KA 3ZSTA 2JTDA 4PGDB 3OR7B 2CKBA 4X6CE 2EZ0D 1UKSA 4K8RD 1NAKH 3W0WE 3QEHB 5ACLA 2AK4E 5EZLA 4EI5B 2AK1H 3KLAB 2XG5A 1BIIA 1NBQA 4JPVL 2J7LA 3MJ6A 3RPIA 4PUBH 3QNZB 2AJ3B 4ZS7L 3MXVH 5EFIA 1RZKL 3L95A 2DKUA 5D9SA 2ESVA 2VR9A 5C09A 5FGSA 5IHUL 1FFOA 3P4NB 5F71A 3WIIL 1I8KA 3I6KA 3DMMC 1NUNB 4CKVX 5C70A 3QDGA 4K8RH 1U42A 3BHBA 4ZPTB 4J3VA 3UAJD 5EUOA 1U91B 3Q6GH 2ZOKB 3ULSB 1V8HA 1JZ6A 1AIFA 2JB6B 1FYHB 2VLME 3G6AA 1QKZL 5ID0A 4OCRH 3MRGB 2YD9A 4KK6C 4LCWE 5HYQB 3MO1B 2BDNL 4EVNB 2WBJA 3IETA 3DYMA 4S2SB 4NCC2 4QOKB 2IANA 5IMKB 1AXTH 4KJQD 3ARFC 5E2WL 2VUYA 2PW2B 4G7YH 5EBLA 1SY6H 5HGBB 3V6FA 5F7WC 1FVCA 5D7IA 5DK3A 4PGEB 1XZ0A 3JTTA 3M1BB 1BBDH 5DVMA 4NRYB 1RJLA 3VFRB 3QI9A 5I16B 2WW8A 5E4EC 5INCA 1OB1B 4XVTL 3ZYIA 3JTSA 3G5ZB 4KPHL 1DUYB 1KNOA 4FXGA 2HLFD 2OTWA 3QXVA 4IRJD 5AAMA 1U3HB 5T33L 4O51B 3E2HB 1T03L 3QO0B 1H3PL 1OP3H 4DTGH 4GKZA 1X7QB 4JREB 3BOVA 5ISZA 3CFDB 3C6LB 4CVXA 3SKMA 3Q5OA 2BNQA 5A43C 3PWPA 5HYSG 2IH1A 2VDRH 2XTJC 4JM4H 3IDYB 4POZC 5D7JD 1RY7B 2Y6SC 3B9DA 3QEGL 4XCFH 2UV3A 4PJHF 2V9RA 3T08A 2XOTA 4CVZA 4LOUD 4RGOL 2AEQH 2HFEA 1DUZA 4CVUA 4HK3J 3CCHB 4I3RH 2VRAA 3ULVL 2XQBL 3WKNA 4HS3B 4HAFA 4NO3A 4Z0BL 3S34L 4DN4H 4MJ4A 1HSAA 5M7QA 4TUKL 2DQJH 4KRLB 2R2BB 4ZQKA 3TBVA 2M8XA 4TRPH 1FZKA 3O6FD 4OFVA 5E00B 5C3TA 3X12A 1NCBH 3UYPA 3VWKA 4HKBB 1Q9KB 4DGIL 1J18A 4EI6B 4Z78A 3NCEB 1AGBB 3NN8B 5CZXD 3WXVH 3VXSB 4POYA 2FBJL 4ZXBD 1I3RA 3CFKB 3SKNA 1A02N 3P73B 5F7FA 2EE9A 4HEPG 3VGAB 4QOKE 2YMXL 1W72A 1UZ6E 2GJZB 3TGXA 2P46B 4P5MA 3QO1B 1E6JH 4CU7A 4KI5E 1I7ZB 3VMNA 5HYJD 3AFLA 4U1GC 4JLRA 4LQFL 1BVKA 1T1XA 3RWDB 4EBQL 1FRGL 1G9ML 5KSUA 5C3LD 1MJJA 1IQDB 1V7NH 4WO4B 4NQVB 3ZHDA 4GRWF 5F8QC 1DZBA 2DD8L 1ZANL 4KMLB 3S88L 4Z0XA 4UOJA 3FOMA 1OVZA 4G6JH 5DFTA 5E99L 4LPCA 1Y0LA 4KMQA 4HJJL 5DZOA 2DWEA 4CMMA 5E2TH 3PHSA 3TBTA 5A2FA 3VDBA 5LQBL 3ULUF 1D6VH 1CYGA 3KYOB 3S97C 1EO8H 2FSEB 4FQXC 4WW1A 1A6UH 4MX7A 1NDGB 1QSEA 1YNKL 4D9LL 2R2EB 1M7DA 4UDTA 1DQML 3CPLB 3EO9L 2YA2A 4MNHA 3KGRA 4XWGL 5C0AA 2IPKA 4N90E 5T3ZL 5GGRA 1MCWM 5HI5C 2SEBB 4G8FB 5B38B 4HKXB 2NTFA 2YD5A 3RGVB 3SDXB 4AMKL 3RZCB 3DX8A 3S35L 3QUXA 2X1QA 2N1KA 4RFEB 3W0WA 1GL4B 4XBEL 5DEFA 1CD1B 5DVKA 5FYLD 5D1XC 2FL5B 5M94B 3PGCA 2CKBH 1ZGLB 2Q8AH 1VEPA 3WFEH 5E8EA 5JXEC 1P84J 5FK9A 2BCKB 3VXQB 1IL1B 4OF5A 5CUSL 5DO2D 3FB8A 2Y5TA 3MV8D 3MJ8A 4WCYH 1OLLA 1T20B 5GISH 3VW3H 5JOPD 3Q1SH 4WDIA 3BP5A 5DJYA 5FYLH 2HJKB 2VLLB 3HC0B 3T3ME 1XGTA 5D1ZC 1YNTB 2A73B 4LCWA 5DR5L 4N8VB 2V5TA 4TQEH 1G7LA 4OD3L 5F9WB 3NABH 3RX8A 2M26A 3E6FA 1NGZB 1IAMA 5KANG 1CFVH 2OJEB 3I6LE 3RIFK 3QIUA 5FKPA 1QSVA 2HYMA 1GAFH 2QQKL 5E5MB 2R56H 4RMWA 4DVRH 3R06A 1G7QA 3PHOA 3ZKXB 3QI9D 2G9HB 2ORBH 1PY4A 3P9MB 3UTSA 5FDWA 3OXRA 5AD0A 3MUHL 2EDKA 5JIPA 1T4KB 5KSBE 5I15H 2J4WL 2UUDH 5DJ2B 4UNTA 1KN4H 4AM0A 1BJ8A 3KPNB 3WN5C 4HAGA 5CIPB 2QQLL 5ISZD 3ARGB 2JJTA 2XTLA 4PYHA 1CS6A 2H41A 4F8TA 3PWPD 3HMXA 1I1FB 3SCMB 1ZVSA 4HG4K 4XRCB 4MXWL 4LF3B 3IVKB 3V4VH 3G6JF 4OJFL 2FATL 5IBLD 2VLKE 5F7EH 1CE1L 2JIXB 1PGRB 1JWUB 4PJEF 1AQDA 1AHWA 5K9QG 1MREH 3RHWF 4CN6A 1FL6B 2VXUL 1T2JA 4AIXA 1SHMA 4MWFA 3TN0C 1F4WL 4L3CB 2F58L 3IF1A 1CQYA 2DL9A 3QJFB 1KCUL 3BAEH 3O2DL 4WHYG 2VDKL 4G9FE 1GIGH 5CILH 1KEML 3N50A 4FG6C 3C6SB 5C2BL 3MUZ1 5MHSE 4MA7L 4Y5VB 1KTDB 4OGYL 4X9GA 5KW9L 4I0CC 3VWKD 3P3YA 1BJMA 1CIDA 3PV6B 1IEAA 3BH9A 2FX7L 4G7VL 2Z91B 3LN4B 4JPIB 3VXME 3QZWB 3OXSA 3R1GL 5I1EL 1J8HD 1JPGB 5I18L 3TBWA 1P1ZA 2A6KA 1M7IB 2Z9TA 4JFOB 2VL4A 3GJFB 4CVWA 4PP2A 1HINL 1A4KB 4K07A 2WZPD 5IESH 2BOCA 3RZWA 1J0YA 2FX9H 1KIQA 3IJHA 3DSFH 3S35X 1DBAL 3LKOA 5J56B 5CD3B 5HHMD 1OM3H 3Q5YA 1W0WA 2VN4A 4ODHL 3N0PB 1QSFB 5FHAL 1XF2A 2ZNXA 3RY5A 5E70A 2Z8WC 4I3SL 1VFMA 4IRSB 2BVQA 4ZFZB 2HTKC 5DI8B 5EOCH 4LSSH 1W72H 4PJBB 1PSKL 1IAOB 2PO6D 5A2KH 2R69L 3NIGF 3LIZH 2NY5C 3QEQB 4UIMA 5AEAA 1L0QA 2Z92B 5EOQL 4I0PC 4Z7QF 5IF0B 1QSED 2Y36L 5AG8A 1J8KA 5IGXL 3QWOA 4J23A 5I8CB 2P43B 1H3GA 3V7MA 5IP4A 3ESUF 3S37L 3GSOB 5E8OA 5C0AD 1SM3H 2EXYD 2MKWA 4FHBD 3RVTC 2F54D 3Q48A 2APWA 5MENB 3DARA 1BOYA 4M5ZH 3RBSA 3SE3A 4GG6B 2X70B 4QWWC 4KWUA 3BN9C 1JF5A 1HILB 1BFTA 3RVXD 4LRNH 3TNNA 2DQCL 4EJ1C 3QUXD 2X4RB 1QRNE 1FHGA 3W0WD 3CDYA 3PE9A 3IAGC 2AK4D 4KVNH 4HGWA 4FFVD 4MCYB 1G84A 1ZLSH 1P2CA 3LKSB 3JBG7 4TOYH 2CKNA 5LGJA 1A2YA 1HHIA 2D9QB 1RZGB 1Y18B 3BZFA 3NIFF 4QT5A 2Y06L 4PGCA 4I2XE 5E1HB 4CADB 3SDAB 2VXSL 5EU7C 3VG0H 4M3KB 4HULB 3VGFA 3MLXL 1CLCA 4H20H 3O3AB 4G6FB 3FO2B 3GKWL 4P59L 4JKLA 3W2DL 3FMGH 1NLDH 1RZIA 1U8LB 4GQ9H 1UM6H 4RGNE 4V2CB 5TJWK 5J06A 3S9DB 2R4RH 2JF1A 3OKOA 1NGPH 2VLMD 3RWIA 5KSVA 3AREB 4J8RB 2IAMA 5B8CC 2HH0L 1D6EA 2DQIH 2FIKB 3IFLL 2DLTA 3CFEA 1QA9A 3P4MA 3S5LA 5DQJB 2P5ED 4MNGB 3W9EA 5E5UB 3OMZA 1YMMA 3WSQH 3EOBB 3WCYA 3HCVA 2IC2A 2EH8H 4KKNA 4NKIL 4JZJC 4NQDE 1UKQA 3KLHD 1X5XA 3ZMRA 4ZAKA 5SX5H 1HYRC 2XQYK 4KQ4L 4LLUB 5EC2A 2D0FA 3KR3H 4BH8A 5IW1B 4M48L 1HNFA 5CAYB 1NLBL 1KTLB 5KSBA 1I9JL 3LD8B 4MNQE 1ZKAA 1ES0B 2X4TA 2HRLA 4W4NA 1MAKA 4LLWB 5F3BA 1LDSA 4M62L 4FQHA 5DFVC 4JFED 1JGVH 2BMKB 4K9EH 3MPCA 5FV2A 2NNAA 5D7SH 4JZNB 4KK9D 4P2CG 3L3IB 1X9QA 1P4LA 3IYLW 3T0DA 1TJGH 4YXKL 1AY1H 1MJUH 4JRYB 3SDYH 4JPKH 3ARBC 3O9WA 4X8JA 2ED9A 4QHUB 4BKLA 2VLKA 4LU5L 3VFOB 4WFEE 4NUGH 5GGTA 4LCYB 4EI5D 3HMXH 5D1QB 4GRLC 1KJ2B 2ATKB 2EDWA 1MFAL 5FEBA 3ZTJH 3ARSA 1FZOB 3H6JA 3ZE2E 4OCWH 1PKOA 1YEEH 3TM6A 4YBQD 4G9FA 2WNGA 3FTGB 2W0LA 1BJ1H 2ZWLT 3LQAL 5EUOF 3H0TA 1OTUC 4OLXH 1AKJA 5BVPH 5EO1A 3S37X 4BUGA 3NFSL 2XZCL 3GSRB 1EHAA 4U6YA 3VXMA 1KJMB 3W39B 4HT1L 1GOHA 4AEHL 1I3GL 1BBJB 2YK1L 4NRXB 4FXKA 5EN2B 5DMJB 3BSZH 4C57C 1DL7L 1BFSA 5MEPB 5IHBA 4WU5B 1TLKA 1D3CA 3BWUC 2W0FB 4QOKD 1KTKE 2ITDB 4KRNA 4HUNB 1CT8A 2BOBB 4KI5D 5F7DB 4DKAA 5D2NC 3QCVH 4IEFB 1TTFA 3BDXA 5DRXA 1K4DB 1SEQH 5D93C 3SGEI 4HIEB 2VQ1A 3X3FH 2BJML 3MBXH 4QRPE 2Y7QA 3MGOA 1GHFL 1JTTA 3GSXA 3ECBA 1RZJL 3BIBX 3QXUA 3IU4H 2RIKA 1JMXA 1XT5A 2PXYA 2RCSL 3QQ3B 2HKFL 1FQ9C 2E7CA 2NYYD 2GCYA 3C6LD 5I1CL 2FECI 1P7QB 2IQAA 3LS5H 1X44A 1T21A 4HH8A 3KPLA 4HIIB 5C7XL 4N0CD 4WTZG 2X40A 1WCBB 3UC0L 1IRAY 4KTEL 3QHFL 3WHXA 2OL3A 1IKNA 3GIVB 4N90D 2BVPA 4UT6H 3INUL 2MCG1 1DBKH 5FA3A 2FBOJ 2VERN 3OF6A 3RVVD 4OD1L 5JR1L 1NBZB 1MHPH 4NFCA 1T04A 3EW3B 1A3LL 3S3JA 4Y2DC 1TTGA 4J6RL 3F65A 3WNKA 1A1NB 5FO8B 1TJIH 1JV5B 2H9GA 2WQ8A 3MJ9L 4XAKE 5IEHB 2R2HA 3QCTH 3ZYOA 4LPUA 4CN1A 4FQ1L 4G8IA 1PZ5B 1LK3L 1HWHB 3D87B 1BQUA 4MQXC 2XTJB 3IKCA 3V6OC 1XR9B 1NC2B 4I2XA 4U1LA 2F5AH 1FO0L 1GSMA 4MXVE 1DVFB 2IAMD 3RKDC 2B1HH 1ZT7A 5CWSB 4UQ3A 4CDHA 1NGXB 4RMTA 4FQIL 1MQKL 3U4EA 1UWEL 2EDYA 4H5SB 2KZ1B 3LH2L 3MBEA 2GJJA 4YX2H 3L7FA 3WDIA 4JFDE 2CLRA 3RWGA 4I4WB 5DK2B 2VDNL 4MD0B 3RWJB 3O3EB 1S9YB 3SHSA 3A6OA 1FIGH 1LNUB 5E8PB 4F37F 5IB5A 3MRRB 3I6LD 1WC7B 4ZPVB 2AJVL 4WO4D 2YA0A 3VI3E 2DDQL 3TVMC 2W9EL 3HN3A 4NQDA 5DGQA 4Z6AT 3HI1B 2HN7B 4FQLL 1NEZA 4BSVB 2A1WH 2XZQL 5F96H 2VKWA 1P4BH 4ETQB 1HH9B 4OV6F 4U1SB 4X7SH 1T66C 3DROB 5F8RC 3JV6A 3U0PB 3NFNB 4PRNA 5IJKA 4NQCB 3SBWC 4MNQA 1IGFH 3NPZB 1FE8H 2GTZB 1QFWI 5I1GH 3MRDB 4DZ8A 4U1GB 4OFDA 1MCFA 1YN6A 4H25B 3EYOB 3HUJB 3RQ3A 5DSCB 3O9WD 1KLGA 3D48R 2EH7H 2C3HA 3ZKNC 2CDFA 4R97B 1FC1A 1UB5B 3OL2A 4PY7B 5FECB 1YEKL 3BKML 2NLJB 4G9DB 1UXWA 3FAXA 4GW4A 1IE5A 1JZ7A 2E7BA 3FQWA 1FC2D 2R4SL 5DUMH 1X6NA 5KN5B 5IM7A 4N0FA 4GJTB 3RIAF 4DUVA 4GO6B 3IDNA 4URTB 3K80A 4FQXB 3MRIB 2V7NA 4YHNA 4YPGA 1QZ1A 4OV5B 2I5YL 4K3DL 3BISA 3GMRA 5MHSD 1DN2A 3OAZH 4ZD3H 2R9HC 3SKOA 3N1MC 1MVUA 3B9KA 3MRLA 1AKJD 5GGTH 3VGDA 1T22A 1Z9OA 3C8HA 3OTTA 5EULV 2DAVA 1A1MB 3JV4B 4PLJC 3VXMD 5EC1B 5DJZA 5IBTL 4CW1B 3M07A 4OM0H 2HKHH 1ERNA 4ELKA 3FT4B 4QTIH 1CGYA 3J7HA 4BSJA 3FFDA 1B6DA 1WUNT 3OQ3B 2JLLA 2VN7A 1E4WH 1KENL 1N26A 1V5JA 2FD6H 4Q58C 4X4XA 4OIIL 1CK0L 5KG9A 1HKFA 5DWUL 1MCIA 5D1XB 5E7BA 3KXFE 4X7FC 2IMMA 5KOMC 4N1CA 5FOBA 1BEYH 4KUZH 3CGTA 2HJLB 4DFIA 1U2CA 4KHXH 2HVJB 4PLOB 3MRKA 1UCBL 2PCPA 2Q1EA 3OPZH 2O5XL 1IC5L 4UUJA 3WFDH 4PRPE 1U8NA 4HGKC 1IMHC 4UTAH 5E2JA 2AJZA 1ZSDB 4XCEB 5T5FH 3SGDH 1ZHKA 2VC2L 3C9NA 4QRPA 1A6TB 4BFEA 2NY0C 5IVXF 3FJTA 5FGBC 3PWLA 2FEDD 4S1DD 1RV6X 4LHJB 4LPTA 5D1ZB 4DZBB 5KAQF 2X4NA 5I75B 2V2TB 2HP4A 4P3WA 4OFYD 3BEVA 4H1LG 2VZUA 4OCMC 2X44D 3P4LA 3K2UL 3PF2A 3SCMD 4OZGB 1A7NH 4AG4H 4Y4KA 3QISA 3IDJA 1BFVH 3CFIC 2PN5A 2R1WA 2F74A 2D7QA 1A9EA 2IALA 1GGBL 5D5MA 1OSZB 2JIXD 1T1ZB 1II4E 3QUZC 1ADQL 1Q9OB 3FQNB 3OF6D 4JO3L 5J3HD 4U2ZA 3EFDH 4KV5F 5AAWA 1G6RL 5IK3B 3WMSA 2XRAL 5HHXL 2HMID 1XCTB 2EDOA 1QRND 2Q76A 4X7CC 1ZHLB 1YJDH 1MVFA 4P4KB 4L4TB 3TO2B 2I07A 1X6LA 1UKTA 4F7EA 3S96B 3CLFL 2CO6B 5IQ9A 2OL3H 1ZA3A 4Q6YA 4RFNC 1CGSH 3IAPA 2ILLA 3B83A 3BGAA 4XC1L 5MEQB 4YZFF 4U1KB 4NOBA 1M6OB 3QRGL 2BSRA 3L5IA 3T4YA 1BX2A 4RGND 3GGWB 5B3NA 4KFZC 4XNQB 4LEXL 3TN0B 3MBED 4JO2L 4ZOCA 2RGSA 4M5YL 1GC1L 1KGCE 3C08L 1J1PH 4P3CL 2G5BA 2FWOB 4Y16C 5CD5D 3A6CH 3VD9A 1NDMA 4PJDF 2AXGB 4NC1E 2F8XC 4JFDA 5DZLA 3S3PA 3E3QC 1LEGB 2WUBL 5FM4A 4KK8C 3ARZA 1NQBA 3V7AG 3WUWG 1CFQB 2CIIB 4KVCH 4OZ4A 1XCQA 1T2QL 4YK4B 3OKKB 4P9MH 1EVUA 4F7MA 2R29H 1GYAA 4LCUB 3RJDA 4D0CB 3BJ91 4BJLA 3P77B 1FNGB 4A6YL 3I2CL 4Z9KB 4NNXB 4HPYH 4MNQD 4FFYL 2LU3A 5GS3A 2GTWA 2DBJA 3MXWL 5J13C 5BMFH 5FYJU 1XF3A 5F72S 1CLYH 1P84K 3VJ6A 2NTSP 2YEZA 4ODBD 5I8OH 4BZ1H 3ULVE 1J1XL 1I7UB 5EBWA 3UPRA 3VFMB 4OZHB 2F53B 3CDFA 1BQHG 4XP4H 3B8YA 3T0EE 2D0HA 2GJ6B 3RAJL 3ZDXF 3BD5A 5C6WH 4ODVL 4PY8J 3KPMA 4ODUA 5GS0L 2DLFH 4XWOD 2N56A 3AY4C 4DCQB 4WFED 5BZDA 2UWEB 1EDQA 1EFXA 4OI8A 4MQ7B 2YR3A 3TT3L 3D39B 3MCLL 4WV1A 5CLTA 1H15A 4I0PB 2EDEA 1INDH 1VPOL 1TVBB 3WHE0 3VFPB 4AEEA 4N68A 3M8OL 5DMIL 4G6ML 3ELAT 1KCRL 2A77H 1MY5A 2C3XA 3B9KD 5I71B 3SDAD 1OT1A 3ROLB 3B9AA 3IAQA 5C07B 4C83B 1H8NA 2JCCE 1DQDL 3N9GH 4AQ1B 3V5KB 3RTQC 4F58L 4GKNA 1M71B 2EYTB 4ZS6D 1JYWA 1DBML 3SKJL 3EHBD 3QPQD 4K3EL 4BQ9A 3CSBA 3F7RA 5H94B 1MJ8H 3S6CA 5TDPA 2XFXB 3KPPB 3VH8A 1FORL 1H0DA 1SYSA 3MNVA 3MACH 2IGFL 4P23B 2X1WL 4PPTA 3KXFA 2JJSA 4U1JA 4K7FB 1IFHH 5E94A 4L5FL 2G2RA 1AR1D 3FQTB 3U36A 5EWIL 4ZYKB 1QACA 3LZFL 1KXVC 4QRPD 5KSBF 4Y5YA 5F21B 5CEYA 1JI2A 3ARRA 1FNLA 4PRPA 5HJ3B 3SDCC 2P8LB 4I48A 5B8CB 3L5WA 5D70H 4S1RL 2YUZA 3GIZL 5T3ZE 2FCBA 2LFGA 3BIKB 1N5AB 3FQXA 3OJ2C 1A6AB 5T1MB 2VLJB 3L5JA 4DK6A 3D0VB 2I9TA 4Y4KD 3O2VH 3MRJA 3PGDA 2XNAB 3OJDB 7FABH 4OLYL 5EH1A 5I74B 5MERB 4JRYD 4NJAL 1MCHA 3MRNA 1G6VK 4NKDA 2B1AL 3WDHA 5ADOL 4Z8FL 3D69A 2YWZA 2XZAL 2QADD 3FB6B 3I6GB 1CFNA 3IDIA 3BFOA 1LO0L 4XH2B 1T5WA 4LLMB 3QSKB 5D1QD 1MLCA 3E6HB 1GZQA 2GSIA 4PJAE 3LDBB 3D39E 4U6VL 3VD5A 4PJ8C 4NSKB 4DKEL 4RCAA 2IPTH 3LB6D 1IEBA 5C0DA 5FUOL 2YPVH 2WIMA 3MNWB 4YDJB 4MQTB 1F90H 4HXAL 3WL9A 3BKYL 1RFDL 1LO3L 4XAKD 1ULVA 3OKNA 5C07E 1NFDB 4GMSL 3SY0A 4P5TA 35C8L 5EU6B 4DEPB 3KYMA 3ARBB 4X99B 3NCCB 5L9DL 1NMAH 1RUML 1N5YH 3BIAX 4U1HA 4Z18A 4ORGA 5ITFA 2EICA 3T3PE 4F15C 4GRLB 3U4BL 3K74B 1A64A 1K4CA 4J12A 4PB9L 4XMPH 1JCKA 2Q8BL 4HMEA 4JFDD 4PR5A 3W81A 3MJ7A 1AD0B 1RU9H 1P7KA 3DIFA 5HDBE 4MS8C 2K9UA 2NMSA 1FG2B 3G5YB 4PJ7B 4OT1H 2A0LC 1NCTA 2X7LA 3OAUH 1MHHB 4IOIB 4ZUVA 5AUMA 4NM4L 1J5OL 2Y1VA 1JPSL 4ZUWA 2HLAA 2FECL 4AYFA 5IB2A 1N6UA 4B0MM 4NC2B 4YHOH 3MLUL 1KFAH 3DXAA 3T2NL 2CRMA 2FJGA 4OUUA 3GMQA 5E03A 1P7HL 1FFPB 1UVQB 5CJOL 1I8IA 1UEMA 3OJVC 3IJSA 5J1TC 1A14L 2OLDA 1GZPB 3RL1A 5AYQA 4WHTA 4HIHB 1F6AB 1P7QD 3O6KH 4YWGH 5C8JB 5F1NB 3V0VA 1MFNA 5D93B 4MD5B 3R0MA 4JVWA 1PQZB 3MMEB 5ESQB 4F3FB 1NAMB 3SE9H 5I1AA 3T0EA 3KPQA 3AXLA 5K33A 4F7CA 4LQ1A 5DHXB 3MA7B 3HAEH 1OD9A 4M6ML 2HRPL 4H8WH 3I02B 3UJJH 4XMKH 3U46A 2FZ3A 2DYPB 1RUPL 4PYGA 3QHZH 4OAWB 1V3MA 4GAGL 2VB5A 2OR9L 2V2WA 1Q38A 5HVWA 5HGGS 1RUAL 5HHQA 4HHAA 2FLRT 4JEGB 43C9A 3VE0B 3UX9B 1AO7E 5EPMB 3REWB 4YXHH 4YHML 2YOCA 5DJXA 1A0QL 3HKFA 2JCCA 3OAYK 4XMLH 3N1GC 1DVFD 1CU4L 3EZJB 1VGEL 3O45B 4MYWB 3QDME 4HUVA 1YNLL 32C2A 3P2TA 3KYKH 1B4JL 3O0RH 1GGCH 2VISA 3O81A 1UEYA 3OZ9L 3O3BA 2HJFB 4NKQB 1XF5B 5CHNA 4Y2DB 2BHZA 3DLQR 1NFIB 4JDTH 4LSRL 1TIUA 2VXQH 4JKPL 2DQDL 3IFNL 3KXFD 4MHHI 1OAXL 4WI6A 1JFQL 1NCDH 4LSPL 3ZE0E 3GK8L 3ILQC 1CXKA 1OAYL 5D2LE 3EFFA 4PRPD 1D5XB 4U1MB 4YBLC 4RBPK 3OKYA 4E42A 1KLFA 5D6CB 1KJ3L 2GUOA 3CVHB 1KYOJ 4RMUA 2WP3O 1O7SA 2WUCH 3C5JB 3BWAA 1DLFH 3BI9X 4JJ5A 1S7RA 4NQCD 4KROD 5IMOA 5J9PB 3IFOB 1F11B 3UPAA 1JNHA 4JFFB 2X4SA 2Q3AA 3RA7L 4JFYB 1KJVB 1JRHI 4K94C 4FNLL 1NBYA 1A47A 2FJFB 3RX7A 5I9QC 4ERSH 1VEMA 3P30L 4KKBD 3L5XL 4EXPX 4YDLC 1X5LA 5D72H 1U58A 3DV6A 4YHZH 1N8ZB 3QT2A 4PJFB 3CFJB 1XFPA 1JMZA 1WV7T 5E56A 3TBSA 4LHUB 1VKXA 3ZE2F 1MCDA 2WK2A 4JPVH 4JDVA 4PJAA 1R6VA 1QUNA 1G7PA 4IIQC 4ZS7H 1T1YA 1RZKH 2E27L 5F44A 4F7PA 1JF1A 2MQ0A 4RMSA 3QA3A 1NEUA 4P5TD 5IHUH 3V79C 4M93C 3DI3B 5L2JB 4GG8A 4P3DA 4HX1A 4PTTB 3ROOB 3WIIH 5J57B 1YEFL 3S4SB 4NYLA 4M9PA 3RWFA 5CZVH 5F7KC 5E8NA 3TIEB 1E4JA 2DBLL 5EOCJ 2NY5L 2VMFA 1KGCD 4PRHB 3RI5K 5BQ7A 1PJ9A 4P4RB 5EUKB 2ADJB 4PLNC 5KS9B 2BDNH 1AQKL 2EKSB 3ZDZE 4XTRC 2DLGA 5IFJA 4EUPB 4ZFGL 5E2WH 3SJVA 5D7KE 5L8LB 1LILA 3NH7L 5JPNA 5I8KH 4HC1L 2E9IA 1KIPA 1HCVA 2I26N 2R1XB 1PYWB 1AGCA 1R3JB 5F1SA 5C0JA 3REVA 1NH6A 2B4CL 1WBYA 4KPHH 1HH6B 3SPVA 2HTLD 3DO3A 1I85C 3UZEA 3WFHA 2BC4A 1OQXA 3LKPB 5T33H 1TQBC 1BD2B 4OCYL 4WI4A 4WNQA 1H3PH 4P2QB 2HAZA 1R5IA 3C60A 5D5MF 1FZMB 1PKQB 2CH8A 3ETBF 3ULVD 5SWZB 1CTOA 1UG9A 1EUUA 2C1OB 3H9HB 3SGJA 2EO9A 3O2DA 4AIZB 4YEFA 4M7LL 3MLTA 5IHLB 1NKOA 1QBML 4XAWL 5T3XL 4E0RB 1FVDA 1ZMYA 3DO7B 4MD4B 3QEGH 1SJXA 4MJ2A 2CJUL 4X5XB 3AS0A 4RGOH 2X4UA 1B90A 1FFRA 5TDOB 2CLZB 4CMHC 4P4KD 4ZO7A 3PJSB 2J8UE 5DD6B 3ULVH 1E4KA 1E28B 2XQBH 2RHEA 4Z0BH 1EFQA 2E9BA 3S34H 2P24B 2AEIT 4TUKH 1B9ZA 3TBYB 4G42B 4D3CH 5JW4Q 4YUEL 1FVEA 2GSGA 3PUCA 1OW0C 4ODWB 1IGCL 2YRLA 4QRUB 2VJXA 4PG9A 3QUZB 4Y4HC 1AO7A 5BJTB 4DGIH 5CCKL 1I1AC 1FPTH 1WWWX 1XR8B 5TGBB 3SN6N 3QIWC 1Q1JL 4NQSB 4K3HA 4LPVA 3D25B 3OKLA 3QDMA 1MRDL 3KPSB 3TJHC 1Z6JT 2WM0A 4YIQB 1H3WM 4PJ5E 2FBJH 1MHCA 4HQQH 1CLOL 4ALAH 3MRCA 1AJ7L 2YMXH 2VR4A 1T0NB 5DRWA 4RFNB 4H26B 4NNYA 2OP4H 4G8GE 4S2SA 4HH9B 4LQFH 1ND0A 4W70A 3D0LB 4EBQH 5EO9B 5L2KB 1G9MH 5B3JE 1JWSB 5GS1A 1CDJA 2W60B 1S7UA 4ZOEA 5KVGL 5J1AA 2D31B 5BZWA 1HQRB 3ZSSA 5D2LA 3MXVL 2DD8H 3LQMA 1ZANH 2EIZB 3S88H 4MB4A 1UACH 5E99H 2PKDA 2Q86A 5C0IA 4X83A 5T3ZD 4Y16B 1C5BL 5EO0B 3CLEH 3GRWL 5LQBH 1RUKL 1DDHB 2EC8A 2ICWA 3M17A 4AIOA 1HXYB 2BVTA 5CBEB 3ZKSD 5JDSA 4PJXE 1VA9A 1PKQE 1YNKH 1BJ1J 2CRZA 2XG4A 4D9LH 1X7QA 5EBMB 2QKIA 5T1KB 5FF6B 3RVWD 1DQMH 2NY1C 3EO9H 5JORB 1QP1A 5LGHL 3L3GB 4NPYB 4XWGH 3HZMA 3JV5A 3P9LB 1G7HB 5T3ZH 1FJ1A 3FRUB 1INQB 1C5DA 4AMKH 5SWSE 3S35H 2G60L 1FGVL 3D39D 1C8PA 43CAB 4I0PD 3LEYL 4PBXA 4XBEH 5J13B 1KB5L 4R4BA 4ZNEE 2Y5EA 4BZYA 2XWBB 3RUGB 3CCHA 2AV1B 1KELL 5C07D 4OI7A 5TF1L 2PYEE 1JPFB 5FA4B 5IOPB 3MGAA 3VMOA 4QWWD 5CUSH 3BN9D 2WWMC 2GFBB 2QJDA 4XI5D 1MCEA 4X5WA 3WS6C 4YDKL 3WNNA 1KN2L 2C3VB 3WFBL 4TUOB 2DI9A 4GBXC 4NZDA 4OD3H 3PWUA 3CFKA 5DMGC 4P23D 4L29A 4LSVL 3QQ4B 3OWEA 4ONHA 5A2LH 3WJLC 5B22A 4NT6A 2AJYL 5EU4A 4QXTB 2CGRL 4LSUL 3RTQB 2QQKH 1PVHA 5GIRB 3LS4L 4X0KA 2A2QT 1T5XB 4AENB 3QIBC 3U30C 3DHJA 2CRIA 3CUPB 4DFHA 5MEOB 5DF0A 5ELIA 4DN4L 1HSBB 1JZ5A 3QNYB 4XZUB 5ENWA 5JQHC 4S0SD 4TRPL 1RHHA 3EJJX 4G80B 1M05B 2QQLH 3C60D 1DANT 4UIKL 3T77A 4FQ2L 3C2SA 4XP1L 2AXFA 4RISL 3AS2A 3B6SA 3O11B 1YPZB 1BZ9B 3MLVL 1JHTA 2FSEA 4IMLA 3BPCB 4OJFH 4S10A 2FATH 4UNUA 4P57A 3WFCL 5C0EA 4GKSB 3T1FA 2X4OA 3QFJE 3SDCB 2BNUA 3I9GL 4KGLA 1OGAB 3CC5B 2VXUH 4UOW1 1S7VB 2MQCA 1OAQL 1ZA6B 2F58H 4GLRI 4HKXA 2VZOA 1KCUH 3O2DH 3V5HA 1FV1A 2J8UA 1KEMH 2OYPA 5L6YL 4JHWH 5C2BH 4MA7H 2D7OA 4OGZA 3WKMH 5F7HA 4OGYH 5KW9H 3CH8A 2EZ0C 4RNRB 4K8RC 3BXNA 1AO7D 4YHIB 1C1EH 1I8LC 5E2TL 3ARBD 5EIIB 3KHQA 1B0GA 4XVSH 1D6VL 4G7VH 2BCKA 4X6DB 3QDMD 3BKJL 4I13B 5ESVB 4LHUG 3R1GH 5I1EH 3QPXH 1A6UL 1YUHA 5I18H 5E08L 1UA6L 4RAUB 2EIEA 1ONQA 4PJ8B 4TUJB 5C0ND 1HINH 4PJ5A 2PW1B 3PP3K 3VWJA 2AI0L 3O3DB 4JFXB 4LNVA 4OZIB 1I7RB 2DLEA 4MB3A 1DBAH 2AV7A 2B2XL 3GMLB 1KBGL 5F6HJ 3WE6A 1AH1A 3CDGB 3UAJC 5JTWA 1TJHL 5IIEA 4ODHH 3S4SG 4G8GA 4X9IA 3RHWK 5AWNL 5K9KA 1CGXA 4I3SH 3VXUE 1DBJL 2IQ9H 4I1NB 1CDYA 1FBIH 2J88L 4YR6A 2UZIL 3GMOB 4WTZA 1ZWIA 1JF6A 3LEXB 5IV2A 3STZA 4F15B 2X05A 5SWQA 4KJQC 3AM8C 5H2BB 5HGHB 5ABDE 3EO0A 3QG7L 3KPRE 1RSFA 4WW2C 2R69H 5JIKA 4FOMA 5EOQH 2ITCB 1QLFA 4P46B 2DKSA 4FQPA 2Y36H 1U8PA 4FA8A 5IGXH 3ALXA 4R7NB 4DOHB 3PWNB 3D2UA 1U8OB 3MRFB 5E6ZA 4MB5A 4LEOA 4PJXA 3S37H 3V9FA 3GB7A 4Z95L 1Z9MA 2HLFC 3WFZA 3MJ9A 3HZVB 4IRJC 2D9CA 3NABL 3BP4B 4IRZL 4QHKJ 4ZDHA 2G75A 4JG1L 3WS3B 2DQCH 3L9RB 4R7DA 2DYPD 1FO0A 1OP3K 1GAFL 5SWSA 2Z8SA 1YN7A 1Q9LB 5I1HL 3JUYA 3GBML 5ESAB 5D7JC 3QEUB 5L8JB 1MCOL 2Y06H 4ZNEA 3ZE1F 5IKCB 4YBHA 4BZ2L 1VADB 3MV7B 2VXSH 2MOVA 1MELA 3QUKA 2PYEA 3MLXH 3KPOA 4MHHG 3GKWH 4P59H 3V7AE 3W2DH 2DL2A 2EIDA 3QUYA 4E5XB 4BUHA 1KIRB 3H8NA 5DDHB 2GY5A 4L4VB 2HH0H 2K7PA 4HUWA 3MUGA 4U31A 5E6YA 1UFUA 3IFLH 3FT3A 3GSNL 2OTUB 1Z9LA 3O6FC 1B0RB 3EOAB 5A2JH 2EXWD 2WSKA 4NKIH 2A83A 5CZXC 4M7LT 5F7UA 3TLRA 1RJZB 1XGRB 4ZXBC 3D1MC 3Q3GB 2XWJA 3RKDD 2WP3T 1YEHL 3AMLA 4KQ4H 3WUZA 3DBXA 4F80A 4W4OA 4LCCC 1QBLL 1DFBL 4M48H 1KPRA 5BXFB 1JGUL 1NLBH 2DIJA 1I9JH 3HG1B 3CDCA 4RAVB 3AB0C 3TNMB 5CBAB 5F1IA 4HPOL 3RNQB 4QCIB 4M62H 5M95B 4JFFD 4JVUA 3H3BC 1SMAA 1S7SA 5IFHL 5CJ8A 4YXKH 3MREB 3VXTB 2IFGA 4E9LA 3RL2A 3SDDC 2VNCA 1RD6A 1CZ8L 4YBLB 1MF2L 5FKAB 2XXCB 3BJLA 4NQEE 4FQCL 1LK2B 5FGRA 2A6DB 5HD8D 3B5HA 1RK1A 4IS6B 2ZUYA 2ZZUT 4LU5H 5DURB 4PJAF 3QFJA 4HFWA 4P2OA 4D2NA 4D9QE 1T83A 2H6PB 3FOLA 2NY6D 4ZSOB 4KMTL 1KUMA 5E1AB 2P5WB 1H9VA 1MCJA 5HHOE 4HJGA 2YPKB 2O61A 4EN3A 4LLVA