3MQKB

Cbf5-nop10-gar1 complex binding with 17mer rna containing aca trinucleotide
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
52
structure length
52
Chain Sequence
RIRKCPKCGRYTLKEVCPVCGEKTKVAHPPRFSPEDPYGEYRRRWKREVLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA pseudouridine synthase B
publication title Structural and functional evidence of high specificity of Cbf5 for ACA trinucleotide.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
total genus 6
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2010-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.40 Mainly Beta Single Sheet Rubrerythrin, domain 2 H/ACA ribonucleoprotein complex, subunit Nop10 3mqkB00
2EY4E 3LWRB 3MQKB 3HAXC 3LWQB 2APOB 2RFKB 2AQCA 2AUSB 3LWOB 3LWVB 2HVYC 3LWPB 3HJYB 3HJWB
chains in the Genus database with same CATH superfamily
4POGA 1VZIA 3H9BA 1T9QA 4JADA 4XGHA 4RXNA 3S2DL 4AHYA 5GAGc 1PZXA 2PPTA 2JI1A 1LKPA 3B08B 1QQTA 1PFVA 1NXGA 2BE5D 3B0AB 2AUSB 3S1RL 3FDJA 1RB9A 2CKCA 2XJPA 5IYDL 2A68D 5GAHc 2O5JD 1IW7D 4A93L 1NXEA 1R0HA 4AR3A 2R7ZL 3PO3L 4C3IL 2AYJA 2YU9L 3S1QL 4AR6A 2M4VA 4A3LL 3KYWA 2HVYC 5JVG1 1PFYA 1T9PA 1P7PA 4ME3A 5H1Sc 5GAEc 2PSMC 1DX8A 4A3DL 2M4YA 1WJVA 3GTGL 5M3FL 3HOXL 4ZN3B 3HJYB 4C2M1 3P2AA 3I4ML 2GMGA 3GTOL 4A3BL 1B71A 2NYDA 3H99A 4A3GL 3J7Y1 3GTKL 1IU6A 1R0IA 3IU3I 1VZGA 1C09A 3SS2A 5MLC3 4AI2A 1S30A 4AR4A 3GTLL 2PYAA 1ZRPA 1I6HL 3HOUL 2V0FA 4A3FL 4LHLA 2PVEA 2XJRA 1RWDA 2CKAA 4TPUA 2HR5A 2J9UB 1YK5A 3H9CA 5M3ML 3H0GL 3KYXA 1CAAA 5EINC 6RXNA 5M5WL 1FHHA 3JR7A 3I4NL 1I50L 1K83L 2EY4E 4GS7D 1YUXA 2JI3A 2QL0A 4TVMA 4POFA 4V196 1OWCA 1BQ9A 2C6AA 1SFOL 1TWCL 1QCVA 3PL5A 5RXNA 3KYUA 1VCXA 2DSXA 5DM61 3MQKB 2R92L 3PKJA 5GADc 5C4JL 1YV1A 1BQ8A 5IY0A 3HAXC 2A6HD 4AI1A 4ZN1B 3GTJL 5IP7L 5JVH1 2Z3QB 3RZDL 4A3KL 2JA5L 1BFYA 4BY1L 1H7VA 2XJVA 1QYBA 3LNLA 2JA6L 1R9TL 3GTQL 3S1NL 5FJ8L 3LPEB 1IRNA 2E2HL 1TWAL 4BY7L 1YUZA 2M6PA 4E6YA 3S16L 4Y52L 3K7AL 3WWLA 3S17L 8RXNA 4LHNA 3LWPB 1S2ZA 2VUML 1RYQA 3H97A 3PO2L 3RZ6A 5IYBL 1RDVA 1Y1WL 4BXXL 2PVXA 1S24A 2V0EA 4YWLA 2ERJA 3M3YL 2XJSA 1TWFL 2MS3A 3LWRB 2VL6A 1R0FA 3LWOB 3HOWL 1PFUA 3QQCE 3HOYL 2NVYL 2XJQA 3LWQB 4G6BA 1NNQA 7RXNA 2R93L 1SMMA 5DM71 3J7Z1 2KKDA 1R0JA 1SMWA 1ODHA 2C6BA 5IP9L 3PIO1 4A3EL 2NVQL 1IROA 5IYCL 5AN9H 4AI0A 1LTLA 4JAEA 3VPBE 2ZIXA 4JAGA 1RYTA 5MFPA 4A3ML 4AR5A 5K2ME 2NVTL 4U671 3CQZL 3WWNB 1E8JA 3RZTA 4QIWP 4UY81 4AHWA 1I3QL 1BRFA 4A3CL 2CR8A 4K9FA 3K35A 1YK4A 3P8BA 4A3IL 3HJWB 1Y1VL 3PZAA 3HOZL 2V3BB 1VZHA 5MF6A 1Z92B 1CADA 1DVBA 2Y0SP 1JYBA 4AHXA 3S1ML 1TWGL 2A6ED 3S15L 1TWHL 1FHMA 3S2HL 1WCML 5C44L 3S14L 3H3VM 3LWVB 4AI3A 2JI2A 3GTPL 1B2OA 4X6AL 2AQCA 1SMUA 5M5XL 5C3EL 5MFZA 4A3JL 2L0ZA 3A44A 2RFKB 1PFWA 4JAFA 2B5ID 5AI3A 4XXBB 4WFN1 4Y7NL 1LKOA 2ERSA 3HKZP 2E2IL 3MPSA 3QVDA 3RYGA 1T9OA 2RDVA 2JA8L 5AI2A 2LCQA 2WAQP 2JA7L 1BE7A 4AHZA 5EIOC 5FLML 2M6OA 3PKIA 2PMZP 2Z3RB 2B63L 5M5YL 4C3JL 3PIP1 1IU5A 1B2JA 5C4XL 1B13A 3FKIL 5MGNA 3MSUA 2APOB 3KYVA 1F4LA 3KYYA 2KN9A 1RDGA 4BBSL 3GTML 2H12A 2K2DA 4B8CD 2NVXL 3PWFA 4C3HL 2XJTA 4BBRL 2E2JL 1R0GA 3NFPI 4YWMA 3HOVL 3RZOL 2A69D 2XJUA 3ZG6A 2WB1P 4AYBP 3M4OL 1OWBA 1LKMA
chains in the Genus database with same CATH topology
2EY4E 3LWRB 3MQKB 3HAXC 3LWQB 2APOB 2RFKB 2AQCA 2AUSB 3LWOB 3LWVB 2HVYC 3LWPB 3HJYB 3HJWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EY4 E;  3LWR B;  3MQK B;  3HAX C;  3LWQ B;  2APO B;  2RFK B;  2AQC A;  2AUS B;  3LWO B;  3LWV B;  2HVY C;  3LWP B;  3HJY B;  3HJW B; 
#chains in the Genus database with same CATH topology
 4POG A;  1VZI A;  3H9B A;  1T9Q A;  4JAD A;  4XGH A;  4RXN A;  3S2D L;  4AHY A;  5GAG c;  1PZX A;  2PPT A;  2JI1 A;  1LKP A;  3B08 B;  1QQT A;  1PFV A;  1NXG A;  2BE5 D;  3B0A B;  2AUS B;  3S1R L;  3FDJ A;  1RB9 A;  2CKC A;  2XJP A;  5IYD L;  2A68 D;  5GAH c;  2O5J D;  1IW7 D;  4A93 L;  1NXE A;  1R0H A;  4AR3 A;  2R7Z L;  3PO3 L;  4C3I L;  2AYJ A;  2YU9 L;  3S1Q L;  4AR6 A;  2M4V A;  4A3L L;  3KYW A;  2HVY C;  5JVG 1;  1PFY A;  1T9P A;  1P7P A;  4ME3 A;  5H1S c;  5GAE c;  2PSM C;  1DX8 A;  4A3D L;  2M4Y A;  1WJV A;  3GTG L;  5M3F L;  3HOX L;  4ZN3 B;  3HJY B;  4C2M 1;  3P2A A;  3I4M L;  2GMG A;  3GTO L;  4A3B L;  1B71 A;  2NYD A;  3H99 A;  4A3G L;  3J7Y 1;  3GTK L;  1IU6 A;  1R0I A;  3IU3 I;  1VZG A;  1C09 A;  3SS2 A;  5MLC 3;  4AI2 A;  1S30 A;  4AR4 A;  3GTL L;  2PYA A;  1ZRP A;  1I6H L;  3HOU L;  2V0F A;  4A3F L;  4LHL A;  2PVE A;  2XJR A;  1RWD A;  2CKA A;  4TPU A;  2HR5 A;  2J9U B;  1YK5 A;  3H9C A;  5M3M L;  3H0G L;  3KYX A;  1CAA A;  5EIN C;  6RXN A;  5M5W L;  1FHH A;  3JR7 A;  3I4N L;  1I50 L;  1K83 L;  2EY4 E;  4GS7 D;  1YUX A;  2JI3 A;  2QL0 A;  4TVM A;  4POF A;  4V19 6;  1OWC A;  1BQ9 A;  2C6A A;  1SFO L;  1TWC L;  1QCV A;  3PL5 A;  5RXN A;  3KYU A;  1VCX A;  2DSX A;  5DM6 1;  3MQK B;  2R92 L;  3PKJ A;  5GAD c;  5C4J L;  1YV1 A;  1BQ8 A;  5IY0 A;  3HAX C;  2A6H D;  4AI1 A;  4ZN1 B;  3GTJ L;  5IP7 L;  5JVH 1;  2Z3Q B;  3RZD L;  4A3K L;  2JA5 L;  1BFY A;  4BY1 L;  1H7V A;  2XJV A;  1QYB A;  3LNL A;  2JA6 L;  1R9T L;  3GTQ L;  3S1N L;  5FJ8 L;  3LPE B;  1IRN A;  2E2H L;  1TWA L;  4BY7 L;  1YUZ A;  2M6P A;  4E6Y A;  3S16 L;  4Y52 L;  3K7A L;  3WWL A;  3S17 L;  8RXN A;  4LHN A;  3LWP B;  1S2Z A;  2VUM L;  1RYQ A;  3H97 A;  3PO2 L;  3RZ6 A;  5IYB L;  1RDV A;  1Y1W L;  4BXX L;  2PVX A;  1S24 A;  2V0E A;  4YWL A;  2ERJ A;  3M3Y L;  2XJS A;  1TWF L;  2MS3 A;  3LWR B;  2VL6 A;  1R0F A;  3LWO B;  3HOW L;  1PFU A;  3QQC E;  3HOY L;  2NVY L;  2XJQ A;  3LWQ B;  4G6B A;  1NNQ A;  7RXN A;  2R93 L;  1SMM A;  5DM7 1;  3J7Z 1;  2KKD A;  1R0J A;  1SMW A;  1ODH A;  2C6B A;  5IP9 L;  3PIO 1;  4A3E L;  2NVQ L;  1IRO A;  5IYC L;  5AN9 H;  4AI0 A;  1LTL A;  4JAE A;  3VPB E;  2ZIX A;  4JAG A;  1RYT A;  5MFP A;  4A3M L;  4AR5 A;  5K2M E;  2NVT L;  4U67 1;  3CQZ L;  3WWN B;  1E8J A;  3RZT A;  4QIW P;  4UY8 1;  4AHW A;  1I3Q L;  1BRF A;  4A3C L;  2CR8 A;  4K9F A;  3K35 A;  1YK4 A;  3P8B A;  4A3I L;  3HJW B;  1Y1V L;  3PZA A;  3HOZ L;  2V3B B;  1VZH A;  5MF6 A;  1Z92 B;  1CAD A;  1DVB A;  2Y0S P;  1JYB A;  4AHX A;  3S1M L;  1TWG L;  2A6E D;  3S15 L;  1TWH L;  1FHM A;  3S2H L;  1WCM L;  5C44 L;  3S14 L;  3H3V M;  3LWV B;  4AI3 A;  2JI2 A;  3GTP L;  1B2O A;  4X6A L;  2AQC A;  1SMU A;  5M5X L;  5C3E L;  5MFZ A;  4A3J L;  2L0Z A;  3A44 A;  2RFK B;  1PFW A;  4JAF A;  2B5I D;  5AI3 A;  4XXB B;  4WFN 1;  4Y7N L;  1LKO A;  2ERS A;  3HKZ P;  2E2I L;  3MPS A;  3QVD A;  3RYG A;  1T9O A;  2RDV A;  2JA8 L;  5AI2 A;  2LCQ A;  2WAQ P;  2JA7 L;  1BE7 A;  4AHZ A;  5EIO C;  5FLM L;  2M6O A;  3PKI A;  2PMZ P;  2Z3R B;  2B63 L;  5M5Y L;  4C3J L;  3PIP 1;  1IU5 A;  1B2J A;  5C4X L;  1B13 A;  3FKI L;  5MGN A;  3MSU A;  2APO B;  3KYV A;  1F4L A;  3KYY A;  2KN9 A;  1RDG A;  4BBS L;  3GTM L;  2H12 A;  2K2D A;  4B8C D;  2NVX L;  3PWF A;  4C3H L;  2XJT A;  4BBR L;  2E2J L;  1R0G A;  3NFP I;  4YWM A;  3HOV L;  3RZO L;  2A69 D;  2XJU A;  3ZG6 A;  2WB1 P;  4AYB P;  3M4O L;  1OWB A;  1LKM A; 
#chains in the Genus database with same CATH homology
 2EY4 E;  3LWR B;  3MQK B;  3HAX C;  3LWQ B;  2APO B;  2RFK B;  2AQC A;  2AUS B;  3LWO B;  3LWV B;  2HVY C;  3LWP B;  3HJY B;  3HJW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...