3MQKC

Cbf5-nop10-gar1 complex binding with 17mer rna containing aca trinucleotide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
75
structure length
75
Chain Sequence
MKRLGKVLHYAKQGFLIVRTNWVPSLNDRVVDKRLQFVGIVKDVFGPVKMPYVAIKPKVSNPEIYVGEVLYVDER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional evidence of high specificity of Cbf5 for ACA trinucleotide.
pubmed doi rcsb
molecule keywords tRNA pseudouridine synthase B
molecule tags Isomerase/rna binding protein/rna
source organism Pyrococcus furiosus
total genus 12
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2010-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.230 Mainly Beta Beta Barrel Thrombin, subunit H Probable tRNA pseudouridine synthase domain 3mqkC00
2HVYB 3MQKC 3UAIC 2RFKC 2EQNA 2EY4C 3U28C 2V3MA
chains in the Genus database with same CATH superfamily
4GPGA 4ABHA 4ZMAH 1P2MA 1HAVB 1YPEH 2O8LA 4JZIA 1TQ0B 2DE9A 1PPZA 4MPWA 4JCNA 1QRWA 4UFFH 1TX8A 3PO1C 2BOHB 1YPHC 2GZ7A 1W10U 2V7QD 1TA6A 3A7XA 4ASUD 3KQEA 2OK5A 7GCHF 4BTIB 4P02A 2QXIA 1A7SA 3VB5A 3BEUA 4CRBA 2XYAA 1GHVH 3MH6A 1UTMA 5GNDA 2ZWLH 3TIUA 2I6QA 1OP8A 3GCHC 1Z8IB 3QZQA 1GBIA 5DP7A 2VINA 3EGKH 4Y8ZA 1V6DA 2H5DA 2KZ4A 1MTNC 3SHAH 1XKBC 1CVWH 1RFNA 4NCYA 1AFQC 1PPEE 3BTQE 3PROA 1MABB 1MKWH 1ZYOA 1DICA 1RD3B 3TH3H 2R2MB 2OQ5A 3A7TA 4Q7YA 1AU8A 1IQNA 3LGYA 3R0FA 4AN7A 2RDLA 3ELAH 2QN5T 5IYTA 3ZIAD 3SYJA 3RC4A 1MBQA 3VGCC 2FYRA 2Z9GA 1NU9A 2BDBA 1UO6A 1ACBE 3SUEA 3K9XB 3MO6A 2ZPQA 5T1VA 2ZFQH 4CH2B 1W13U 2F43B 3T62A 1FI8A 1GJBB 4K3JA 4B73A 1HAZB 3DA9B 2CGAA 1OHHD 1WBGB 3M5MA 3E91A 4FU7A 2FTMA 4IMZA 2LELA 3F2HA 2KM0A 1C2JA 2JH0D 1CGJE 1QURH 1VGCB 3BTDE 2B8OH 5C5NA 1C1SA 2JDID 1YM0A 4B76A 4GCHG 3RMNH 1O33A 1C5OH 1Y59T 2EC9H 4ASHA 1JOUB 1QZ8A 1EJNA 3NWUA 2C3SA 2ZHDA 3GCTG 3KF2A 1PQAA 1ESTA 3F6UH 3SQHE 1GJ8B 1E1QD 1LPGB 3BTTE 3PV2A 2JETB 4YOJA 3TK9A 1TE0A 3CP7A 4ISOA 5TJXA 4WH8A 1MD7A 2QY0B 2A31A 3DFJA 5LPEA 1C1WH 1OYTH 5K0HA 4Y71A 3RXFA 1WSSH 1W3CA 4TSFD 1AI8H 1F5LA 3FP8E 1EJMA 1ELEE 1YCPH 4JZDH 4YESB 5FPTA 2RG3A 1C2IA 2ZZUH 3FFGA 3MWIU 1UK2A 3C27B 2O8UA 2WSSD 2OD3B 1A0JA 1ARCA 1O35A 3D23A 2FLRH 2ODPA 2M2AA 4B75A 1ELCA 4U30A 1DS2E 1OOKB 2TPIZ 4CREA 4XE4A 4BOHA 4DW2U 4X8VH 3STIA 4FU9A 4HZHA 1KIGH 1P8VC 1JIRA 4DIHH 4Y0ZE 2P95A 5C1XA 4JK6A 1ZSKA 2ZG0H 1YKTA 4NFFA 7ESTE 2NWNA 4WMEA 1JRSA 1NM6A 1P11E 2A4QA 2FOHA 2XTTB 2BMGB 4XRNA 2Y7XA 4MG3A 2G8TA 1G3DA 1HLTH 2FDAA 1HPGA 5DP4A 1BJUA 2TIOA 3RXUA 4A1TA 4KELA 5CHBA 2TRMA 1H9LB 2D26C 4F48B 2BD7A 5IDKA 1XXDA 4O9VA 2PV9B 4AFZA 3URDA 2AS9A 3P70B 2ZGBH 1KXFA 2FODA 1CBWB 1H1BA 2G4TA 3AW0A 3SU1A 5F53A 1SHYA 1NRSH 1IOEA 3RXDA 4O3UA 3LT3A 1S6HA 5EQSA 1QY6A 1YCPM 2BDHA 1DSUA 3KQCA 1P04A 2PP6A 1DLEA 2ZTYA 1O34A 3A85A 3FZDA 2TGPZ 1QQUA 3URCA 1FLEE 4LZ4B 5EJLA 3GS9A 1AMHA 5EG4A 1AN1E 4E05H 1GCTB 5K7RA 2V6NA 4U2WA 1D6WA 3RXAA 2ZGJA 1TFXA 8GCHG 2UUYA 1MU6B 3SU0A 4NA7A 1YBWA 2XCNA 1S0QA 1QL8A 5E2PA 1V2KT 1C5UA 1SFIA 1AKSB 3AAVA 1V2MT 5H4IB 1NRRH 4ZKSU 1ZPBA 5L2YH 5FBIA 4KTSA 1O2LA 1ABJH 2FXRA 3RXMA 1EPTC 2A5KA 3HATH 5DSFA 5FBEA 2J98B 2HWLB 1FV9A 1BTHH 1GI0A 4D9QA 2BVXH 4K1SA 4MVNA 3ZVGA 2J92A 1TQ7B 1GBEA 2C4FH 2O9QA 3FKSD 1TBZH 1GHYH 3JZ1B 1LVYA 4NA8A 1SLUB 4NIWA 3PV4A 1GBBA 3SBKA 2BYAX 1GBCA 4I8KA 1Y3UA 1PQ5A 1KXAA 1C5LH 3MI4A 1OSSA 3M5OA 3MO9A 1K1MA 2ZF0H 4H4FA 1PYTC 1IQJA 1TNLA 1EQ9A 1Z7KA 3ZYDA 2ULLA 3OAAD 2IJD1 4VGCC 4YT6H 3U8RH 1O38A 2J5UA 1TAWA 3KQDA 1IHSH 1SR5C 2F91A 5HXFA 4GHTA 1IHTH 1GBFA 1SQAA 3VB6A 4X6NA 4AG1A 4CHAB 3AK5A 4AX9H 4ABJA 3TJUA 4CRCA 2WPDD 5HKKD 4X6OA 1Q2WA 3PLKA 1HAOH 1BTYA 2IN2A 2AYWA 1SMFE 3A8DA 1QHRB 4AGJA 2R0KA 1GBAA 1K1IA 2BZ6H 2L74A 1UTQA 3MNSA 2NU1E 2BD3A 4BXWA 5DP3A 2EQNA 3FO8D 3P95A 1SGYE 4ZUHA 1AQ7A 1BTXA 4B2CA 1GG6B 2J97A 1XX9A 1KXDA 4Q80A 1EZXC 2GKVE 1Y3YA 3PV5A 1EOLA 3BG4C 5DKMA 4IGDA 1HCGA 2VGCC 1HNEE 3BTGE 1GMHG 1TGNA 2ZGXH 2PLXA 2ZU3A 4FXGH 2AMDA 1OKXA 5HM2A 4I31A 5KGOA 1PPBH 3RU4D 5FX6A 1LVOA 3SUFA 5AHGH 3SV8A 1IQLA 3RP2A 5HGGA 1P3EA 3OX7U 5FL7D 3UWIA 2ZP0H 1SQTA 3OYPA 5C1YA 4LK4A 1O5BB 1MU8B 3P8NA 1C4U2 2XWAA 1QJ7B 1EAIA 3PM3A 2ZNKH 3ZVAA 3WWFA 2VWMA 1BTZA 1BB0B 3PMBB 1NBMD 3PRBA 4DURA 1F92A 4H6TA 1A5IA 3PLBA 1BTPA 2FYQA 1TX6A 2A1DB 5EOKA 1WTGH 4IN1A 1QIXB 4X1PU 1YLNA 4IS5A 3O8RA 2FI3E 4NFEA 1Z1JA 2PKAB 3IITA 1UCYH 1V2RT 2V35A 1O3DA 3Q3XA 1O2SA 1FIWA 1P0SH 2Z94A 3ZVCA 5C17A 5L30H 2OC0A 1D4PB 1AUJA 4GLYA 4ISIH 1NO9H 2HPQH 1UVUH 5EW1H 1M9UA 2BX3A 1BRUP 3S7KB 3I78A 1O5AB 2F9OA 3QTVH 3RXLA 4A92A 3SNCA 1GMHF 2FOBA 2BY8X 1NBME 1CA0C 1N8OB 3ATMA 2J95A 2Z6BD 2XC4A 1EXFA 3A8AA 5JBAS 3HK6B 3GOVB 3RXKA 1JXPA 2A4OA 4D7GA 4BNRA 1GJ7B 3RXQA 3ZZ5A 1P3CA 2F3CE 2XWBI 3V12A 4E06H 1ZZZA 8LPRA 5FX5A 1V2QT 3LC3A 1D3PB 2A2XH 1CO7E 3EYDA 1S6LA 3PTBA 5DG6A 1L1GA 3UOUA 4A5TS 4INHA 2FOCA 4ZXXH 2GZ8A 1E36B 4MPUA 3PYHA 4Q63A 4FUDA 2ZDNA 1LPZB 3HKIB 2B5TB 3WWBA 4ABIA 1EKBB 3W95A 4Y10E 2BY5X 4UDWH 1G3BA 2HNTC 1P2IA 2ILNA 1DWDH 1HAIH 1C2KA 1SQOA 1C1TA 2A7HA 4ZKOU 1A4WH 3NZIA 1A46H 1CU1A 1K28D 1S5SA 4K1TA 1P2OA 1OWJA 1O2GH 2HNTE 1C2GA 2RCEA 5AF9H 1S84A 5AFYH 2PSYA 1AE5A 1LCYA 2LPRA 1ZOMA 4TPIZ 3LJJA 2H9HA 1SGDE 1O5GH 4QT8C 1AKSA 1O3BA 3A7VA 3ENSB 1INCA 1AB9C 3M3VA 1QQ4A 5TCCA 1Q3XA 1DITH 3VB3A 7LPRA 1QR3E 1NN6A 3HGNA 4ABFA 4ESTE 1ZPCA 1L2EA 4WVPE 1GL1A 3AASA 1GCDA 3TJVA 1TGBA 2W6JD 1FY5A 1FUJA 5F8ZA 3OFND 4RI0A 5JYIA 2Y5HA 1V2UT 1IQMA 3A7YA 2A7CA 2EI8A 1AFEH 1G37A 2OC7A 2VIVA 1AY6H 3OY6U 2W3KA 3MH4A 4DVAU 2BM2A 4LOYH 1ESBA 1LHCH 4GVUA 3S69A 3SGBE 4DOQA 3UNSA 2GTBA 1V2NT 3RXVA 1T7CA 1XMNB 1OWKA 2XNIA 1TOCB 3A86A 2C8YB 1E1RD 1DXWA 1BMMH 2HNTF 1PPHE 1BRAA 1N1LA 2ZKSA 1GVLA 2Z9JA 2F83A 1D3TB 2BD4A 3OE7D 1DE7H 1NPMA 1AGJA 1TGSZ 4ISNA 1O3IA 1VZQH 1C5NH 2UWOA 2BD8A 1YYY1 1ANCA 3MO3A 1F0TA 2FPZA 1C5QA 3TJOA 3P8OA 2ZEBA 2AIQA 1ETSH 5ESBA 4I8GA 3EA8A 1T8OA 1QA0A 3DSPA 3SJKA 1C5ZB 1C5VA 2ZO3H 3A80A 4O3TA 1P9UA 3MU1A 1QA7A 3NPSA 3LC5A 1NY22 3WW7A 2Z9IA 1UVOA 1YPJH 1P9SA 3I29A 3UNQA 2VIQA 1ETTH 2YMSC 2BD5A 2J4IA 3LGUA 4BAKB 1C1RA 5PTPA 4LXBH 5AVDA 2O8MA 1UTKA 1PPCE 2Q6GA 2H2ZA 2ZFSA 4DT7B 2H1UA 2D1JA 2QXHA 2STAE 1TRNA 3SJ8A 1O3JA 4JYUH 4X1NU 1C2EA 3EA9A 3T29A 1TPOA 3ATLA 2SGDE 4X8UH 4YOGA 1VCQA 1BIOA 1KTTB 3RXJA 3U1IB 1O2ZA 4OS5A 5A0CA 2FOFA 4TT3D 5HMAA 4ZROA 2OQUA 2BY7X 4AFQA 3TU7H 5T6DA 2D8WA 2KX4A 2C90B 4X8TH 1P2JA 4DJZB 3ODFA 1O3OA 1MTSA 1VITG 2ZC9H 2JH5D 1O3HA 1QB9A 3NCLA 1LQEA 4DCDA 1A0LA 2THFB 3BN9A 2G5VA 1COWD 4U01A 2EI7A 1UTLM 3AW1A 3ZVDA 1C2LA 3ZV8A 1ZPZA 2QF5A 3M7TA 3VPKA 2FOAA 3RMOH 1HAGE 1O3GA 4YZUA 1K22H 2C8XB 5EPNA 4WF8A 4WJG2 2Y5GA 4INLA 1UK4A 1GHBG 1TNIA 3ATKA 1AWFH 1K1OA 4AOQA 2CF9H 1KXCA 2FM2A 4HTCH 3T28A 1GBDA 1DPOA 1YPHE 6GCHF 1RXPA 4WMFA 2CV3A 1PQ8A 1DY9A 1T31A 2XRCA 1C5TA 5E0JA 2ZQ1A 1WCZA 1CE5A 1Y3VA 2SGPE 4TPYA 3S9CA 1ZLRA 3UB0A 3U8OH 2ODQA 2GD4B 1TONA 3LGWA 3P8FA 4K8YA 1VGCC 4DIIH 1VITF 1OYQA 1YPKH 3SU3A 2BLVA 3VG8A 2PTNA 1T8MA 3UR9A 1WOFA 1XUJA 2ZHEH 1C1NA 1EFRD 4UFGH 3DUXH 4CRGA 1QNJA 5CE1A 3E6PH 4NWLA 2JETC 1GMDG 1TMTH 1WYKA 2NU0E 4MNXA 1YPMH 1DWEH 3SO3A 3SQEE 2PUXB 2WYGA 2AMQA 2P8OB 1J14A 5EODA 4OS1A 5CHAB 3F0PA 2VBCA 3O8BA 1JMOH 1BJVA 1EJAA 2STBE 2RFKC 5I46H 1AO5A 3F1SB 1DWCH 1BOQA 3RXHA 2KCYA 2Y7ZA 2AH4X 1IQEA 1GJ9B 1MTVA 1ZJKA 1GI2A 3HPTB 2ZU2A 3SNBA 1A5HA 2I6SA 1TWXB 3KNXA 2FMJA 5C3NA 1AFQB 3LGVA 5C1UA 2BX4A 1C5RA 2R9PA 1C4Y2 3VB7A 4UONA 1Y5AT 2ANKH 1F7ZA 1TA2A 1TNGA 1O31A 6ESTA 1CQQA 1K1JA 5E8EH 2AMPA 1OWDA 1D3DB 1GJAB 4RSPA 4KKDA 1YGCH 1THRH 1SHHB 4AC9A 1VR1H 1G32B 3DSOA 1DANH 2A45B 1NZQH 2ZTXA 5JBTA 1DY8A 1LHEH 2GV6A 4Y0YE 2Z3CA 4OS2A 3PMHB 2O8WA 2J34A 1DM4B 4XBCA 1GMDF 2OC1A 1WQSA 1A0HB 2BVSH 1AIXH 1MCTA 1CBWC 1OXGA 1BA8B 1DX5M 3RM2H 2ZIQH 4KTUA 3ZZ4A 4ZKNU 5DPAA 1BTWA 2ZPSA 1BQYA 2BDIA 1FN6A 1HAHH 4A1XA 2GCHG 4GCHF 2NU3E 3A87A 2YOLA 2B7DH 3M3SA 1ZTLA 3C1KA 5GCHG 1GCTC 3GCTF 2ZFRH 3N99A 3SU4A 4FUIA 1GI8B 1XUIA 3AVZA 2SGAA 5ABWA 1ZJDA 3RDZA 1C1PA 3ITIA 4FUCA 1ELFA 3ZZCA 5J4SA 2ZDLA 1T8LA 3V0XA 3A89A 1HFDA 4I86A 1V2OT 4JYVH 4BTUB 3BEFB 5JBBS 1S6FA 2FS9A 2UUFB 4A7IB 1V2PT 1G30B 2Z7FE 1GI1A 3ZYEA 3RLWH 4IC6A 4OGYA 5KECA 2BDAA 5LPRA 2P3TB 1V2VT 4R0IA 1IQFA 1TB6H 4D9RA 3MHWU 3D49H 1SC8U 3A82A 4FUGA 1FJSA 1RGQA 1EZSC 1VJAU 3PWCA 4MNVA 3S0NA 4GAWA 3TK6A 1EZQA 1UTOA 1O2WA 3SJIA 1GDNA 3VEQB 3RXTA 2PWXA 4UEHH 1PYTD 2GCHF 2V0BA 1SGIB 1TNHA 2PTCE 2G51A 4CHAC 5GCHF 2XBWA 1GL0E 4XBDA 5G4BA 1MKXK 1KLTA 2PSXA 4A6LA 1SGQE 1A61H 3LKWA 1G2MA 4H6SB 1DDJA 4AB9A 1IQGA 1O5CB 1O3NA 1O2YA 1FAKH 4JK5A 5FPSA 3SV9A 1C1UH 4ABBA 4X8SH 5TCAA 1GG6C 4WY3A 2ANWA 3IWMA 1Z8JB 3DFLA 3TJNA 1GHXH 1RTLA 1TYNA 2AGGX 2XC5A 1MTWA 1QBOA 3RXGA 1QL9A 1AZ8A 2PUQH 3V3MA 2SGFE 3TLOA 1ELBA 1KYNA 2OCVB 8GCHF 1XVMA 1EOJA 3ZVFA 3SV6A 1Q31A 1YPLH 1AZZA 1DOJA 5B6LA 1CGIE 1L4DA 1SI5H 2VVVA 2ZECA 3HK3B 4NA9H 2WUCA 3P8GA 3N7OA 2XOKD 1ANBA 2VJ1A 1Y8TA 3SGAE 1IAUA 1THPB 3LONA 1NFXA 2EA3A 4ABEA 4ACBA 5EJZA 3QDZB 4X1SU 3A7ZA 2VVUA 1FQ3A 7KMEH 1MAXA 3QUMP 1UHBA 2SNVA 4ZAEA 1GI3A 2D2DA 4TWWA 4F49A 3DT0H 2VB0A 5AFZH 4LZ1H 1SL3A 1XUHA 3LIWA 3TPIZ 4YTAA 2WPJS 3BTFE 3FP6E 3ODDA 1C5WB 3EE0B 1T4UH 3K6ZA 4M9FA 3GY3A 4E7NA 2VH6A 2ZFPH 3UUZA 2ZFTA 1HJAB 4B6EA 2GP9B 3FN8A 4BXSA 1NFYA 1UMAH 5JDUB 1H9IE 3L6PA 1O2OA 1TPPA 2BZAA 3LOXA 3R3GB 2UUKB 1LPKB 1N8OC 1OWIA 1O3PB 2BLWA 3UIRA 4R8TB 3SJOA 5C94A 1TIOA 4YT7H 2WZQA 5HIZA 2G00A 1P05A 3UY9A 2Q6DA 1OX1A 1GDUA 2IPQX 3U98H 1UTNA 1K1NA 1ANDA 1TABE 5JBCS 3SV7A 2GGVB 1LVBA 1MUEB 1Y3WA 3MU8A 3SI3H 1J16A 1GI6A 1OWEA 4FVDA 1MQ6A 1C5SA 2FOGA 1HYLA 1UVTH 4P00A 1K21H 1HUTH 3F68H 4IMQA 1HAYB 1GBKA 3SUDA 1O2VA 4HGCA 2ZA5A 2G52A 1HIAA 1O3CA 4IBLH 3T25A 2BLOA 4JMYA 5LPFA 4MNWA 4B6FA 2Q1JA 2FEQH 2FI4E 1BITA 2CK3D 2W5EA 4K5ZA 3RMMH 5HM9A 3ZZAA 1MD8A 1ZHPA 1OS8A 2BQ6B 2VWNA 3A8CA 1NRNH 1NT1A 3KQ5A 3NRLA 3BTKE 4Y7AA 3FVFB 3SNDA 2CHAB 2KAIA 2QE7D 3OY5U 4NIYA 3T26A 4Q7XA 2JJ2D 4UFEH 1RIWB 1PFXC 4YXWD 1TPAE 2JH6D 1SSXA 1DSTA 1DWBH 1VCWA 1HDTH 4M7GA 1T4VH 1EAWA 1QRXA 2PKSB 2QGRA 2B0FA 1GHWH 3VB4A 3Q3KA 1EATA 3UWJH 3T5FH 1AD8H 1Z8GA 5EPYA 5JB9S 1V2WT 3DD2H 4BANB 3E0PB 1FX0B 4CR5A 1GVKB 4KTCA 3RXRA 1SGCA 1PQ7A 4WMDA 1TMBH 3A84A 5EXNA 1H8HD 2WYJA 3AAUA 4FETA 1BMNH 1IQKA 2B9LA 2A2QH 1XUFA 1GJ6A 5EW2H 3G01A 2Z9LA 3M36A 4XOJA 2IPHA 1ZMLA 1Z6EA 4FU8A 2WPKS 4E7RG 4X1QU 4GHQA 2OXSA 1FXYA 1LHGH 1GHAG 1SOTA 1SB1H 2FOMB 1BMLA 5GDSH 3QO6A 1MMJN 1EB2A 3F2GA 4DT4A 1GHZA 3BTHE 1XUGA 1P03A 5FPYA 4ABGA 1FDPA 5EGMA 1WXRA 1GBLA 2J9NA 3MU4A 2XBVA 1SLVB 2ZCKP 3MU5A 1SOZA 1GWAA 2HVXA 1BDAA 1NU7B 1BHXB 2PR3A 3ATIA 3RUOA 1C9TA 3BG8A 4BAHB 1IQHA 3RXIA 4B2BA 5A0BA 2W6ID 1O3EA 2P59A 1TOMH 2AHME 1BTUA 1C1MA 3HGPA 1GI5A 1LKAA 1BUIA 5F8XA 3VFEA 2PGBB 1KY9A 5IK2D 2A0QB 1W2KH 2W26A 1ZRBA 4D8NA 2FX4A 1F2SE 3ZVEA 1SGTA 3K2UA 3DCLA 1BCUH 3Q00A 2AERH 3FZZA 3SORA 4J2YB 4ABAA 1W7GH 1A1RA 2V3OH 3KCGH 2QXJA 3M5NA 1PJPA 3K65B 3CS0A 1CT2E 2QAAA 5LGOA 1K1LA 3LU9B 2A32A 1E0FD 3KHVA 1N6XA 3TNSA 1GHAF 1E79D 1EPTA 4HFPB 4HG6A 1EP6A 1ZRKA 2YMSD 4K8BA 3VXEH 1XM1A 3S9AA 4ZHAA 3GCNA 5EXLA 3A7WA 1MTUA 3PB1E 1J17T 4X2WA 1S81A 3TK5A 1GJ5H 3KL6A 1BBRK 2GCTB 2Y80A 2HLDD 2FX6A 1V2ST 3BEIB 3OSYA 1K9OE 4NIVA 5DP5A 2FZZA 3VXFH 3QWCH 2BQWB 4NGAH 1V2LT 5E2OA 4RKJB 1C2FA 5BPEA 1W7XH 3OTPA 1G9IE 1P10A 3W94A 4FUEA 3ESTA 2BDGA 1H8ED 2VWOA 1Z6JH 3SU6A 1AUTC 3GY5A 1NFUA 2K1QA 4MQAA 4CBNA 1O32A 3FANA 2QIQA 1TGTA 1L1JA 4PROA 1W11U 5GJ4B 1UVPA 2P3UB 1SQRA 1HBTH 3ZZ3A 2ZU1A 3CENA 3F3BA 2BD9A 4ZHLU 3A8BA 3UOPA 2UWPA 5SGAE 5DP6A 4Z6AH 1UJ1A 2ANMH 3QGNB 4NSYA 4O97A 1LKBA 3B23B 4X6MA 2A5AA 3RU4T 4INKA 3WY8A 4YO9A 4UE7H 3BF6H 1C5YB 2ZGCA 1GJ4H 1UCYE 1MCVA 1X7AC 4MDSA 2W7SA 1BBRE 1SGFA 1HRTH 2DE8A 4OS6A 3GY7A 6CHAB 4SGAE 1CGHA 2XNDD 3F9FA 5EQRA 2ZU5A 1B7XB 4AZ2B 1SGPE 2ODYB 3UNRA 2GMTB 5A09A 1GGDB 8ESTE 2FS8A 2QF3A 3MH7A 1NESE 1EAUA 2ALPA 4I32A 1ANEA 1D6RA 2WV4A 5I25A 3U69H 3UTUH 1V2JT 4B2AA 2VU8E 2ZHQH 1HGTH 2BDYA 3B9FH 1P02A 1DXPA 5C2ZA 5B6OA 3OTJE 4ZHMU 3UQVA 4YLUA 4DY7B 1W0JD 2V3HH 2SGEE 4MPVA 1S82A 4K69A 1ZGIA 3NKKA 5EU8A 4Q7ZA 1G3EA 1MBMA 4Z0KA 3UR6A 1C5MD 1QB6A 4BAQB 2P93A 2GDDA 2WPHS 5EIYA 1FIZA 2XXLA 2ZPRA 2RA3A 5DP9A 2FIRH 3GYLB 1O2PA 2P8OC 1TNJA 5CHAC 3F9EA 4CR9A 1W0KD 1O5FH 1J8AA 1O2TA 3L33A 5C0TA 3SU5A 1GJDB 1YF4A 1G36A 3TNTA 4A1VA 1WDIA 1SGEE 1KSNA 4ABDA 1UHBB 1P2QA 1VJ9U 3ZZBA 4DGJA 3BTME 4MNYA 1HXEH 1XKAC 3SOSA 3PO1B 5KEDA 1FY8E 1GI9B 1W0ZU 4CBOA 1MKXH 2F4LA 3A88A 3GY2A 3KQBA 9LPRA 1YWUA 3BV9B 3CNRA 2KR7A 3OEHD 3M61U 4NG9H 4GUXA 1ZSLA 1DLKB 2DUCA 4ZKRU 5A8XA 3B8JA 1GHBF 1O0DH 1BRCE 2RDEA 2QYIA 3GCHB 1J9CH 2ZGHA 1LDTT 4AFSA 1Y3XA 1O3AA 1LQDB 2IOTA 1XXFA 3MQKC 3FOAA 1YLCA 1W14U 1MTNB 2BXUH 2OP9A 4YOIA 1UVSH 3RC6A 5T6GA 3F9HA 3GCOA 2ESTE 2J38A 2XCFA 2Z3EA 3MOCA 2BQ7B 3PMJA 1TRMA 2ANYA 5GPIB 3SJ9A 1P09A 2AGIX 2CN0H 2H9TH 2KCAA 3S9BA 1C1QA 2QA9E 4O03A 3SU2A 3MTYA 3VGCB 4TWYA 1GMCG 1KLIH 3Q76A 2FO9A 3ATWA 4XSKU 1CT0E 1UTPA 2ZFFH 4WWYA 3W1EA 4K1EA 2HPPH 2ZQ2A 3P6ZB 1YLDA 3MNBA 1MAYA 1BT7A 3M5LA 1H8IH 2ASUB 3M7QA 1KDQA 2PW8H 1PPGE 5HYOA 2R2WU 4X1RU 3ZVBA 1C2MA 1KLJH 2A4RA 3STJA 1YC0A 3Q77A 1PPFE 4FVBA 2CXVA 1KXEA 1E34B 1WAYB 2QF4A 1P57B 5E0HA 1C4V2 4TY6A 1MH0A 4Y8YA 2EI6A 2HALA 5DK1A 1RTKA 2QV1A 2P94A 1HIAB 1C1VH 2F9NA 3E16B 2P3FH 5F6MA 4B71A 1O2XA 2QF0A 1SBWA 2KFWA 4JZFH 2XBYA 2QC2A 1QBVH 4FUFA 1S0RA 1W8BH 3SZEA 1GPZA 1GI7B 3BTWE 5C67A 3GDUA 2KAIB 4F4OC 1NRQH 1QGFA 4AFUA 1KXBA 5LH8A 2GVFA 3TGIE 3D65E 2F9UA 2OC8A 3M3TA 5ESTE 5BRRE 4IC5A 1WQVH 3UPEA 2GZ9A 1G3CA 1QRZA 3M7UA 3MNCA 4BTTB 1ELAA 1A5GH 3EQ0H 3F0OA 1GMCF 1P01A 1YP9A 3CS7A 3QX5H 4HI3A 1WV7H 1ZR0A 1TMUH 2UWLA 3KYGA 3P92A 3TVJB 1TPSA 4H42U 2FP7B 4AYVB 3JZ2B 1O39A 2VH0A 3P17H 2AIPA 3H09A 1QFKH 2Y5FA 2VVCA 2G81E 1EAXA 1D9IA 3F2FA 1ZMNA 3RXPA 4I8LA 2KCOA 1A2CH 5C0UA 4NIXA 2BTCE 5EQQA 1L4ZA 3E8LA 3ZV9A 1A3BH 1V3XA 3LJOA 1C2DA 2G4UA 2QXGA 2BHGA 2C93B 5DP8A 1OP0A 2LNCA 3ZZDA 1HB0B 2IJOB 4B1TA 1HJ8A 1QB1A 2CF8H 4MTBA 2ALVA 4UD9H 3QZRA 3GICB 3TH4H 1RTFB 2LP6A 3TITA 6LPRA 2ZCHP 1Z8RA 1O2HA 3MMGA 1MKWK 1C9PA 1ZSJA 4I8JA 3BIVH 5JB8S 3GY4A 3MH5A 4I7YH 2JKHA 4XBBA 1TALA 4RT0A 2A5IA 1K1PA 2EEKA 5FHTA 3A81A 2VNTA 1MQ5A 2GDEH 1O2NA 2R3UA 4Y76A 4BAOB 3IG6B 3NXPA 3M37A 2BY6X 1F0SA 3N7DA 3GDVA 1F0UA 3SNAA 1TGCA 1H4WA 3TH2H 1O3FA 2O8TA 2BVRH 2P16A 2H9EH 1C2HA 1HAVA 1AVWA 1AHTH 4XD7D 1D3QB 3H7TA 2NU2E 5GIBA 1O2IA 2Z3DA 2G55A 1EASA 2SGQE 3LGIA 3TGJE 1F5RA 4Y7BA 1XVOA 4XFQA 4Q2KA 2XW9A 1ZHMA 4X2VA 2WUBA 1HAXB 1O3KA 1EPTB 1O2QA 2J2UA 5A8YA 1RJXB 4WXIA 4GSOA 2ZDAH 3A83A 3PMAB 5GXPA 2QCYA 2FWWA 5FCKA 1FY4A 1ESAA 1TLDA 1T32A 1WUNH 1HJAC 1JIMA 1DVAH 5GWZA 4RT1A 1QJ6B 1AWHB 4CRAA 1S85A 1Z71A 3S7HB 1DFPA 5L2ZH 3EE7A 5L6NH 4AYYB 4X2XA 4VGCB 1LMWB 1HAPH 3RLYH 3U9AH 1YCPK 3LGTA 2F9PA 1F0RA 1B0EA 3RXBA 1O2JA 1Z1IA 2YNBA 3T27A 3SZNA 1FAXA 2WPIS 4KP0A 3SV2H 3NK8A 1FONA 2BB4A 1ABIH 4FUBA 5E0GA 3GISB 4UFDH 2UUJB 1P2NA 2ZI2H 4BAMB 5A2MH 5DO4H 1ZMJA 3H5CB 4ISLA 1SGFG 2WV9A 3KGPA 2A4GA 3LH1A 1ZTJA 3U1JB 2OTVA 5DGJA 4JZ1A 1ARBA 1CHOG 1SGNE 4Y11E 1FY1A 1ID5H 3LH3A 1LTOA 3L3TA 4U32A 4B74A 1HJ9A 1ELVA 1BZXE 1L0ZA 1NC6A 4TYDA 3DHKH 5FXLA 3BG4B 3I77A 3KN2A 4Z1MD 2GV7A 8KME2 2HRVA 1GI4A 2VGCB 2FOEA 3N7EA 1JBUH 2YNAA 1ELGA 2H6MA 1H8DH 1EUFA 1L1NA 1QJ1B 1Y5UT 5C5OA 1TX7A 2G5NA 2CHAC 5F03A 2ZTZA 4NSVA 3RU4E 2JIZD 4I8HA 1BBRH 1ELDE 2JJ1D 1RIWC 1VKYA 5T6FA 1LHDH 1V2TT 1ZGVA 1N6YA 1OWHA 2TGDA 2TBSA 1O2KA 1VITH 4NWKA 4AORA 2PKSC 3K6YA 2F9BH 2R0LA 4CH8B 3SUGA 5FAHA 2H5CA 1GBJA 1NROH 2R3YA 1SGRE 1SLXB 1FPHH 2ZHFH 1J15A 2K0QA 2ZHWH 1H9HE 4NZLA 1DUEA 3SGQE 5CMXH 3SN8A 4OGXA 3RC5A 3PTNA 4FOUC 1CHOF 2C8ZB 1OPHB 1QBNA 3QLPH 4DG4A 1YPGH 1QL7A 2PFEA 1G2LA 2VIPA 3SI4H 4X2YA 3PRDA 4NZQA 2ZCLP 4WXVA 1W12U 3MFJA 2XBXA 9ESTA 1K2I1 2WPMS 1O5DH 1LO6A 1B5GH 3E3TA 2WHXA 1P2KA 3BIUH 3RXSA 2GJGA 1CA0B 4YLQH 1SKYE 1VCPA 1SLWB 1LVMA 1NFWA 2BDCA 1FY3A 3PWBA 1S83A 1LHFH 2VWLA 2C8WB 1EP5A 4AG2A 1QCPA 4CRFA 2K8IA 1GJCB 4JZEH 1A3EH 4AGKA 5CDFE 3LDXH 2BXTH 1EB1H 2EY4C 2OBOA 3RM0H 3E0NB 1C5PA 4X0WU 2RA0A 1FMGA 2TGAA 1ELTA 2CJIA 4SGBE 3RXEA 3GY8A 1WU1A 3MU0A 1SPJA 1GBHA 2V3MA 3V13A 2BLQA 2L6OA 3KYFA 1JRTA 1FZZA 3H7OA 1SVPA 3O8DA 3SNEA 5EXMA 1O5EH 1ZHRA 1ORFA 3MNXA 1CHGA 4OS4A 5HIYA 3UQOA 4D7FA 3SW2B 4K60A 1GDQA 2Y6TA 4THNH 1AVXA 2SNWA 1GBMA 2W3IA 3GDSA 4MLFB 2WPLS 3O8CA 1DT2A 5DN6D 3KIDU 2VIDA 1KTSB 3BSQA 3MYWA 5F8TA 3SHCH 1F5KU 1ZTKA 3QN7A 5T3HA 3U28C 3KEEA 2J98A 2AFQB 1NRPH 5ETXA 4KGAA 4ACAA 2CMYA 2PGQB 4Y79A 1BRBE 1C5XB 2OINA 1KDQB 1HXFH 4JYTA 1E38B 2FI5E 3E1XB 1UW7A 2AEIH 4F55A 3GYMA 1E35B 3RXOA 2FESH 3EAJA 1K0HA 1OP2A 3FAOA 2ZU4A 2GCTC 2HGTH 1KMHB 3LPRA 1CA8B 3F9GA 3OEED 1EZUC 1BHXF 2GX4A 5JPMH 3U8TH 1AB9B 3M35A 3HKJB 1O37A 1FPCH 1O2RA 3EA7A 3QK1A 2Z9KA 4Y8XA 3UFAA 4TY7A 1CSOE 4OM9A 1AVGH 2GT7A 2ZDKA 3UREA 1GBTA 5C20A 4YM9A 1DUAA 2FLBH 2WV5A 4K2YA 2BY9X 2GT8A 2HVYB 1THSH 1UTJA 2TGTA 5A0AE 2KCPA 4MPXA 1RRKA 2PHBA 4IN2A 1O2UA 2AGEX 5DJ7A 1NTPA 3BTEE 1UCYK 1NS3A 1HV7A 2SFAA 4FUHA 4RN6A 5EJ1A 1BMAA 1BMFD 2BD2A 2F9VA 3FP7E 4Y6DA 1TNKA 1UK3A 2OLGA 1W0YH 2W7UA 4ZCNA 3QGJA 1P06A 3V7TA 1RS0A 2FTLE 4CRDA 3TGKE 1TBRH 2HOBA 3RMLH 2OUAA 1Y5BT 2A7JA 1SFQB 3UAIC 1MZDA 1P12E 1AE8H 4RKOB 1CT4E 1XUKA 1YY3A 4ZH8A 1QTFA 6CHAC 1TRYA 5FCRA 2ZDVH 2XC0A 1T8NA 3E90B 3T2NA 2VIWA 4X6PA 4ISHH 4WH6A 2GMTC 4FUJA 1GGDC 2Y81A 3PLPA 7GCHG 4J1YA 1MZAA 3QTOH 4I33A 3ZZ7A 1FN8A 1SG8B 4AB8A 1C1OA 2OBQA 3NUMA 2NU4E 6GCHG 4OS7A 1TBQH 2J94A 3D62A 4IW4E 4Q4LA 1E37B 3RXCA 2ZDMA 4D76A 1WTHD 5A8ZA 2YMSB 2BOKA 1O2MA 1GVZA 2VIOA 3OU0A 4XDEA 5J4QA 1IQIA 2PKAA 1FNIA 2HLCA 3DSGA 4ZXYH 2Q6FA 3Q3YA 1U6QA 1O3MA 3ZZ8A 3GY6A 2WINI 3ZZ6A 2M5TA 1O36A 1EX3A 1O30A 3ZZ9A 2Y82A 1JWTA 1B0FA 1ETRH 1O3LA 3EDXB
chains in the Genus database with same CATH topology
2HVYB 3MQKC 3UAIC 2RFKC 2EQNA 2EY4C 3U28C 2V3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HVY B;  3MQK C;  3UAI C;  2RFK C;  2EQN A;  2EY4 C;  3U28 C;  2V3M A; 
#chains in the Genus database with same CATH topology
 4GPG A;  4ABH A;  4ZMA H;  1P2M A;  1HAV B;  1YPE H;  2O8L A;  4JZI A;  1TQ0 B;  2DE9 A;  1PPZ A;  4MPW A;  4JCN A;  1QRW A;  4UFF H;  1TX8 A;  3PO1 C;  2BOH B;  1YPH C;  2GZ7 A;  1W10 U;  2V7Q D;  1TA6 A;  3A7X A;  4ASU D;  3KQE A;  2OK5 A;  7GCH F;  4BTI B;  4P02 A;  2QXI A;  1A7S A;  3VB5 A;  3BEU A;  4CRB A;  2XYA A;  1GHV H;  3MH6 A;  1UTM A;  5GND A;  2ZWL H;  3TIU A;  2I6Q A;  1OP8 A;  3GCH C;  1Z8I B;  3QZQ A;  1GBI A;  5DP7 A;  2VIN A;  3EGK H;  4Y8Z A;  1V6D A;  2H5D A;  2KZ4 A;  1MTN C;  3SHA H;  1XKB C;  1CVW H;  1RFN A;  4NCY A;  1AFQ C;  1PPE E;  3BTQ E;  3PRO A;  1MAB B;  1MKW H;  1ZYO A;  1DIC A;  1RD3 B;  3TH3 H;  2R2M B;  2OQ5 A;  3A7T A;  4Q7Y A;  1AU8 A;  1IQN A;  3LGY A;  3R0F A;  4AN7 A;  2RDL A;  3ELA H;  2QN5 T;  5IYT A;  3ZIA D;  3SYJ A;  3RC4 A;  1MBQ A;  3VGC C;  2FYR A;  2Z9G A;  1NU9 A;  2BDB A;  1UO6 A;  1ACB E;  3SUE A;  3K9X B;  3MO6 A;  2ZPQ A;  5T1V A;  2ZFQ H;  4CH2 B;  1W13 U;  2F43 B;  3T62 A;  1FI8 A;  1GJB B;  4K3J A;  4B73 A;  1HAZ B;  3DA9 B;  2CGA A;  1OHH D;  1WBG B;  3M5M A;  3E91 A;  4FU7 A;  2FTM A;  4IMZ A;  2LEL A;  3F2H A;  2KM0 A;  1C2J A;  2JH0 D;  1CGJ E;  1QUR H;  1VGC B;  3BTD E;  2B8O H;  5C5N A;  1C1S A;  2JDI D;  1YM0 A;  4B76 A;  4GCH G;  3RMN H;  1O33 A;  1C5O H;  1Y59 T;  2EC9 H;  4ASH A;  1JOU B;  1QZ8 A;  1EJN A;  3NWU A;  2C3S A;  2ZHD A;  3GCT G;  3KF2 A;  1PQA A;  1EST A;  3F6U H;  3SQH E;  1GJ8 B;  1E1Q D;  1LPG B;  3BTT E;  3PV2 A;  2JET B;  4YOJ A;  3TK9 A;  1TE0 A;  3CP7 A;  4ISO A;  5TJX A;  4WH8 A;  1MD7 A;  2QY0 B;  2A31 A;  3DFJ A;  5LPE A;  1C1W H;  1OYT H;  5K0H A;  4Y71 A;  3RXF A;  1WSS H;  1W3C A;  4TSF D;  1AI8 H;  1F5L A;  3FP8 E;  1EJM A;  1ELE E;  1YCP H;  4JZD H;  4YES B;  5FPT A;  2RG3 A;  1C2I A;  2ZZU H;  3FFG A;  3MWI U;  1UK2 A;  3C27 B;  2O8U A;  2WSS D;  2OD3 B;  1A0J A;  1ARC A;  1O35 A;  3D23 A;  2FLR H;  2ODP A;  2M2A A;  4B75 A;  1ELC A;  4U30 A;  1DS2 E;  1OOK B;  2TPI Z;  4CRE A;  4XE4 A;  4BOH A;  4DW2 U;  4X8V H;  3STI A;  4FU9 A;  4HZH A;  1KIG H;  1P8V C;  1JIR A;  4DIH H;  4Y0Z E;  2P95 A;  5C1X A;  4JK6 A;  1ZSK A;  2ZG0 H;  1YKT A;  4NFF A;  7EST E;  2NWN A;  4WME A;  1JRS A;  1NM6 A;  1P11 E;  2A4Q A;  2FOH A;  2XTT B;  2BMG B;  4XRN A;  2Y7X A;  4MG3 A;  2G8T A;  1G3D A;  1HLT H;  2FDA A;  1HPG A;  5DP4 A;  1BJU A;  2TIO A;  3RXU A;  4A1T A;  4KEL A;  5CHB A;  2TRM A;  1H9L B;  2D26 C;  4F48 B;  2BD7 A;  5IDK A;  1XXD A;  4O9V A;  2PV9 B;  4AFZ A;  3URD A;  2AS9 A;  3P70 B;  2ZGB H;  1KXF A;  2FOD A;  1CBW B;  1H1B A;  2G4T A;  3AW0 A;  3SU1 A;  5F53 A;  1SHY A;  1NRS H;  1IOE A;  3RXD A;  4O3U A;  3LT3 A;  1S6H A;  5EQS A;  1QY6 A;  1YCP M;  2BDH A;  1DSU A;  3KQC A;  1P04 A;  2PP6 A;  1DLE A;  2ZTY A;  1O34 A;  3A85 A;  3FZD A;  2TGP Z;  1QQU A;  3URC A;  1FLE E;  4LZ4 B;  5EJL A;  3GS9 A;  1AMH A;  5EG4 A;  1AN1 E;  4E05 H;  1GCT B;  5K7R A;  2V6N A;  4U2W A;  1D6W A;  3RXA A;  2ZGJ A;  1TFX A;  8GCH G;  2UUY A;  1MU6 B;  3SU0 A;  4NA7 A;  1YBW A;  2XCN A;  1S0Q A;  1QL8 A;  5E2P A;  1V2K T;  1C5U A;  1SFI A;  1AKS B;  3AAV A;  1V2M T;  5H4I B;  1NRR H;  4ZKS U;  1ZPB A;  5L2Y H;  5FBI A;  4KTS A;  1O2L A;  1ABJ H;  2FXR A;  3RXM A;  1EPT C;  2A5K A;  3HAT H;  5DSF A;  5FBE A;  2J98 B;  2HWL B;  1FV9 A;  1BTH H;  1GI0 A;  4D9Q A;  2BVX H;  4K1S A;  4MVN A;  3ZVG A;  2J92 A;  1TQ7 B;  1GBE A;  2C4F H;  2O9Q A;  3FKS D;  1TBZ H;  1GHY H;  3JZ1 B;  1LVY A;  4NA8 A;  1SLU B;  4NIW A;  3PV4 A;  1GBB A;  3SBK A;  2BYA X;  1GBC A;  4I8K A;  1Y3U A;  1PQ5 A;  1KXA A;  1C5L H;  3MI4 A;  1OSS A;  3M5O A;  3MO9 A;  1K1M A;  2ZF0 H;  4H4F A;  1PYT C;  1IQJ A;  1TNL A;  1EQ9 A;  1Z7K A;  3ZYD A;  2ULL A;  3OAA D;  2IJD 1;  4VGC C;  4YT6 H;  3U8R H;  1O38 A;  2J5U A;  1TAW A;  3KQD A;  1IHS H;  1SR5 C;  2F91 A;  5HXF A;  4GHT A;  1IHT H;  1GBF A;  1SQA A;  3VB6 A;  4X6N A;  4AG1 A;  4CHA B;  3AK5 A;  4AX9 H;  4ABJ A;  3TJU A;  4CRC A;  2WPD D;  5HKK D;  4X6O A;  1Q2W A;  3PLK A;  1HAO H;  1BTY A;  2IN2 A;  2AYW A;  1SMF E;  3A8D A;  1QHR B;  4AGJ A;  2R0K A;  1GBA A;  1K1I A;  2BZ6 H;  2L74 A;  1UTQ A;  3MNS A;  2NU1 E;  2BD3 A;  4BXW A;  5DP3 A;  2EQN A;  3FO8 D;  3P95 A;  1SGY E;  4ZUH A;  1AQ7 A;  1BTX A;  4B2C A;  1GG6 B;  2J97 A;  1XX9 A;  1KXD A;  4Q80 A;  1EZX C;  2GKV E;  1Y3Y A;  3PV5 A;  1EOL A;  3BG4 C;  5DKM A;  4IGD A;  1HCG A;  2VGC C;  1HNE E;  3BTG E;  1GMH G;  1TGN A;  2ZGX H;  2PLX A;  2ZU3 A;  4FXG H;  2AMD A;  1OKX A;  5HM2 A;  4I31 A;  5KGO A;  1PPB H;  3RU4 D;  5FX6 A;  1LVO A;  3SUF A;  5AHG H;  3SV8 A;  1IQL A;  3RP2 A;  5HGG A;  1P3E A;  3OX7 U;  5FL7 D;  3UWI A;  2ZP0 H;  1SQT A;  3OYP A;  5C1Y A;  4LK4 A;  1O5B B;  1MU8 B;  3P8N A;  1C4U 2;  2XWA A;  1QJ7 B;  1EAI A;  3PM3 A;  2ZNK H;  3ZVA A;  3WWF A;  2VWM A;  1BTZ A;  1BB0 B;  3PMB B;  1NBM D;  3PRB A;  4DUR A;  1F92 A;  4H6T A;  1A5I A;  3PLB A;  1BTP A;  2FYQ A;  1TX6 A;  2A1D B;  5EOK A;  1WTG H;  4IN1 A;  1QIX B;  4X1P U;  1YLN A;  4IS5 A;  3O8R A;  2FI3 E;  4NFE A;  1Z1J A;  2PKA B;  3IIT A;  1UCY H;  1V2R T;  2V35 A;  1O3D A;  3Q3X A;  1O2S A;  1FIW A;  1P0S H;  2Z94 A;  3ZVC A;  5C17 A;  5L30 H;  2OC0 A;  1D4P B;  1AUJ A;  4GLY A;  4ISI H;  1NO9 H;  2HPQ H;  1UVU H;  5EW1 H;  1M9U A;  2BX3 A;  1BRU P;  3S7K B;  3I78 A;  1O5A B;  2F9O A;  3QTV H;  3RXL A;  4A92 A;  3SNC A;  1GMH F;  2FOB A;  2BY8 X;  1NBM E;  1CA0 C;  1N8O B;  3ATM A;  2J95 A;  2Z6B D;  2XC4 A;  1EXF A;  3A8A A;  5JBA S;  3HK6 B;  3GOV B;  3RXK A;  1JXP A;  2A4O A;  4D7G A;  4BNR A;  1GJ7 B;  3RXQ A;  3ZZ5 A;  1P3C A;  2F3C E;  2XWB I;  3V12 A;  4E06 H;  1ZZZ A;  8LPR A;  5FX5 A;  1V2Q T;  3LC3 A;  1D3P B;  2A2X H;  1CO7 E;  3EYD A;  1S6L A;  3PTB A;  5DG6 A;  1L1G A;  3UOU A;  4A5T S;  4INH A;  2FOC A;  4ZXX H;  2GZ8 A;  1E36 B;  4MPU A;  3PYH A;  4Q63 A;  4FUD A;  2ZDN A;  1LPZ B;  3HKI B;  2B5T B;  3WWB A;  4ABI A;  1EKB B;  3W95 A;  4Y10 E;  2BY5 X;  4UDW H;  1G3B A;  2HNT C;  1P2I A;  2ILN A;  1DWD H;  1HAI H;  1C2K A;  1SQO A;  1C1T A;  2A7H A;  4ZKO U;  1A4W H;  3NZI A;  1A46 H;  1CU1 A;  1K28 D;  1S5S A;  4K1T A;  1P2O A;  1OWJ A;  1O2G H;  2HNT E;  1C2G A;  2RCE A;  5AF9 H;  1S84 A;  5AFY H;  2PSY A;  1AE5 A;  1LCY A;  2LPR A;  1ZOM A;  4TPI Z;  3LJJ A;  2H9H A;  1SGD E;  1O5G H;  4QT8 C;  1AKS A;  1O3B A;  3A7V A;  3ENS B;  1INC A;  1AB9 C;  3M3V A;  1QQ4 A;  5TCC A;  1Q3X A;  1DIT H;  3VB3 A;  7LPR A;  1QR3 E;  1NN6 A;  3HGN A;  4ABF A;  4EST E;  1ZPC A;  1L2E A;  4WVP E;  1GL1 A;  3AAS A;  1GCD A;  3TJV A;  1TGB A;  2W6J D;  1FY5 A;  1FUJ A;  5F8Z A;  3OFN D;  4RI0 A;  5JYI A;  2Y5H A;  1V2U T;  1IQM A;  3A7Y A;  2A7C A;  2EI8 A;  1AFE H;  1G37 A;  2OC7 A;  2VIV A;  1AY6 H;  3OY6 U;  2W3K A;  3MH4 A;  4DVA U;  2BM2 A;  4LOY H;  1ESB A;  1LHC H;  4GVU A;  3S69 A;  3SGB E;  4DOQ A;  3UNS A;  2GTB A;  1V2N T;  3RXV A;  1T7C A;  1XMN B;  1OWK A;  2XNI A;  1TOC B;  3A86 A;  2C8Y B;  1E1R D;  1DXW A;  1BMM H;  2HNT F;  1PPH E;  1BRA A;  1N1L A;  2ZKS A;  1GVL A;  2Z9J A;  2F83 A;  1D3T B;  2BD4 A;  3OE7 D;  1DE7 H;  1NPM A;  1AGJ A;  1TGS Z;  4ISN A;  1O3I A;  1VZQ H;  1C5N H;  2UWO A;  2BD8 A;  1YYY 1;  1ANC A;  3MO3 A;  1F0T A;  2FPZ A;  1C5Q A;  3TJO A;  3P8O A;  2ZEB A;  2AIQ A;  1ETS H;  5ESB A;  4I8G A;  3EA8 A;  1T8O A;  1QA0 A;  3DSP A;  3SJK A;  1C5Z B;  1C5V A;  2ZO3 H;  3A80 A;  4O3T A;  1P9U A;  3MU1 A;  1QA7 A;  3NPS A;  3LC5 A;  1NY2 2;  3WW7 A;  2Z9I A;  1UVO A;  1YPJ H;  1P9S A;  3I29 A;  3UNQ A;  2VIQ A;  1ETT H;  2YMS C;  2BD5 A;  2J4I A;  3LGU A;  4BAK B;  1C1R A;  5PTP A;  4LXB H;  5AVD A;  2O8M A;  1UTK A;  1PPC E;  2Q6G A;  2H2Z A;  2ZFS A;  4DT7 B;  2H1U A;  2D1J A;  2QXH A;  2STA E;  1TRN A;  3SJ8 A;  1O3J A;  4JYU H;  4X1N U;  1C2E A;  3EA9 A;  3T29 A;  1TPO A;  3ATL A;  2SGD E;  4X8U H;  4YOG A;  1VCQ A;  1BIO A;  1KTT B;  3RXJ A;  3U1I B;  1O2Z A;  4OS5 A;  5A0C A;  2FOF A;  4TT3 D;  5HMA A;  4ZRO A;  2OQU A;  2BY7 X;  4AFQ A;  3TU7 H;  5T6D A;  2D8W A;  2KX4 A;  2C90 B;  4X8T H;  1P2J A;  4DJZ B;  3ODF A;  1O3O A;  1MTS A;  1VIT G;  2ZC9 H;  2JH5 D;  1O3H A;  1QB9 A;  3NCL A;  1LQE A;  4DCD A;  1A0L A;  2THF B;  3BN9 A;  2G5V A;  1COW D;  4U01 A;  2EI7 A;  1UTL M;  3AW1 A;  3ZVD A;  1C2L A;  3ZV8 A;  1ZPZ A;  2QF5 A;  3M7T A;  3VPK A;  2FOA A;  3RMO H;  1HAG E;  1O3G A;  4YZU A;  1K22 H;  2C8X B;  5EPN A;  4WF8 A;  4WJG 2;  2Y5G A;  4INL A;  1UK4 A;  1GHB G;  1TNI A;  3ATK A;  1AWF H;  1K1O A;  4AOQ A;  2CF9 H;  1KXC A;  2FM2 A;  4HTC H;  3T28 A;  1GBD A;  1DPO A;  1YPH E;  6GCH F;  1RXP A;  4WMF A;  2CV3 A;  1PQ8 A;  1DY9 A;  1T31 A;  2XRC A;  1C5T A;  5E0J A;  2ZQ1 A;  1WCZ A;  1CE5 A;  1Y3V A;  2SGP E;  4TPY A;  3S9C A;  1ZLR A;  3UB0 A;  3U8O H;  2ODQ A;  2GD4 B;  1TON A;  3LGW A;  3P8F A;  4K8Y A;  1VGC C;  4DII H;  1VIT F;  1OYQ A;  1YPK H;  3SU3 A;  2BLV A;  3VG8 A;  2PTN A;  1T8M A;  3UR9 A;  1WOF A;  1XUJ A;  2ZHE H;  1C1N A;  1EFR D;  4UFG H;  3DUX H;  4CRG A;  1QNJ A;  5CE1 A;  3E6P H;  4NWL A;  2JET C;  1GMD G;  1TMT H;  1WYK A;  2NU0 E;  4MNX A;  1YPM H;  1DWE H;  3SO3 A;  3SQE E;  2PUX B;  2WYG A;  2AMQ A;  2P8O B;  1J14 A;  5EOD A;  4OS1 A;  5CHA B;  3F0P A;  2VBC A;  3O8B A;  1JMO H;  1BJV A;  1EJA A;  2STB E;  2RFK C;  5I46 H;  1AO5 A;  3F1S B;  1DWC H;  1BOQ A;  3RXH A;  2KCY A;  2Y7Z A;  2AH4 X;  1IQE A;  1GJ9 B;  1MTV A;  1ZJK A;  1GI2 A;  3HPT B;  2ZU2 A;  3SNB A;  1A5H A;  2I6S A;  1TWX B;  3KNX A;  2FMJ A;  5C3N A;  1AFQ B;  3LGV A;  5C1U A;  2BX4 A;  1C5R A;  2R9P A;  1C4Y 2;  3VB7 A;  4UON A;  1Y5A T;  2ANK H;  1F7Z A;  1TA2 A;  1TNG A;  1O31 A;  6EST A;  1CQQ A;  1K1J A;  5E8E H;  2AMP A;  1OWD A;  1D3D B;  1GJA B;  4RSP A;  4KKD A;  1YGC H;  1THR H;  1SHH B;  4AC9 A;  1VR1 H;  1G32 B;  3DSO A;  1DAN H;  2A45 B;  1NZQ H;  2ZTX A;  5JBT A;  1DY8 A;  1LHE H;  2GV6 A;  4Y0Y E;  2Z3C A;  4OS2 A;  3PMH B;  2O8W A;  2J34 A;  1DM4 B;  4XBC A;  1GMD F;  2OC1 A;  1WQS A;  1A0H B;  2BVS H;  1AIX H;  1MCT A;  1CBW C;  1OXG A;  1BA8 B;  1DX5 M;  3RM2 H;  2ZIQ H;  4KTU A;  3ZZ4 A;  4ZKN U;  5DPA A;  1BTW A;  2ZPS A;  1BQY A;  2BDI A;  1FN6 A;  1HAH H;  4A1X A;  2GCH G;  4GCH F;  2NU3 E;  3A87 A;  2YOL A;  2B7D H;  3M3S A;  1ZTL A;  3C1K A;  5GCH G;  1GCT C;  3GCT F;  2ZFR H;  3N99 A;  3SU4 A;  4FUI A;  1GI8 B;  1XUI A;  3AVZ A;  2SGA A;  5ABW A;  1ZJD A;  3RDZ A;  1C1P A;  3ITI A;  4FUC A;  1ELF A;  3ZZC A;  5J4S A;  2ZDL A;  1T8L A;  3V0X A;  3A89 A;  1HFD A;  4I86 A;  1V2O T;  4JYV H;  4BTU B;  3BEF B;  5JBB S;  1S6F A;  2FS9 A;  2UUF B;  4A7I B;  1V2P T;  1G30 B;  2Z7F E;  1GI1 A;  3ZYE A;  3RLW H;  4IC6 A;  4OGY A;  5KEC A;  2BDA A;  5LPR A;  2P3T B;  1V2V T;  4R0I A;  1IQF A;  1TB6 H;  4D9R A;  3MHW U;  3D49 H;  1SC8 U;  3A82 A;  4FUG A;  1FJS A;  1RGQ A;  1EZS C;  1VJA U;  3PWC A;  4MNV A;  3S0N A;  4GAW A;  3TK6 A;  1EZQ A;  1UTO A;  1O2W A;  3SJI A;  1GDN A;  3VEQ B;  3RXT A;  2PWX A;  4UEH H;  1PYT D;  2GCH F;  2V0B A;  1SGI B;  1TNH A;  2PTC E;  2G51 A;  4CHA C;  5GCH F;  2XBW A;  1GL0 E;  4XBD A;  5G4B A;  1MKX K;  1KLT A;  2PSX A;  4A6L A;  1SGQ E;  1A61 H;  3LKW A;  1G2M A;  4H6S B;  1DDJ A;  4AB9 A;  1IQG A;  1O5C B;  1O3N A;  1O2Y A;  1FAK H;  4JK5 A;  5FPS A;  3SV9 A;  1C1U H;  4ABB A;  4X8S H;  5TCA A;  1GG6 C;  4WY3 A;  2ANW A;  3IWM A;  1Z8J B;  3DFL A;  3TJN A;  1GHX H;  1RTL A;  1TYN A;  2AGG X;  2XC5 A;  1MTW A;  1QBO A;  3RXG A;  1QL9 A;  1AZ8 A;  2PUQ H;  3V3M A;  2SGF E;  3TLO A;  1ELB A;  1KYN A;  2OCV B;  8GCH F;  1XVM A;  1EOJ A;  3ZVF A;  3SV6 A;  1Q31 A;  1YPL H;  1AZZ A;  1DOJ A;  5B6L A;  1CGI E;  1L4D A;  1SI5 H;  2VVV A;  2ZEC A;  3HK3 B;  4NA9 H;  2WUC A;  3P8G A;  3N7O A;  2XOK D;  1ANB A;  2VJ1 A;  1Y8T A;  3SGA E;  1IAU A;  1THP B;  3LON A;  1NFX A;  2EA3 A;  4ABE A;  4ACB A;  5EJZ A;  3QDZ B;  4X1S U;  3A7Z A;  2VVU A;  1FQ3 A;  7KME H;  1MAX A;  3QUM P;  1UHB A;  2SNV A;  4ZAE A;  1GI3 A;  2D2D A;  4TWW A;  4F49 A;  3DT0 H;  2VB0 A;  5AFZ H;  4LZ1 H;  1SL3 A;  1XUH A;  3LIW A;  3TPI Z;  4YTA A;  2WPJ S;  3BTF E;  3FP6 E;  3ODD A;  1C5W B;  3EE0 B;  1T4U H;  3K6Z A;  4M9F A;  3GY3 A;  4E7N A;  2VH6 A;  2ZFP H;  3UUZ A;  2ZFT A;  1HJA B;  4B6E A;  2GP9 B;  3FN8 A;  4BXS A;  1NFY A;  1UMA H;  5JDU B;  1H9I E;  3L6P A;  1O2O A;  1TPP A;  2BZA A;  3LOX A;  3R3G B;  2UUK B;  1LPK B;  1N8O C;  1OWI A;  1O3P B;  2BLW A;  3UIR A;  4R8T B;  3SJO A;  5C94 A;  1TIO A;  4YT7 H;  2WZQ A;  5HIZ A;  2G00 A;  1P05 A;  3UY9 A;  2Q6D A;  1OX1 A;  1GDU A;  2IPQ X;  3U98 H;  1UTN A;  1K1N A;  1AND A;  1TAB E;  5JBC S;  3SV7 A;  2GGV B;  1LVB A;  1MUE B;  1Y3W A;  3MU8 A;  3SI3 H;  1J16 A;  1GI6 A;  1OWE A;  4FVD A;  1MQ6 A;  1C5S A;  2FOG A;  1HYL A;  1UVT H;  4P00 A;  1K21 H;  1HUT H;  3F68 H;  4IMQ A;  1HAY B;  1GBK A;  3SUD A;  1O2V A;  4HGC A;  2ZA5 A;  2G52 A;  1HIA A;  1O3C A;  4IBL H;  3T25 A;  2BLO A;  4JMY A;  5LPF A;  4MNW A;  4B6F A;  2Q1J A;  2FEQ H;  2FI4 E;  1BIT A;  2CK3 D;  2W5E A;  4K5Z A;  3RMM H;  5HM9 A;  3ZZA A;  1MD8 A;  1ZHP A;  1OS8 A;  2BQ6 B;  2VWN A;  3A8C A;  1NRN H;  1NT1 A;  3KQ5 A;  3NRL A;  3BTK E;  4Y7A A;  3FVF B;  3SND A;  2CHA B;  2KAI A;  2QE7 D;  3OY5 U;  4NIY A;  3T26 A;  4Q7X A;  2JJ2 D;  4UFE H;  1RIW B;  1PFX C;  4YXW D;  1TPA E;  2JH6 D;  1SSX A;  1DST A;  1DWB H;  1VCW A;  1HDT H;  4M7G A;  1T4V H;  1EAW A;  1QRX A;  2PKS B;  2QGR A;  2B0F A;  1GHW H;  3VB4 A;  3Q3K A;  1EAT A;  3UWJ H;  3T5F H;  1AD8 H;  1Z8G A;  5EPY A;  5JB9 S;  1V2W T;  3DD2 H;  4BAN B;  3E0P B;  1FX0 B;  4CR5 A;  1GVK B;  4KTC A;  3RXR A;  1SGC A;  1PQ7 A;  4WMD A;  1TMB H;  3A84 A;  5EXN A;  1H8H D;  2WYJ A;  3AAU A;  4FET A;  1BMN H;  1IQK A;  2B9L A;  2A2Q H;  1XUF A;  1GJ6 A;  5EW2 H;  3G01 A;  2Z9L A;  3M36 A;  4XOJ A;  2IPH A;  1ZML A;  1Z6E A;  4FU8 A;  2WPK S;  4E7R G;  4X1Q U;  4GHQ A;  2OXS A;  1FXY A;  1LHG H;  1GHA G;  1SOT A;  1SB1 H;  2FOM B;  1BML A;  5GDS H;  3QO6 A;  1MMJ N;  1EB2 A;  3F2G A;  4DT4 A;  1GHZ A;  3BTH E;  1XUG A;  1P03 A;  5FPY A;  4ABG A;  1FDP A;  5EGM A;  1WXR A;  1GBL A;  2J9N A;  3MU4 A;  2XBV A;  1SLV B;  2ZCK P;  3MU5 A;  1SOZ A;  1GWA A;  2HVX A;  1BDA A;  1NU7 B;  1BHX B;  2PR3 A;  3ATI A;  3RUO A;  1C9T A;  3BG8 A;  4BAH B;  1IQH A;  3RXI A;  4B2B A;  5A0B A;  2W6I D;  1O3E A;  2P59 A;  1TOM H;  2AHM E;  1BTU A;  1C1M A;  3HGP A;  1GI5 A;  1LKA A;  1BUI A;  5F8X A;  3VFE A;  2PGB B;  1KY9 A;  5IK2 D;  2A0Q B;  1W2K H;  2W26 A;  1ZRB A;  4D8N A;  2FX4 A;  1F2S E;  3ZVE A;  1SGT A;  3K2U A;  3DCL A;  1BCU H;  3Q00 A;  2AER H;  3FZZ A;  3SOR A;  4J2Y B;  4ABA A;  1W7G H;  1A1R A;  2V3O H;  3KCG H;  2QXJ A;  3M5N A;  1PJP A;  3K65 B;  3CS0 A;  1CT2 E;  2QAA A;  5LGO A;  1K1L A;  3LU9 B;  2A32 A;  1E0F D;  3KHV A;  1N6X A;  3TNS A;  1GHA F;  1E79 D;  1EPT A;  4HFP B;  4HG6 A;  1EP6 A;  1ZRK A;  2YMS D;  4K8B A;  3VXE H;  1XM1 A;  3S9A A;  4ZHA A;  3GCN A;  5EXL A;  3A7W A;  1MTU A;  3PB1 E;  1J17 T;  4X2W A;  1S81 A;  3TK5 A;  1GJ5 H;  3KL6 A;  1BBR K;  2GCT B;  2Y80 A;  2HLD D;  2FX6 A;  1V2S T;  3BEI B;  3OSY A;  1K9O E;  4NIV A;  5DP5 A;  2FZZ A;  3VXF H;  3QWC H;  2BQW B;  4NGA H;  1V2L T;  5E2O A;  4RKJ B;  1C2F A;  5BPE A;  1W7X H;  3OTP A;  1G9I E;  1P10 A;  3W94 A;  4FUE A;  3EST A;  2BDG A;  1H8E D;  2VWO A;  1Z6J H;  3SU6 A;  1AUT C;  3GY5 A;  1NFU A;  2K1Q A;  4MQA A;  4CBN A;  1O32 A;  3FAN A;  2QIQ A;  1TGT A;  1L1J A;  4PRO A;  1W11 U;  5GJ4 B;  1UVP A;  2P3U B;  1SQR A;  1HBT H;  3ZZ3 A;  2ZU1 A;  3CEN A;  3F3B A;  2BD9 A;  4ZHL U;  3A8B A;  3UOP A;  2UWP A;  5SGA E;  5DP6 A;  4Z6A H;  1UJ1 A;  2ANM H;  3QGN B;  4NSY A;  4O97 A;  1LKB A;  3B23 B;  4X6M A;  2A5A A;  3RU4 T;  4INK A;  3WY8 A;  4YO9 A;  4UE7 H;  3BF6 H;  1C5Y B;  2ZGC A;  1GJ4 H;  1UCY E;  1MCV A;  1X7A C;  4MDS A;  2W7S A;  1BBR E;  1SGF A;  1HRT H;  2DE8 A;  4OS6 A;  3GY7 A;  6CHA B;  4SGA E;  1CGH A;  2XND D;  3F9F A;  5EQR A;  2ZU5 A;  1B7X B;  4AZ2 B;  1SGP E;  2ODY B;  3UNR A;  2GMT B;  5A09 A;  1GGD B;  8EST E;  2FS8 A;  2QF3 A;  3MH7 A;  1NES E;  1EAU A;  2ALP A;  4I32 A;  1ANE A;  1D6R A;  2WV4 A;  5I25 A;  3U69 H;  3UTU H;  1V2J T;  4B2A A;  2VU8 E;  2ZHQ H;  1HGT H;  2BDY A;  3B9F H;  1P02 A;  1DXP A;  5C2Z A;  5B6O A;  3OTJ E;  4ZHM U;  3UQV A;  4YLU A;  4DY7 B;  1W0J D;  2V3H H;  2SGE E;  4MPV A;  1S82 A;  4K69 A;  1ZGI A;  3NKK A;  5EU8 A;  4Q7Z A;  1G3E A;  1MBM A;  4Z0K A;  3UR6 A;  1C5M D;  1QB6 A;  4BAQ B;  2P93 A;  2GDD A;  2WPH S;  5EIY A;  1FIZ A;  2XXL A;  2ZPR A;  2RA3 A;  5DP9 A;  2FIR H;  3GYL B;  1O2P A;  2P8O C;  1TNJ A;  5CHA C;  3F9E A;  4CR9 A;  1W0K D;  1O5F H;  1J8A A;  1O2T A;  3L33 A;  5C0T A;  3SU5 A;  1GJD B;  1YF4 A;  1G36 A;  3TNT A;  4A1V A;  1WDI A;  1SGE E;  1KSN A;  4ABD A;  1UHB B;  1P2Q A;  1VJ9 U;  3ZZB A;  4DGJ A;  3BTM E;  4MNY A;  1HXE H;  1XKA C;  3SOS A;  3PO1 B;  5KED A;  1FY8 E;  1GI9 B;  1W0Z U;  4CBO A;  1MKX H;  2F4L A;  3A88 A;  3GY2 A;  3KQB A;  9LPR A;  1YWU A;  3BV9 B;  3CNR A;  2KR7 A;  3OEH D;  3M61 U;  4NG9 H;  4GUX A;  1ZSL A;  1DLK B;  2DUC A;  4ZKR U;  5A8X A;  3B8J A;  1GHB F;  1O0D H;  1BRC E;  2RDE A;  2QYI A;  3GCH B;  1J9C H;  2ZGH A;  1LDT T;  4AFS A;  1Y3X A;  1O3A A;  1LQD B;  2IOT A;  1XXF A;  3MQK C;  3FOA A;  1YLC A;  1W14 U;  1MTN B;  2BXU H;  2OP9 A;  4YOI A;  1UVS H;  3RC6 A;  5T6G A;  3F9H A;  3GCO A;  2EST E;  2J38 A;  2XCF A;  2Z3E A;  3MOC A;  2BQ7 B;  3PMJ A;  1TRM A;  2ANY A;  5GPI B;  3SJ9 A;  1P09 A;  2AGI X;  2CN0 H;  2H9T H;  2KCA A;  3S9B A;  1C1Q A;  2QA9 E;  4O03 A;  3SU2 A;  3MTY A;  3VGC B;  4TWY A;  1GMC G;  1KLI H;  3Q76 A;  2FO9 A;  3ATW A;  4XSK U;  1CT0 E;  1UTP A;  2ZFF H;  4WWY A;  3W1E A;  4K1E A;  2HPP H;  2ZQ2 A;  3P6Z B;  1YLD A;  3MNB A;  1MAY A;  1BT7 A;  3M5L A;  1H8I H;  2ASU B;  3M7Q A;  1KDQ A;  2PW8 H;  1PPG E;  5HYO A;  2R2W U;  4X1R U;  3ZVB A;  1C2M A;  1KLJ H;  2A4R A;  3STJ A;  1YC0 A;  3Q77 A;  1PPF E;  4FVB A;  2CXV A;  1KXE A;  1E34 B;  1WAY B;  2QF4 A;  1P57 B;  5E0H A;  1C4V 2;  4TY6 A;  1MH0 A;  4Y8Y A;  2EI6 A;  2HAL A;  5DK1 A;  1RTK A;  2QV1 A;  2P94 A;  1HIA B;  1C1V H;  2F9N A;  3E16 B;  2P3F H;  5F6M A;  4B71 A;  1O2X A;  2QF0 A;  1SBW A;  2KFW A;  4JZF H;  2XBY A;  2QC2 A;  1QBV H;  4FUF A;  1S0R A;  1W8B H;  3SZE A;  1GPZ A;  1GI7 B;  3BTW E;  5C67 A;  3GDU A;  2KAI B;  4F4O C;  1NRQ H;  1QGF A;  4AFU A;  1KXB A;  5LH8 A;  2GVF A;  3TGI E;  3D65 E;  2F9U A;  2OC8 A;  3M3T A;  5EST E;  5BRR E;  4IC5 A;  1WQV H;  3UPE A;  2GZ9 A;  1G3C A;  1QRZ A;  3M7U A;  3MNC A;  4BTT B;  1ELA A;  1A5G H;  3EQ0 H;  3F0O A;  1GMC F;  1P01 A;  1YP9 A;  3CS7 A;  3QX5 H;  4HI3 A;  1WV7 H;  1ZR0 A;  1TMU H;  2UWL A;  3KYG A;  3P92 A;  3TVJ B;  1TPS A;  4H42 U;  2FP7 B;  4AYV B;  3JZ2 B;  1O39 A;  2VH0 A;  3P17 H;  2AIP A;  3H09 A;  1QFK H;  2Y5F A;  2VVC A;  2G81 E;  1EAX A;  1D9I A;  3F2F A;  1ZMN A;  3RXP A;  4I8L A;  2KCO A;  1A2C H;  5C0U A;  4NIX A;  2BTC E;  5EQQ A;  1L4Z A;  3E8L A;  3ZV9 A;  1A3B H;  1V3X A;  3LJO A;  1C2D A;  2G4U A;  2QXG A;  2BHG A;  2C93 B;  5DP8 A;  1OP0 A;  2LNC A;  3ZZD A;  1HB0 B;  2IJO B;  4B1T A;  1HJ8 A;  1QB1 A;  2CF8 H;  4MTB A;  2ALV A;  4UD9 H;  3QZR A;  3GIC B;  3TH4 H;  1RTF B;  2LP6 A;  3TIT A;  6LPR A;  2ZCH P;  1Z8R A;  1O2H A;  3MMG A;  1MKW K;  1C9P A;  1ZSJ A;  4I8J A;  3BIV H;  5JB8 S;  3GY4 A;  3MH5 A;  4I7Y H;  2JKH A;  4XBB A;  1TAL A;  4RT0 A;  2A5I A;  1K1P A;  2EEK A;  5FHT A;  3A81 A;  2VNT A;  1MQ5 A;  2GDE H;  1O2N A;  2R3U A;  4Y76 A;  4BAO B;  3IG6 B;  3NXP A;  3M37 A;  2BY6 X;  1F0S A;  3N7D A;  3GDV A;  1F0U A;  3SNA A;  1TGC A;  1H4W A;  3TH2 H;  1O3F A;  2O8T A;  2BVR H;  2P16 A;  2H9E H;  1C2H A;  1HAV A;  1AVW A;  1AHT H;  4XD7 D;  1D3Q B;  3H7T A;  2NU2 E;  5GIB A;  1O2I A;  2Z3D A;  2G55 A;  1EAS A;  2SGQ E;  3LGI A;  3TGJ E;  1F5R A;  4Y7B A;  1XVO A;  4XFQ A;  4Q2K A;  2XW9 A;  1ZHM A;  4X2V A;  2WUB A;  1HAX B;  1O3K A;  1EPT B;  1O2Q A;  2J2U A;  5A8Y A;  1RJX B;  4WXI A;  4GSO A;  2ZDA H;  3A83 A;  3PMA B;  5GXP A;  2QCY A;  2FWW A;  5FCK A;  1FY4 A;  1ESA A;  1TLD A;  1T32 A;  1WUN H;  1HJA C;  1JIM A;  1DVA H;  5GWZ A;  4RT1 A;  1QJ6 B;  1AWH B;  4CRA A;  1S85 A;  1Z71 A;  3S7H B;  1DFP A;  5L2Z H;  3EE7 A;  5L6N H;  4AYY B;  4X2X A;  4VGC B;  1LMW B;  1HAP H;  3RLY H;  3U9A H;  1YCP K;  3LGT A;  2F9P A;  1F0R A;  1B0E A;  3RXB A;  1O2J A;  1Z1I A;  2YNB A;  3T27 A;  3SZN A;  1FAX A;  2WPI S;  4KP0 A;  3SV2 H;  3NK8 A;  1FON A;  2BB4 A;  1ABI H;  4FUB A;  5E0G A;  3GIS B;  4UFD H;  2UUJ B;  1P2N A;  2ZI2 H;  4BAM B;  5A2M H;  5DO4 H;  1ZMJ A;  3H5C B;  4ISL A;  1SGF G;  2WV9 A;  3KGP A;  2A4G A;  3LH1 A;  1ZTJ A;  3U1J B;  2OTV A;  5DGJ A;  4JZ1 A;  1ARB A;  1CHO G;  1SGN E;  4Y11 E;  1FY1 A;  1ID5 H;  3LH3 A;  1LTO A;  3L3T A;  4U32 A;  4B74 A;  1HJ9 A;  1ELV A;  1BZX E;  1L0Z A;  1NC6 A;  4TYD A;  3DHK H;  5FXL A;  3BG4 B;  3I77 A;  3KN2 A;  4Z1M D;  2GV7 A;  8KME 2;  2HRV A;  1GI4 A;  2VGC B;  2FOE A;  3N7E A;  1JBU H;  2YNA A;  1ELG A;  2H6M A;  1H8D H;  1EUF A;  1L1N A;  1QJ1 B;  1Y5U T;  5C5O A;  1TX7 A;  2G5N A;  2CHA C;  5F03 A;  2ZTZ A;  4NSV A;  3RU4 E;  2JIZ D;  4I8H A;  1BBR H;  1ELD E;  2JJ1 D;  1RIW C;  1VKY A;  5T6F A;  1LHD H;  1V2T T;  1ZGV A;  1N6Y A;  1OWH A;  2TGD A;  2TBS A;  1O2K A;  1VIT H;  4NWK A;  4AOR A;  2PKS C;  3K6Y A;  2F9B H;  2R0L A;  4CH8 B;  3SUG A;  5FAH A;  2H5C A;  1GBJ A;  1NRO H;  2R3Y A;  1SGR E;  1SLX B;  1FPH H;  2ZHF H;  1J15 A;  2K0Q A;  2ZHW H;  1H9H E;  4NZL A;  1DUE A;  3SGQ E;  5CMX H;  3SN8 A;  4OGX A;  3RC5 A;  3PTN A;  4FOU C;  1CHO F;  2C8Z B;  1OPH B;  1QBN A;  3QLP H;  4DG4 A;  1YPG H;  1QL7 A;  2PFE A;  1G2L A;  2VIP A;  3SI4 H;  4X2Y A;  3PRD A;  4NZQ A;  2ZCL P;  4WXV A;  1W12 U;  3MFJ A;  2XBX A;  9EST A;  1K2I 1;  2WPM S;  1O5D H;  1LO6 A;  1B5G H;  3E3T A;  2WHX A;  1P2K A;  3BIU H;  3RXS A;  2GJG A;  1CA0 B;  4YLQ H;  1SKY E;  1VCP A;  1SLW B;  1LVM A;  1NFW A;  2BDC A;  1FY3 A;  3PWB A;  1S83 A;  1LHF H;  2VWL A;  2C8W B;  1EP5 A;  4AG2 A;  1QCP A;  4CRF A;  2K8I A;  1GJC B;  4JZE H;  1A3E H;  4AGK A;  5CDF E;  3LDX H;  2BXT H;  1EB1 H;  2EY4 C;  2OBO A;  3RM0 H;  3E0N B;  1C5P A;  4X0W U;  2RA0 A;  1FMG A;  2TGA A;  1ELT A;  2CJI A;  4SGB E;  3RXE A;  3GY8 A;  1WU1 A;  3MU0 A;  1SPJ A;  1GBH A;  2V3M A;  3V13 A;  2BLQ A;  2L6O A;  3KYF A;  1JRT A;  1FZZ A;  3H7O A;  1SVP A;  3O8D A;  3SNE A;  5EXM A;  1O5E H;  1ZHR A;  1ORF A;  3MNX A;  1CHG A;  4OS4 A;  5HIY A;  3UQO A;  4D7F A;  3SW2 B;  4K60 A;  1GDQ A;  2Y6T A;  4THN H;  1AVX A;  2SNW A;  1GBM A;  2W3I A;  3GDS A;  4MLF B;  2WPL S;  3O8C A;  1DT2 A;  5DN6 D;  3KID U;  2VID A;  1KTS B;  3BSQ A;  3MYW A;  5F8T A;  3SHC H;  1F5K U;  1ZTK A;  3QN7 A;  5T3H A;  3U28 C;  3KEE A;  2J98 A;  2AFQ B;  1NRP H;  5ETX A;  4KGA A;  4ACA A;  2CMY A;  2PGQ B;  4Y79 A;  1BRB E;  1C5X B;  2OIN A;  1KDQ B;  1HXF H;  4JYT A;  1E38 B;  2FI5 E;  3E1X B;  1UW7 A;  2AEI H;  4F55 A;  3GYM A;  1E35 B;  3RXO A;  2FES H;  3EAJ A;  1K0H A;  1OP2 A;  3FAO A;  2ZU4 A;  2GCT C;  2HGT H;  1KMH B;  3LPR A;  1CA8 B;  3F9G A;  3OEE D;  1EZU C;  1BHX F;  2GX4 A;  5JPM H;  3U8T H;  1AB9 B;  3M35 A;  3HKJ B;  1O37 A;  1FPC H;  1O2R A;  3EA7 A;  3QK1 A;  2Z9K A;  4Y8X A;  3UFA A;  4TY7 A;  1CSO E;  4OM9 A;  1AVG H;  2GT7 A;  2ZDK A;  3URE A;  1GBT A;  5C20 A;  4YM9 A;  1DUA A;  2FLB H;  2WV5 A;  4K2Y A;  2BY9 X;  2GT8 A;  2HVY B;  1THS H;  1UTJ A;  2TGT A;  5A0A E;  2KCP A;  4MPX A;  1RRK A;  2PHB A;  4IN2 A;  1O2U A;  2AGE X;  5DJ7 A;  1NTP A;  3BTE E;  1UCY K;  1NS3 A;  1HV7 A;  2SFA A;  4FUH A;  4RN6 A;  5EJ1 A;  1BMA A;  1BMF D;  2BD2 A;  2F9V A;  3FP7 E;  4Y6D A;  1TNK A;  1UK3 A;  2OLG A;  1W0Y H;  2W7U A;  4ZCN A;  3QGJ A;  1P06 A;  3V7T A;  1RS0 A;  2FTL E;  4CRD A;  3TGK E;  1TBR H;  2HOB A;  3RML H;  2OUA A;  1Y5B T;  2A7J A;  1SFQ B;  3UAI C;  1MZD A;  1P12 E;  1AE8 H;  4RKO B;  1CT4 E;  1XUK A;  1YY3 A;  4ZH8 A;  1QTF A;  6CHA C;  1TRY A;  5FCR A;  2ZDV H;  2XC0 A;  1T8N A;  3E90 B;  3T2N A;  2VIW A;  4X6P A;  4ISH H;  4WH6 A;  2GMT C;  4FUJ A;  1GGD C;  2Y81 A;  3PLP A;  7GCH G;  4J1Y A;  1MZA A;  3QTO H;  4I33 A;  3ZZ7 A;  1FN8 A;  1SG8 B;  4AB8 A;  1C1O A;  2OBQ A;  3NUM A;  2NU4 E;  6GCH G;  4OS7 A;  1TBQ H;  2J94 A;  3D62 A;  4IW4 E;  4Q4L A;  1E37 B;  3RXC A;  2ZDM A;  4D76 A;  1WTH D;  5A8Z A;  2YMS B;  2BOK A;  1O2M A;  1GVZ A;  2VIO A;  3OU0 A;  4XDE A;  5J4Q A;  1IQI A;  2PKA A;  1FNI A;  2HLC A;  3DSG A;  4ZXY H;  2Q6F A;  3Q3Y A;  1U6Q A;  1O3M A;  3ZZ8 A;  3GY6 A;  2WIN I;  3ZZ6 A;  2M5T A;  1O36 A;  1EX3 A;  1O30 A;  3ZZ9 A;  2Y82 A;  1JWT A;  1B0F A;  1ETR H;  1O3L A;  3EDX B; 
#chains in the Genus database with same CATH homology
 2HVY B;  3MQK C;  3UAI C;  2RFK C;  2EQN A;  2EY4 C;  3U28 C;  2V3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...