3MQKC

Cbf5-nop10-gar1 complex binding with 17mer rna containing aca trinucleotide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
75
structure length
75
Chain Sequence
MKRLGKVLHYAKQGFLIVRTNWVPSLNDRVVDKRLQFVGIVKDVFGPVKMPYVAIKPKVSNPEIYVGEVLYVDER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA pseudouridine synthase B
publication title Structural and functional evidence of high specificity of Cbf5 for ACA trinucleotide.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
total genus 12
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2010-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.230 Mainly Beta Beta Barrel Thrombin, subunit H Probable tRNA pseudouridine synthase domain 3mqkC00
3MQKC 2EY4C 3U28C 2RFKC 2V3MA 3UAIC 2HVYB 2EQNA
chains in the Genus database with same CATH superfamily
1GJ7B 5DKMA 3LDXH 1C5YB 2ZPSA 1MUEB 4ISOA 2BY7X 1QQ4A 3EA9A 1GJ6A 2ODQA 1SKYE 1BJUA 1F5KU 4DJZB 5ABWA 1ELCA 4K2YA 3Q76A 5DPAA 2GKVE 3UUZA 1UTOA 3RXGA 4D7GA 2GT8A 1A0LA 2BHGA 5A8ZA 2WUCA 5C5OA 5C0UA 3MNBA 1FIZA 1H9LB 1YPMH 2OINA 1BRBE 1WDIA 1MCTA 8GCHF 1O2LA 4ISLA 3R3GB 4CREA 3SU5A 1JXPA 1F2SE 3RXJA 1EP5A 2JDID 3M3SA 1O39A 2W26A 2LELA 2GDDA 4CBNA 3MWIU 4GPGA 1Z8GA 2UUJB 2WPHS 4H4FA 1YKTA 3S0NA 4TWYA 1Z7KA 2V3MA 3TITA 1O3AA 1XUJA 4YXWD 1TNHA 3F0OA 4GLYA 4Y8XA 3ZYEA 1BT7A 1LDTT 4X8TH 3BN9A 2FMJA 2V6NA 1JRSA 3ODDA 1H8HD 5AF9H 3PMJA 1GL1A 3ZV8A 1GJBB 3P8OA 3LGWA 1C2HA 1J8AA 2XBYA 2HNTC 2FX6A 4I8JA 4D9RA 1UVOA 2EA3A 5C94A 2VH6A 1DPOA 3QZRA 5DP5A 2F4LA 3A86A 3ZZ9A 2KM0A 1GGDC 1ZHPA 1IQLA 3K65B 3MH7A 1EAIA 3ZVBA 4A5TS 1GJCB 3SHCH 2AHME 2J98B 5LH8A 1EASA 4AFSA 1GJ9B 4XD7D 2GGVB 1PPEE 2GV6A 2J34A 1ANBA 2QIQA 3LGTA 3CP7A 1Z71A 1WBGB 4O3TA 2VINA 2ZGXH 1DWBH 3KQEA 1FX0B 4LOYH 3GICB 2GD4B 3A82A 1E37B 4FVBA 2F43B 1ZOMA 2FTLE 1RFNA 4PROA 3U98H 4NG9H 1SGQE 1QZ8A 2ZFSA 4RT0A 1XXFA 2XTTB 5FX6A 3UR9A 2Y5FA 3E8LA 4Y8YA 1AFQB 4O97A 1YPEH 1DITH 2BX4A 4AORA 4BXWA 3PMBB 1V6DA 1L1JA 2F9BH 1ELEE 4DOQA 3QWCH 1S0QA 5C2ZA 1ANCA 3LKWA 2UWLA 1EPTA 1UVPA 1CE5A 1RTFB 3UOUA 4IC5A 4I8HA 2WV5A 1S84A 4NWKA 2ZWLH 4MG3A 4U32A 2V35A 3K6ZA 1C2MA 1WCZA 2Z7FE 4INLA 2VJ1A 1HAPH 1DOJA 2UUKB 1LCYA 3A83A 1HYLA 1GBLA 4CRFA 4UFFH 1VJAU 4FUCA 2RCEA 4OGYA 1G2MA 1EFRD 2VBCA 1ORFA 5T1VA 4XDEA 3TK9A 3FVFB 1UCYE 4K60A 3TJUA 1JBUH 4BTTB 3LC5A 2RDEA 1OYQA 2QY0B 2QN5T 4XOJA 3SV2H 2D1JA 3ZZ4A 1CVWH 1TNJA 1HAVB 1V2TT 3QZQA 4OS1A 1PPHE 4FUIA 3SJOA 4GVUA 1HUTH 1DY8A 1K1JA 2HNTF 1NFYA 1NU9A 1O33A 1FV9A 4A7IB 3EQ0H 2ZU1A 1QQUA 1BUIA 3SU3A 3BG4C 3IITA 2BD3A 4K8YA 3PROA 2IN2A 2KFWA 4O03A 3QK1A 4FVDA 4AFZA 3TH2H 2YMSD 3F9EA 5EIYA 2XC5A 1NRRH 3KYGA 5T6GA 2HOBA 5CMXH 1GBAA 3RXUA 3RXHA 1QB1A 4HI3A 4X1QU 1KLJH 2A4GA 1G37A 3F2FA 4ABDA 1MQ6A 2R3UA 2HPPH 2QXHA 4BXSA 1K0HA 1QHRB 2BDHA 4X2YA 1P03A 2TIOA 3I78A 1C5RA 1TONA 1AVXA 1MZDA 4WMFA 4YTAA 4ABGA 1D3DB 2ZU5A 3DFLA 9ESTA 1ANEA 1TGBA 3A81A 4AX9H 4NZLA 4ACBA 4XSKU 1Z8IB 1GMHG 1FXYA 1BJVA 3RLYH 1BTWA 4DCDA 2NU3E 1S5SA 2BDGA 3S7KB 1RIWB 1EAXA 1RD3B 1RTKA 2VB0A 2WPMS 2W3IA 1M9UA 5AVDA 1FY5A 4WY3A 2ZDKA 2BQ7B 1O36A 2Y82A 4KELA 1A4WH 2AMQA 3I29A 1JOUB 1QURH 2WPDD 4Y76A 4YO9A 2FOHA 2A45B 1H9HE 3N7OA 3VFEA 2SGQE 2QV1A 1OP8A 1E36B 1W14U 1O3OA 3FFGA 2FO9A 1LMWB 2VWNA 1ZYOA 1UK2A 2H5DA 2RG3A 2ZFPH 3BTGE 1DSUA 3A7VA 1GJ4H 1GWAA 1C5QA 2Y80A 1MAXA 4ASUD 3HKIB 1TGSZ 2R2WU 2OK5A 4I33A 3MH5A 2AFQB 1P2JA 1W7GH 2PR3A 1S6FA 1NRNH 3A8DA 2JETC 3LPRA 1VITH 2BD2A 4CRDA 3GY6A 1XMNB 1NTPA 2FOGA 1YLNA 5FAHA 1ARBA 4SGAE 2WUBA 1L1GA 3A89A 4GHQA 3U1JB 4BAKB 5EOKA 2ZTXA 1TPPA 2ZGJA 4AOQA 3BTHE 3RXMA 2HRVA 5A09A 1ELFA 3AK5A 3OX7U 2CN0H 5JDUB 1UTKA 1T8OA 3HKJB 1C2JA 2ZGCA 1HFDA 1B0FA 1A46H 1GVKB 2GZ7A 3MHWU 3LGYA 5EW2H 1A0JA 2PKAB 4MPXA 2JH6D 3QN7A 1WQSA 1XUHA 1BTUA 1C1WH 1CU1A 3V12A 3QLPH 2ODYB 3UOPA 2VWMA 2TPIZ 1AIXH 2PUXB 3L33A 5LPEA 2PTCE 3KL6A 1GI3A 1GDUA 2AIPA 5DP6A 2BZAA 1CHOF 1VITG 2ZHDA 1FY3A 1AI8H 5FPSA 4GCHG 1ELTA 1GG6C 4ZXXH 1SQAA 4KP0A 3M3VA 5C17A 2BTCE 2CXVA 1SGEE 3SUDA 3F9GA 4Q7YA 3BF6H 2GTBA 2IJOB 2G4TA 3G01A 3PMHB 2BMGB 2HGTH 3SW2B 2HLCA 3LGUA 3ZVGA 1KDQB 3SORA 3FZDA 2UWOA 4R8TB 4BANB 1P01A 1S82A 3Q00A 2ZECA 2VIPA 4WH8A 3ZVDA 5J4QA 2STBE 1DX5M 4ISIH 4WH6A 2PTNA 2NU0E 1COWD 3SJKA 1TBZH 2G55A 1AKSB 5EPNA 1TRYA 2G52A 1J15A 1YY3A 1Q31A 2YMSB 1Y8TA 2P95A 3ZZCA 1V2VT 2ALPA 2PKSB 3FN8A 5FHTA 2D8WA 2FS8A 3SNCA 1T4UH 2G51A 3P8GA 4KKDA 3M35A 1UTPA 3LH3A 5IYTA 1QJ7B 4I86A 2OBQA 3K9XB 3BTDE 4E05H 2GJGA 5DO4H 1O2YA 1TGCA 1F0RA 4TT3D 2ZDVH 1ELAA 1H8IH 2J98A 3RXIA 4NSVA 1HGTH 3A7WA 3MU4A 3BTFE 1BBRK 1GBTA 1SVPA 2OBOA 3DSGA 4UD9H 1P02A 1Y3VA 5DSFA 1BRCE 3HATH 1YLCA 1WV7H 2BB4A 2CV3A 4NFEA 2XYAA 1ZHRA 2EC9H 3SNDA 1UK3A 1N8OC 3SU4A 4D7FA 4KTUA 2OQUA 2JIZD 2AH4X 3N7DA 1NS3A 2FI3E 2O9QA 4NIWA 3TJNA 2BVRH 4Y8ZA 4F48B 5GXPA 3RXRA 4ZHLU 1NFWA 1JWTA 3RMLH 3BTKE 2PGBB 3F0PA 5DGJA 2KR7A 1GHVH 2VIOA 4MNWA 3GCTG 4INKA 5CDFE 1O3EA 3PWBA 4Y79A 2JKHA 4FU9A 7GCHG 1SQRA 1PPZA 1GHXH 1G3EA 7ESTE 3PRDA 1G3CA 1QFKH 2ZA5A 5GIBA 3ZZ8A 1P2IA 1LPZB 3GDVA 3GY3A 1FI8A 1GBHA 1BB0B 4B2AA 2V0BA 1IAUA 2PFEA 1FPCH 5JPMH 1GCDA 1O38A 3ZZBA 3WWBA 1TMTH 2XBXA 3SQHE 1OS8A 4I31A 1TX8A 1V2JT 1ABJH 1C1NA 1MQ5A 2I6QA 4O9VA 4JK5A 5GCHF 3BIUH 1O2KA 3PV4A 4CRCA 1FAKH 4UDWH 1O2MA 1Z1IA 1Y3UA 3UB0A 3TVJB 4X6PA 1C5OH 1QB6A 1HAVA 1P9UA 3MH4A 4WF8A 4HFPB 1E38B 3ATKA 3GY5A 3SU6A 3BIVH 1NRPH 3GS9A 3SV6A 1W0KD 5K0HA 2A7HA 3M7TA 1RXPA 1ACBE 2WV4A 4BAOB 1C4U2 4ABIA 1P09A 1SFIA 2ZHFH 5ETXA 1IOEA 1P3CA 4BAQB 3KHVA 2H6MA 1O3PB 1QB9A 3MO9A 1H4WA 2DE9A 2R0LA 1IHTH 1BZXE 4M7GA 3RXBA 6CHAC 1QIXB 4B73A 3EA7A 4YM9A 1PQ5A 1MTWA 4E06H 3ZIAD 2EI7A 1AO5A 1O2JA 3NWUA 2XRCA 2TGAA 3KYFA 1V2RT 1FNIA 8GCHG 3U69H 4CRGA 1C4Y2 4IGDA 1GBFA 1GHAG 3GCTF 1C5NH 4F49A 1T8LA 2ZU4A 2FOAA 3LOXA 4UONA 1YGCH 7GCHF 5EODA 2KCAA 1U6QA 1LVBA 1HJAC 5FCRA 1AUTC 1P2KA 4MVNA 4MNYA 2CF9H 4DT4A 1QY6A 5JB8S 3MOCA 2XC0A 5EPYA 1P10A 1LPKB 2RA3A 1S6LA 4NFFA 2ZPQA 2RFKC 2Q6FA 1O5CB 2VIDA 1V2ST 1HV7A 4MQAA 5PTPA 4K1TA 3A80A 4TPYA 1HRTH 3M7QA 1DSTA 2SGAA 2ZQ2A 2SGPE 2ZO3H 1SPJA 4X6OA 1UCYK 1RJXB 2C8WB 3KIDU 4FUGA 1C9PA 2HVYB 1AD8H 3RXEA 3RC6A 4JCNA 2JH0D 5CHBA 1PQ8A 3SNAA 9LPRA 4I8LA 2WYJA 1EJNA 1W12U 2ZHQH 1MH0A 1C1RA 3PMAB 3ZYDA 3TGIE 4GSOA 3WY8A 4KTSA 5AHGH 5E0HA 3SI3H 4AC9A 1RGQA 4AFQA 1UTLM 2FOBA 3GYLB 2FOEA 1SLWB 1NRSH 2TBSA 1ZJKA 1MMJN 3LU9B 2BQWB 3OSYA 3BG4B 1K2I1 5C1XA 5DP4A 2I6SA 1BITA 1FONA 3PTNA 1OP2A 4TY6A 2Y81A 3RXSA 3OY5U 1ZMLA 1OWDA 2SFAA 3QGNB 1OOKB 3ZVAA 2WPKS 2IPHA 2FLRH 1HXEH 3TLOA 1AFEH 3UREA 3ZZDA 3O8BA 1C5UA 1QR3E 4DGJA 3TIUA 1ZZZA 3T27A 1MKWK 1ELVA 4B6EA 1C5VA 1GCTC 2AYWA 3EGKH 5BPEA 3S69A 2XBVA 4FU8A 4MLFB 1BBRH 2M2AA 4Q7XA 2H9TH 4Q80A 1GHAF 1P2MA 3GYMA 1DUAA 1UMAH 1W7XH 1N6YA 4B75A 2TGTA 2BZ6H 3UTUH 1RS0A 1YC0A 1DFPA 3PO1B 2PKAA 3F2HA 2P59A 1QBVH 2TGPZ 3UQOA 2C8YB 1C5ZB 1EJMA 4FUJA 2FWWA 1H8DH 2FYRA 3V0XA 3HGNA 5B6LA 3PM3A 3FO8D 1AZZA 5EQQA 3MTYA 1C9TA 3H5CB 3OAAD 4LK4A 1A5HA 4K3JA 3BEUA 1LPGB 3F68H 1SGRE 2J5UA 2FI5E 5E8EH 2R2MB 3ZVEA 4ZHMU 5F8TA 3TGJE 1AU8A 1MBQA 1EP6A 1LQEA 5F53A 1K1PA 1HAZB 1SC8U 1KDQA 1LHFH 5HKKD 1O3BA 1Y5BT 3ATLA 1MABB 1QNJA 3S7HB 2Y5GA 3MH6A 1VGCB 2GV7A 2CMYA 5F6MA 1ZR0A 1TOMH 2JETB 5EGMA 3U28C 4MNVA 1TYNA 4DW2U 2FOMB 3OYPA 1KXCA 1W10U 2A5IA 2SNWA 4WXIA 3NCLA 3E3TA 3U8OH 1EQ9A 4JZFH 4YLUA 1AKSA 2CGAA 4AB8A 4Z1MD 3C1KA 3EE7A 1IQNA 1SGTA 1CSOE 3H09A 2G5NA 2BY6X 4B6FA 4RKOB 1TE0A 4U01A 4CH8B 1GI6A 1E35B 3QTOH 4ISHH 1ZTJA 1HAXB 1O5EH 1JRTA 2QXJA 3V7TA 2NU4E 1IQHA 5HIZA 5DP7A 8LPRA 3BG8A 1S81A 4ISNA 1ZHMA 3SJ8A 1O2ZA 1SMFE 1EAWA 2GT7A 1O2UA 1P04A 5FXLA 3UNQA 1OXGA 2CHAB 3VGCC 1L2EA 1C5TA 1NESE 1IQJA 2OC8A 1WOFA 1GG6B 3F6UH 2OTVA 3T26A 1D3PB 1SQTA 4ZCNA 4D8NA 4DY7B 1GBJA 3FP8E 3GDUA 3SO3A 3MU1A 1ETTH 4X0WU 1IQFA 1Y3WA 2QF0A 1A7SA 3F9FA 3FP6E 2ALVA 1PFXC 2XCNA 3K6YA 2F9NA 4H6TA 3GDSA 1K1IA 1WSSH 2ODPA 1UCYH 4JYUH 7LPRA 1GVZA 3OFND 2A2XH 1DS2E 2W5EA 3DA9B 2BDCA 2AIQA 5CHAC 3DSPA 2G5VA 1SLXB 1TRNA 1PPGE 4I8GA 5EXNA 1HNEE 1K1LA 2EEKA 1VZQH 1C1MA 1QGFA 3D23A 2G81E 2P93A 2C3SA 2A32A 4OGXA 1ELGA 2RDLA 1FIWA 1A5GH 3STIA 3VPKA 1Y3YA 4TPIZ 1MTVA 3O8RA 1MD7A 2VIQA 3MNCA 4WMEA 1BQYA 1WAYB 4ABBA 3PLPA 1AZ8A 1P3EA 3RXAA 4IC6A 5IDKA 3RM0H 4ABAA 3LH1A 4FXGH 1D3TB 1UVSH 3PO1C 4NA8A 2WYGA 3LGIA 4JZ1A 5A0BA 4ESTE 1SHHB 2BXUH 2F3CE 3ENSB 5FBEA 2ZPRA 1A3BH 2THFB 2QE7D 1SLVB 5EXLA 1A5IA 3TNSA 3NXPA 1G2LA 3ZVFA 3S9BA 3AW1A 1C1VH 1L4ZA 3Q3XA 1K9OE 1MKWH 2GDEH 1C1TA 1CHOG 5DP3A 3KQDA 1P9SA 2G4UA 1XUGA 3MO6A 3SJIA 1EKBB 2B5TB 2FOCA 4Y10E 2ULLA 3NUMA 4FUHA 4MDSA 2ZHEH 5C0TA 5GDSH 2KCOA 1C5SA 1W0JD 1N8OB 4YLQH 1GDQA 3SGQE 2OQ5A 1LVMA 3MMGA 3AVZA 3MU0A 4MPVA 5JBTA 1T8MA 2EI6A 1TX7A 2JJ2D 1ZTLA 1JIRA 2QGRA 4A92A 1ETSH 1LO6A 1OWJA 4X8UH 5T6DA 4YT6H 5L2YH 1VGCC 3RC5A 4YT7H 3PTBA 1EZXC 1BRUP 1BTYA 2J95A 2Q1JA 2OC1A 2P94A 2STAE 3MNSA 1HPGA 2ILNA 2QXIA 2ZHWH 1TGNA 2PUQH 3SV8A 3BTQE 5T3HA 1FAXA 1UHBB 1HAYB 5C5NA 5C20A 3A7TA 1BCUH 2ZCKP 3TPIZ 1YF4A 1O5DH 1KIGH 3QO6A 4D76A 1KXAA 1WTHD 1A2CH 3B9FH 1G9IE 2VIWA 2Y6TA 4IN2A 3OEHD 1LHDH 1CHGA 2ZDNA 1QCPA 3DHKH 2F9OA 3EA8A 1UVUH 1EAUA 3M5NA 1EOLA 3BEIB 1H9IE 2FLBH 2WINI 1O2WA 1A0HB 1OP0A 2FX4A 4ABHA 2ZF0H 4ASHA 2KZ4A 1FY1A 4IW4E 4X6NA 2K0QA 2BD8A 2BD9A 1CGJE 2RA0A 3FOAA 4JZDH 2CHAC 4FOUC 1ESTA 2V7QD 1W11U 3DT0H 2FODA 4XE4A 4Y7AA 1VJ9U 3PRBA 4FUDA 1TNLA 1F0TA 3ESTA 2BD7A 4FU7A 4RSPA 6CHAB 3BTME 4BAMB 4XRNA 1O5GH 1QRXA 1O3DA 7KMEH 1JIMA 4K1SA 3TH4H 5G4BA 1TRMA 1OHHD 6GCHF 1AMHA 2YOLA 1TMBH 1BTXA 1ESAA 3PYHA 3P8FA 4YZUA 2ZIQH 5FPYA 4Y11E 1AVWA 1SGCA 2IJD1 3GISB 3PV5A 2VVVA 2YNBA 1S85A 1ZGVA 3IG6B 3DUXH 1C5XB 2AGGX 4XFQA 2R9PA 2XW9A 1WUNH 1HJAB 2GMTC 1YPKH 3W95A 4F4OC 2SNVA 5B6OA 5EXMA 3RXTA 1X7AC 4E7RG 1QL9A 4X2VA 2XWAA 1ESBA 2K8IA 3MFJA 3RXKA 4J2YB 3UFAA 4FUBA 1GI1A 1CO7E 3VG8A 5GCHG 1KYNA 3F2GA 4DURA 1WQVH 2Z9LA 1NZQH 1B7XB 1O2QA 2Q6GA 1GMDF 3S9CA 4MPUA 5TCCA 4AG2A 4BOHA 2ZDMA 1TBRH 4X2XA 2A4RA 4OS2A 2G8TA 2LNCA 1SB1H 4ZUHA 2A7CA 4TYDA 5BRRE 3MYWA 1AB9B 1TB6H 1SR5C 4ZKSU 5A0CA 1H8ED 4X1SU 1GBDA 1XVMA 1TNKA 2QYIA 2ZDAH 2WPJS 3SBKA 5GJ4B 5HMAA 1O2XA 2ANYA 3SU1A 1RRKA 5ESTE 4D9QA 2V3HH 3SI4H 1BMNH 4Q2KA 1EZUC 3E0NB 3P8NA 4B2BA 1IHSH 5A8XA 2W6ID 3RMNH 3GY8A 1P11E 1IQKA 3RXDA 1TNGA 2H9EH 2EY4C 4ABEA 1O31A 3RU4E 3TK6A 4AN7A 2ZNKH 5FL7D 1O32A 1TALA 2PSXA 3T28A 5KECA 3UWJH 1GCTB 2AMPA 2P3TB 2V3OH 2Z6BD 1PQ7A 3UWIA 3SJ9A 2BXTH 1KXBA 1CGIE 3KQCA 2C8ZB 1HIAB 1SOZA 2TRMA 1UTQA 2ZP0H 3A85A 8ESTE 4ZKOU 4YOGA 2W7UA 1GHYH 2BX3A 1BA8B 1HAIH 2VNTA 3UQVA 1QL8A 1GBKA 1W3CA 5CE1A 4UFEH 1T4VH 1SI5H 2ANKH 4OS4A 2EQNA 3SV9A 1DUEA 1YPGH 1O5AB 1ELBA 1FMGA 3EYDA 1MTUA 3ZZ3A 1THPB 2F9VA 5L2ZH 3ZZ5A 4CH2B 2BM2A 4BTUB 3RXFA 3R0FA 4GUXA 4HTCH 4X8VH 1ZMJA 1HXFH 3ITIA 3M37A 1W0YH 3B8JA 3A7YA 3NK8A 3DCLA 3A8CA 1LQDB 4AYYB 3GCHC 1O3GA 3ATMA 3ZZ6A 3M61U 3O8CA 1NT1A 2BOKA 1BMMH 3BTWE 1S6HA 3HGPA 2O8MA 3A7XA 3TJVA 4ZKNU 1TA2A 3SYJA 4A1XA 1DLEA 1B5GH 2ASUB 3RDZA 3SU2A 1CQQA 1Q2WA 3RUOA 4DIIH 3LIWA 2XXLA 2ESTE 3ZZ7A 1F7ZA 4WMDA 3RXLA 1MCVA 1XKBC 5HM2A 4ZKRU 1SGDE 1OKXA 1E1QD 1SQOA 3P95A 3U1IB 2ZCHP 1S83A 1MTNB 2C90B 3NRLA 3UNRA 2PSYA 4U30A 1QA0A 2DUCA 3FZZA 2KCPA 1Y59T 2ZKSA 1L4DA 3PLKA 2C4FH 1ZGIA 2A7JA 2FXRA 2UUYA 1YCPM 1GMCF 1F5LA 1DT2A 3D49H 4X8SH 3I77A 1B0EA 5EG4A 1KXEA 5HIYA 5JBCS 3RP2A 3TH3H 4NZQA 1V2WT 1O0DH 2KAIB 1HLTH 1ZLRA 1EZQA 2Z9IA 3SNBA 2FZZA 1C2DA 1NU7B 1QL7A 1J14A 2VU8E 3LONA 2OP9A 2XWBI 4X1NU 3IWMA 2PGQB 1F5RA 2ZFRH 1NFUA 1P0SH 5JYIA 3CS7A 1AHTH 1W0ZU 1Y3XA 4IMZA 1FJSA 2WPIS 4I8KA 3VGCB 1E0FD 1LKAA 1V2UT 3QDZB 3AAVA 3NZIA 1TNIA 1EX3A 3HK6B 1C1UH 3QGJA 4JZIA 1O2GH 2ZU2A 4ZROA 4ZMAH 1AB9C 2BD5A 6ESTA 4A1VA 2XBWA 5AFYH 3LT3A 4B2CA 2AEIH 1HJ9A 1SL3A 3OY6U 3TU7H 2WZQA 3NPSA 2BLOA 1DE7H 3OTJE 1MKXK 3E0PB 1BTHH 1PPBH 2F9PA 1O35A 1IQGA 1NFXA 3SQEE 1BMAA 3VXEH 1KMHB 3A88A 4P00A 4XBCA 3RXVA 4NIVA 2HWLB 5CHAB 1SGIB 2AGEX 2ZFTA 3CNRA 3VB7A 1GDNA 2GZ9A 1UHBA 1Z1JA 1BMLA 1BRAA 2BYAX 1O3KA 3HK3B 2HVXA 1GBBA 3M5OA 2VWLA 4RKJB 2WPLS 5FCKA 1Z6JH 2NWNA 4CRAA 1VCWA 3KNXA 3E6PH 4RN6A 1SLUB 4VGCB 3E16B 1TABE 2C93B 1O3NA 4AB9A 2IPQX 4JYTA 4NA9H 4H6SB 2AGIX 1Z8RA 1TGTA 3ZZAA 2PLXA 2GCHG 1XUKA 2CK3D 5EQRA 1GVLA 2FDAA 6LPRA 1K21H 2IOTA 4B76A 2O8TA 1SGYE 1BDAA 3SU0A 5I25A 3EE0B 2H9HA 3SUEA 5AFZH 3A8AA 1GL0E 1LHGH 1V2KT 1V3XA 1OPHB 4GAWA 5C3NA 3QTVH 4DG4A 1AWFH 4DIHH 1L0ZA 1NM6A 2Z3EA 1UTMA 4FETA 1ARCA 1F0UA 3CS0A 1TIOA 4NIYA 4Y7BA 1FN6A 1GBCA 1XVOA 3UR6A 3VEQB 3WW7A 5DJ7A 2VH0A 1EUFA 2R0KA 1O3IA 1MD8A 5EJLA 3K2UA 3PB1E 2OUAA 1TLDA 1HAOH 1CT0E 3OTPA 4P02A 2B0FA 3TNTA 4OM9A 2TGDA 1MZAA 1YLDA 3ATWA 4H42U 2ZGHA 3VB6A 4NWLA 2GCTC 1EB1H 4CBOA 2L74A 4Y6DA 5DP9A 1E1RD 4Y71A 1VR1H 2ZFFH 1YP9A 5FX5A 2FIRH 1MTNC 4AGKA 3L3TA 3T5FH 1UTJA 4OS6A 4J1YA 2H1UA 3FP7E 1DWCH 3SOSA 2CJIA 1UVTH 4ACAA 1KSNA 1YCPK 1ZPZA 1E34B 1NRQH 3SUFA 3A87A 5GPIB 3MQKC 4NGAH 3BTEE 1T32A 2J94A 3ATIA 1C1OA 1IQEA 3A8BA 1PPCE 1G30B 4WVPE 3UNSA 1O34A 1P05A 5HYOA 1CA0C 2P8OB 2GCHF 2ZCLP 1TOCB 3ZVCA 3NKKA 2Y5HA 2QXGA 2BVXH 3RU4D 4IN1A 1PJPA 3MU5A 1DVAH 4CHAC 3Q3YA 3M5MA 2QAAA 2BDAA 3KQ5A 2G00A 4Q4LA 1VCQA 1AY6H 4NCYA 5ESBA 1ANDA 3KCGH 1TPOA 1DWEH 5J4SA 5E2PA 3LC3A 1HAGE 3UPEA 1WXRA 1QRWA 4JYVH 1C1QA 1F92A 4TY7A 3WWFA 3Q77A 5IK2D 2J97A 1YM0A 5GNDA 3O8DA 2WSSD 1XX9A 3F1SB 2B8OH 1P8VC 3AASA 3BV9B 1D6WA 1HIAA 1FDPA 1UO6A 1ZRBA 5A8YA 1SGFG 3URCA 4IMQA 2J4IA 3BEFB 3PV2A 4TWWA 4MNXA 1KLTA 4X1PU 2GMTB 4X1RU 1A3EH 1LHEH 1EXFA 2PHBA 2Z9KA 1TA6A 2PW8H 3PLBA 2ZQ1A 4RI0A 3JZ1B 2F83A 1QRZA 1BTPA 1TQ7B 3RC4A 3BSQA 2BY9X 1Q3XA 1Z8JB 1RTLA 3RXOA 1E79D 3RLWH 1MKXH 2BLQA 2OC7A 4Z0KA 3UY9A 1YWUA 1GBEA 1HB0B 4VGCC 4UFDH 4MPWA 3SV7A 5JB9S 4XBDA 2A0QB 4DVAU 3ZV9A 3V13A 4JMYA 4Z6AH 4B1TA 2FYQA 3AAUA 1EJAA 1CBWB 1K1OA 4YESB 2VGCB 5JBBS 4AYVB 5HM9A 1ZJDA 1L1NA 2AMDA 1BHXB 1GI2A 2F9UA 4QT8C 4RT1A 1OX1A 1K28D 1P2OA 4KGAA 1DXWA 4DT7B 2BLWA 2W3KA 1ZPBA 2ZU3A 3UAIC 1O5FH 1WTGH 2KCYA 1THRH 1G3BA 2D2DA 1V2OT 2BDYA 2J2UA 1C2IA 2D26C 1MU6B 4LXBH 1SGNE 1V2QT 2BY5X 1QJ6B 1CT4E 2OXSA 1NY22 3V3MA 1IQIA 1QBOA 1YPJH 2A1DB 1A61H 3GY7A 4JZEH 4ABJA 1P06A 3Q3KA 5EW1H 5DP8A 1PYTC 2Z9JA 3RXQA 1KTSB 2M5TA 3P70B 1FUJA 1O2OA 1NBME 5EJ1A 5E0JA 3KF2A 1OWIA 2PWXA 2BQ6B 6GCHG 5DG6A 1QBNA 1LHCH 3H7TA 1TPSA 1DANH 2AS9A 1DICA 2DE8A 1T7CA 2JH5D 4TSFD 4I32A 1FY4A 3U8TH 1CA8B 1GI8B 3CENA 3JZ2B 1J17T 1MTSA 5E0GA 2KAIA 1OWKA 4U2WA 2A31A 1GHZA 1Y5UT 1NO9H 3KQBA 3T62A 1W2KH 2XNDD 3HPTB 3MNXA 1O2PA 4UFGH 2J9NA 2VVCA 1DXPA 3LJOA 1V2MT 4CRBA 3ODFA 4ZXYH 1QA7A 1C5PA 1ZSJA 2VVUA 1GMDG 1BOQA 1WU1A 1ETRH 4B71A 1D4PB 2Y7ZA 4A1TA 2ZTYA 3RMOH 3M7UA 2A4QA 3GCHB 1FPHH 1O3LA 2P8OC 4ZH8A 3M5LA 1P57B 3KN2A 5KGOA 1AFQC 2OC0A 1C5WB 3T2NA 2Z3CA 4E7NA 1O30A 1YCPH 5DN6D 1C1SA 1HCGA 3DFJA 1V2NT 2NU1E 2VIVA 1HJ8A 4FUFA 3AW0A 2XC4A 4THNH 1ZSKA 1C2LA 1GJ8B 1GMHF 1XXDA 1SGFA 1GJAB 2K1QA 2QCYA 1QJ1B 2WV9A 4GHTA 1OWEA 1ZSLA 3ELAH 1SHYA 2BOHB 1C2KA 3MU8A 1C1PA 1CGHA 1LVYA 2SGDE 3VB3A 1O3FA 3MI4A 1MAYA 3P92A 3VB5A 1AWHB 1TPAE 4HG6A 1KTTB 3E91A 1TBQH 2ZC9H 1GI7B 1GJDB 5E2OA 2H2ZA 1G3DA 1O3HA 3PWCA 2GZ8A 3MO3A 5GWZA 4KTCA 2HLDD 3RM2H 3OU0A 3URDA 5SGAE 1Z6EA 2UUFB 3U8RH 2A5AA 2BLVA 2P3FH 5LPFA 1LVOA 1ZTKA 2A2QH 4ZAEA 3A7ZA 4HGCA 2ZFQH 4R0IA 3N7EA 4A6LA 2JJ1D 3DSOA 4Y0YE 3FKSD 1GI0A 1JMOH 2ZDLA 4K5ZA 5T6FA 1ZRKA 1YPLH 2W7SA 1D3QB 2FP7B 4AG1A 4M9FA 4K8BA 5HGGA 4Y0ZE 3E90B 4AGJA 2XOKD 5C1YA 1KXDA 1N1LA 1CBWC 2B9LA 2Q6DA 1C2EA 1V2PT 3RXCA 2VGCC 5F03A 3P17H 1SG8B 3DD2H 2L6OA 1O5BB 1SSXA 1F0SA 3QUMP 1O2VA 3H7OA 1TAWA 1GI5A 4BTIB 5KEDA 4INHA 3W94A 1O3MA 2GVFA 5JBAS 1NROH 5EU8A 4YOJA 1P2NA 1GHWH 1D6RA 2B7DH 3SUGA 1IQMA 1OSSA 1O37A 1AE8H 1EPTB 2Z9GA 3STJA 2O8UA 1FZZA 2ZZUH 2ZG0H 1K22H 1ZMNA 3GCOA 4Q7ZA 1RIWC 2ZI2H 1O2SA 1K1NA 2P16A 2QF3A 3D62A 1S0RA 1VCPA 2R3YA 1XUIA 2J92A 3FANA 3W1EA 1O3CA 3M36A 5LGOA 1KXFA 1Y5AT 4LZ1H 3BTTE 1EATA 1INCA 1W13U 2LP6A 1THSH 1FN8A 4HZHA 1EOJA 4SGBE 4XBBA 5EJZA 5FPTA 1DM4B 2VWOA 1GMCG 2CF8H 2BDIA 1GPZA 1VITF 5F8XA 1O2IA 1FQ3A 3RU4T 1MU8B 2ZEBA 1D9IA 3B23B 4GCHF 4O3UA 1UK4A 1PPFE 4JK6A 1MBMA 2FM2A 3LJJA 5C67A 1N6XA 1GJ5H 2XNIA 1LTOA 4YOIA 1KLIH 3S9AA 4AZ2B 3SN8A 1ELDE 5C1UA 1ID5H 1SFQB 1ZPCA 4WXVA 2QC2A 4MTBA 2OD3B 8KME2 1C4V2 5L30H 2FOFA 4ZHAA 1PYTD 3T25A 1TWXB 2A5KA 4F55A 2PV9B 4X2WA 3SGBE 3SZEA 1SBWA 2FS9A 4WJG2 3F9HA 4NA7A 5K7RA 2WHXA 4ABFA 2SGEE 1GBMA 3LGVA 3GCNA 5DK1A 1GHBG 1HDTH 1GI9B 1PQAA 2QF4A 5EQSA 3TJOA 4I7YH 2HPQH 1AGJA 1EB2A 1DWDH 1HBTH 3UIRA 4Q63A 1BHXF 2SGFE 1AVGH 2P3UB 1ABIH 1NC6A 2ANWA 1T31A 5I46H 4K69A 3SGAE 1OWHA 1J9CH 2FTMA 2C8XB 3C27B 2Z3DA 1O2HA 1T8NA 1DLKB 4AFUA 1C2FA 2FEQH 2GCTB 1TFXA 2QA9E 2H5CA 1XKAC 2Y7XA 3A84A 4UEHH 5FBIA 1LKBA 1YYY1 1A1RA 1AE5A 4FUEA 3T29A 1YPHE 2W6JD 1BIOA 3GY2A 1GGDB 2GP9B 4IBLH 3U9AH 3KGPA 1DY9A 2O8LA 1TQ0B 1EZSC 2GX4A 2ZGBH 1YBWA 2LPRA 2FI4E 3N99A 1TX6A 3E1XB 3P6ZB 4CR9A 1W8BH 1O2NA 1O2RA 1GBIA 1P12E 2ANMH 2Z94A 3L6PA 4CR5A 1QTFA 3SNEA 3KEEA 2HALA 3VXFH 2O8WA 1UTNA 1CA0B 4OS5A 5TJXA 3TGKE 5A0AE 3EDXB 4BAHB 1AUJA 3TK5A 3QX5H 1NBMD 1WYKA 1P2QA 2OCVB 1OYTH 2OLGA 3GOVB 4WWYA 1V2LT 2BVSH 3OEED 4CHAB 2BD4A 1O3JA 1VKYA 1BTZA 3FAOA 2QF5A 2XCFA 3D65E 1G32B 2UWPA 2NU2E 3F3BA 1KY9A 2BY8X 2AERH 3RXPA 1C5MD 1GHBF 4OS7A 1NPMA 5H4IB 2PP6A 1HAHH 5TCAA 1FY8E 4X6MA 5LPRA 2YMSC 1AN1E 2F91A 2YNAA 4NSYA 1XUFA 2A4OA 2EI8A 1NN6A 1UW7A 3GY4A 2PKSC 4B74A 3M3TA 1TMUH 1SGPE 1DDJA 2FESH 1H1BA 1C2GA 3EAJA 3RMMH 1C5LH 1EPTC 1O2TA 2KX4A 5HXFA 1UJ1A 2ZTZA 4LZ4B 1J16A 5A2MH 1YPHC 4NIXA 2J38A 3VB4A 2FPZA 1K1MA 2BDBA 1BMFD 3SZNA 4BNRA 1SOTA 2HNTE 4IS5A 1AQ7A 1G36A 5L6NH 5F8ZA 1CT2E 1XM1A 4UE7H 1FLEE 3SHAH 1BBRE 4K1EA 1GI4A 3OE7D
chains in the Genus database with same CATH topology
3MQKC 2EY4C 3U28C 2RFKC 2V3MA 3UAIC 2HVYB 2EQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQK C;  2EY4 C;  3U28 C;  2RFK C;  2V3M A;  3UAI C;  2HVY B;  2EQN A; 
#chains in the Genus database with same CATH topology
 1GJ7 B;  5DKM A;  3LDX H;  1C5Y B;  2ZPS A;  1MUE B;  4ISO A;  2BY7 X;  1QQ4 A;  3EA9 A;  1GJ6 A;  2ODQ A;  1SKY E;  1BJU A;  1F5K U;  4DJZ B;  5ABW A;  1ELC A;  4K2Y A;  3Q76 A;  5DPA A;  2GKV E;  3UUZ A;  1UTO A;  3RXG A;  4D7G A;  2GT8 A;  1A0L A;  2BHG A;  5A8Z A;  2WUC A;  5C5O A;  5C0U A;  3MNB A;  1FIZ A;  1H9L B;  1YPM H;  2OIN A;  1BRB E;  1WDI A;  1MCT A;  8GCH F;  1O2L A;  4ISL A;  3R3G B;  4CRE A;  3SU5 A;  1JXP A;  1F2S E;  3RXJ A;  1EP5 A;  2JDI D;  3M3S A;  1O39 A;  2W26 A;  2LEL A;  2GDD A;  4CBN A;  3MWI U;  4GPG A;  1Z8G A;  2UUJ B;  2WPH S;  4H4F A;  1YKT A;  3S0N A;  4TWY A;  1Z7K A;  2V3M A;  3TIT A;  1O3A A;  1XUJ A;  4YXW D;  1TNH A;  3F0O A;  4GLY A;  4Y8X A;  3ZYE A;  1BT7 A;  1LDT T;  4X8T H;  3BN9 A;  2FMJ A;  2V6N A;  1JRS A;  3ODD A;  1H8H D;  5AF9 H;  3PMJ A;  1GL1 A;  3ZV8 A;  1GJB B;  3P8O A;  3LGW A;  1C2H A;  1J8A A;  2XBY A;  2HNT C;  2FX6 A;  4I8J A;  4D9R A;  1UVO A;  2EA3 A;  5C94 A;  2VH6 A;  1DPO A;  3QZR A;  5DP5 A;  2F4L A;  3A86 A;  3ZZ9 A;  2KM0 A;  1GGD C;  1ZHP A;  1IQL A;  3K65 B;  3MH7 A;  1EAI A;  3ZVB A;  4A5T S;  1GJC B;  3SHC H;  2AHM E;  2J98 B;  5LH8 A;  1EAS A;  4AFS A;  1GJ9 B;  4XD7 D;  2GGV B;  1PPE E;  2GV6 A;  2J34 A;  1ANB A;  2QIQ A;  3LGT A;  3CP7 A;  1Z71 A;  1WBG B;  4O3T A;  2VIN A;  2ZGX H;  1DWB H;  3KQE A;  1FX0 B;  4LOY H;  3GIC B;  2GD4 B;  3A82 A;  1E37 B;  4FVB A;  2F43 B;  1ZOM A;  2FTL E;  1RFN A;  4PRO A;  3U98 H;  4NG9 H;  1SGQ E;  1QZ8 A;  2ZFS A;  4RT0 A;  1XXF A;  2XTT B;  5FX6 A;  3UR9 A;  2Y5F A;  3E8L A;  4Y8Y A;  1AFQ B;  4O97 A;  1YPE H;  1DIT H;  2BX4 A;  4AOR A;  4BXW A;  3PMB B;  1V6D A;  1L1J A;  2F9B H;  1ELE E;  4DOQ A;  3QWC H;  1S0Q A;  5C2Z A;  1ANC A;  3LKW A;  2UWL A;  1EPT A;  1UVP A;  1CE5 A;  1RTF B;  3UOU A;  4IC5 A;  4I8H A;  2WV5 A;  1S84 A;  4NWK A;  2ZWL H;  4MG3 A;  4U32 A;  2V35 A;  3K6Z A;  1C2M A;  1WCZ A;  2Z7F E;  4INL A;  2VJ1 A;  1HAP H;  1DOJ A;  2UUK B;  1LCY A;  3A83 A;  1HYL A;  1GBL A;  4CRF A;  4UFF H;  1VJA U;  4FUC A;  2RCE A;  4OGY A;  1G2M A;  1EFR D;  2VBC A;  1ORF A;  5T1V A;  4XDE A;  3TK9 A;  3FVF B;  1UCY E;  4K60 A;  3TJU A;  1JBU H;  4BTT B;  3LC5 A;  2RDE A;  1OYQ A;  2QY0 B;  2QN5 T;  4XOJ A;  3SV2 H;  2D1J A;  3ZZ4 A;  1CVW H;  1TNJ A;  1HAV B;  1V2T T;  3QZQ A;  4OS1 A;  1PPH E;  4FUI A;  3SJO A;  4GVU A;  1HUT H;  1DY8 A;  1K1J A;  2HNT F;  1NFY A;  1NU9 A;  1O33 A;  1FV9 A;  4A7I B;  3EQ0 H;  2ZU1 A;  1QQU A;  1BUI A;  3SU3 A;  3BG4 C;  3IIT A;  2BD3 A;  4K8Y A;  3PRO A;  2IN2 A;  2KFW A;  4O03 A;  3QK1 A;  4FVD A;  4AFZ A;  3TH2 H;  2YMS D;  3F9E A;  5EIY A;  2XC5 A;  1NRR H;  3KYG A;  5T6G A;  2HOB A;  5CMX H;  1GBA A;  3RXU A;  3RXH A;  1QB1 A;  4HI3 A;  4X1Q U;  1KLJ H;  2A4G A;  1G37 A;  3F2F A;  4ABD A;  1MQ6 A;  2R3U A;  2HPP H;  2QXH A;  4BXS A;  1K0H A;  1QHR B;  2BDH A;  4X2Y A;  1P03 A;  2TIO A;  3I78 A;  1C5R A;  1TON A;  1AVX A;  1MZD A;  4WMF A;  4YTA A;  4ABG A;  1D3D B;  2ZU5 A;  3DFL A;  9EST A;  1ANE A;  1TGB A;  3A81 A;  4AX9 H;  4NZL A;  4ACB A;  4XSK U;  1Z8I B;  1GMH G;  1FXY A;  1BJV A;  3RLY H;  1BTW A;  4DCD A;  2NU3 E;  1S5S A;  2BDG A;  3S7K B;  1RIW B;  1EAX A;  1RD3 B;  1RTK A;  2VB0 A;  2WPM S;  2W3I A;  1M9U A;  5AVD A;  1FY5 A;  4WY3 A;  2ZDK A;  2BQ7 B;  1O36 A;  2Y82 A;  4KEL A;  1A4W H;  2AMQ A;  3I29 A;  1JOU B;  1QUR H;  2WPD D;  4Y76 A;  4YO9 A;  2FOH A;  2A45 B;  1H9H E;  3N7O A;  3VFE A;  2SGQ E;  2QV1 A;  1OP8 A;  1E36 B;  1W14 U;  1O3O A;  3FFG A;  2FO9 A;  1LMW B;  2VWN A;  1ZYO A;  1UK2 A;  2H5D A;  2RG3 A;  2ZFP H;  3BTG E;  1DSU A;  3A7V A;  1GJ4 H;  1GWA A;  1C5Q A;  2Y80 A;  1MAX A;  4ASU D;  3HKI B;  1TGS Z;  2R2W U;  2OK5 A;  4I33 A;  3MH5 A;  2AFQ B;  1P2J A;  1W7G H;  2PR3 A;  1S6F A;  1NRN H;  3A8D A;  2JET C;  3LPR A;  1VIT H;  2BD2 A;  4CRD A;  3GY6 A;  1XMN B;  1NTP A;  2FOG A;  1YLN A;  5FAH A;  1ARB A;  4SGA E;  2WUB A;  1L1G A;  3A89 A;  4GHQ A;  3U1J B;  4BAK B;  5EOK A;  2ZTX A;  1TPP A;  2ZGJ A;  4AOQ A;  3BTH E;  3RXM A;  2HRV A;  5A09 A;  1ELF A;  3AK5 A;  3OX7 U;  2CN0 H;  5JDU B;  1UTK A;  1T8O A;  3HKJ B;  1C2J A;  2ZGC A;  1HFD A;  1B0F A;  1A46 H;  1GVK B;  2GZ7 A;  3MHW U;  3LGY A;  5EW2 H;  1A0J A;  2PKA B;  4MPX A;  2JH6 D;  3QN7 A;  1WQS A;  1XUH A;  1BTU A;  1C1W H;  1CU1 A;  3V12 A;  3QLP H;  2ODY B;  3UOP A;  2VWM A;  2TPI Z;  1AIX H;  2PUX B;  3L33 A;  5LPE A;  2PTC E;  3KL6 A;  1GI3 A;  1GDU A;  2AIP A;  5DP6 A;  2BZA A;  1CHO F;  1VIT G;  2ZHD A;  1FY3 A;  1AI8 H;  5FPS A;  4GCH G;  1ELT A;  1GG6 C;  4ZXX H;  1SQA A;  4KP0 A;  3M3V A;  5C17 A;  2BTC E;  2CXV A;  1SGE E;  3SUD A;  3F9G A;  4Q7Y A;  3BF6 H;  2GTB A;  2IJO B;  2G4T A;  3G01 A;  3PMH B;  2BMG B;  2HGT H;  3SW2 B;  2HLC A;  3LGU A;  3ZVG A;  1KDQ B;  3SOR A;  3FZD A;  2UWO A;  4R8T B;  4BAN B;  1P01 A;  1S82 A;  3Q00 A;  2ZEC A;  2VIP A;  4WH8 A;  3ZVD A;  5J4Q A;  2STB E;  1DX5 M;  4ISI H;  4WH6 A;  2PTN A;  2NU0 E;  1COW D;  3SJK A;  1TBZ H;  2G55 A;  1AKS B;  5EPN A;  1TRY A;  2G52 A;  1J15 A;  1YY3 A;  1Q31 A;  2YMS B;  1Y8T A;  2P95 A;  3ZZC A;  1V2V T;  2ALP A;  2PKS B;  3FN8 A;  5FHT A;  2D8W A;  2FS8 A;  3SNC A;  1T4U H;  2G51 A;  3P8G A;  4KKD A;  3M35 A;  1UTP A;  3LH3 A;  5IYT A;  1QJ7 B;  4I86 A;  2OBQ A;  3K9X B;  3BTD E;  4E05 H;  2GJG A;  5DO4 H;  1O2Y A;  1TGC A;  1F0R A;  4TT3 D;  2ZDV H;  1ELA A;  1H8I H;  2J98 A;  3RXI A;  4NSV A;  1HGT H;  3A7W A;  3MU4 A;  3BTF E;  1BBR K;  1GBT A;  1SVP A;  2OBO A;  3DSG A;  4UD9 H;  1P02 A;  1Y3V A;  5DSF A;  1BRC E;  3HAT H;  1YLC A;  1WV7 H;  2BB4 A;  2CV3 A;  4NFE A;  2XYA A;  1ZHR A;  2EC9 H;  3SND A;  1UK3 A;  1N8O C;  3SU4 A;  4D7F A;  4KTU A;  2OQU A;  2JIZ D;  2AH4 X;  3N7D A;  1NS3 A;  2FI3 E;  2O9Q A;  4NIW A;  3TJN A;  2BVR H;  4Y8Z A;  4F48 B;  5GXP A;  3RXR A;  4ZHL U;  1NFW A;  1JWT A;  3RML H;  3BTK E;  2PGB B;  3F0P A;  5DGJ A;  2KR7 A;  1GHV H;  2VIO A;  4MNW A;  3GCT G;  4INK A;  5CDF E;  1O3E A;  3PWB A;  4Y79 A;  2JKH A;  4FU9 A;  7GCH G;  1SQR A;  1PPZ A;  1GHX H;  1G3E A;  7EST E;  3PRD A;  1G3C A;  1QFK H;  2ZA5 A;  5GIB A;  3ZZ8 A;  1P2I A;  1LPZ B;  3GDV A;  3GY3 A;  1FI8 A;  1GBH A;  1BB0 B;  4B2A A;  2V0B A;  1IAU A;  2PFE A;  1FPC H;  5JPM H;  1GCD A;  1O38 A;  3ZZB A;  3WWB A;  1TMT H;  2XBX A;  3SQH E;  1OS8 A;  4I31 A;  1TX8 A;  1V2J T;  1ABJ H;  1C1N A;  1MQ5 A;  2I6Q A;  4O9V A;  4JK5 A;  5GCH F;  3BIU H;  1O2K A;  3PV4 A;  4CRC A;  1FAK H;  4UDW H;  1O2M A;  1Z1I A;  1Y3U A;  3UB0 A;  3TVJ B;  4X6P A;  1C5O H;  1QB6 A;  1HAV A;  1P9U A;  3MH4 A;  4WF8 A;  4HFP B;  1E38 B;  3ATK A;  3GY5 A;  3SU6 A;  3BIV H;  1NRP H;  3GS9 A;  3SV6 A;  1W0K D;  5K0H A;  2A7H A;  3M7T A;  1RXP A;  1ACB E;  2WV4 A;  4BAO B;  1C4U 2;  4ABI A;  1P09 A;  1SFI A;  2ZHF H;  5ETX A;  1IOE A;  1P3C A;  4BAQ B;  3KHV A;  2H6M A;  1O3P B;  1QB9 A;  3MO9 A;  1H4W A;  2DE9 A;  2R0L A;  1IHT H;  1BZX E;  4M7G A;  3RXB A;  6CHA C;  1QIX B;  4B73 A;  3EA7 A;  4YM9 A;  1PQ5 A;  1MTW A;  4E06 H;  3ZIA D;  2EI7 A;  1AO5 A;  1O2J A;  3NWU A;  2XRC A;  2TGA A;  3KYF A;  1V2R T;  1FNI A;  8GCH G;  3U69 H;  4CRG A;  1C4Y 2;  4IGD A;  1GBF A;  1GHA G;  3GCT F;  1C5N H;  4F49 A;  1T8L A;  2ZU4 A;  2FOA A;  3LOX A;  4UON A;  1YGC H;  7GCH F;  5EOD A;  2KCA A;  1U6Q A;  1LVB A;  1HJA C;  5FCR A;  1AUT C;  1P2K A;  4MVN A;  4MNY A;  2CF9 H;  4DT4 A;  1QY6 A;  5JB8 S;  3MOC A;  2XC0 A;  5EPY A;  1P10 A;  1LPK B;  2RA3 A;  1S6L A;  4NFF A;  2ZPQ A;  2RFK C;  2Q6F A;  1O5C B;  2VID A;  1V2S T;  1HV7 A;  4MQA A;  5PTP A;  4K1T A;  3A80 A;  4TPY A;  1HRT H;  3M7Q A;  1DST A;  2SGA A;  2ZQ2 A;  2SGP E;  2ZO3 H;  1SPJ A;  4X6O A;  1UCY K;  1RJX B;  2C8W B;  3KID U;  4FUG A;  1C9P A;  2HVY B;  1AD8 H;  3RXE A;  3RC6 A;  4JCN A;  2JH0 D;  5CHB A;  1PQ8 A;  3SNA A;  9LPR A;  4I8L A;  2WYJ A;  1EJN A;  1W12 U;  2ZHQ H;  1MH0 A;  1C1R A;  3PMA B;  3ZYD A;  3TGI E;  4GSO A;  3WY8 A;  4KTS A;  5AHG H;  5E0H A;  3SI3 H;  4AC9 A;  1RGQ A;  4AFQ A;  1UTL M;  2FOB A;  3GYL B;  2FOE A;  1SLW B;  1NRS H;  2TBS A;  1ZJK A;  1MMJ N;  3LU9 B;  2BQW B;  3OSY A;  3BG4 B;  1K2I 1;  5C1X A;  5DP4 A;  2I6S A;  1BIT A;  1FON A;  3PTN A;  1OP2 A;  4TY6 A;  2Y81 A;  3RXS A;  3OY5 U;  1ZML A;  1OWD A;  2SFA A;  3QGN B;  1OOK B;  3ZVA A;  2WPK S;  2IPH A;  2FLR H;  1HXE H;  3TLO A;  1AFE H;  3URE A;  3ZZD A;  3O8B A;  1C5U A;  1QR3 E;  4DGJ A;  3TIU A;  1ZZZ A;  3T27 A;  1MKW K;  1ELV A;  4B6E A;  1C5V A;  1GCT C;  2AYW A;  3EGK H;  5BPE A;  3S69 A;  2XBV A;  4FU8 A;  4MLF B;  1BBR H;  2M2A A;  4Q7X A;  2H9T H;  4Q80 A;  1GHA F;  1P2M A;  3GYM A;  1DUA A;  1UMA H;  1W7X H;  1N6Y A;  4B75 A;  2TGT A;  2BZ6 H;  3UTU H;  1RS0 A;  1YC0 A;  1DFP A;  3PO1 B;  2PKA A;  3F2H A;  2P59 A;  1QBV H;  2TGP Z;  3UQO A;  2C8Y B;  1C5Z B;  1EJM A;  4FUJ A;  2FWW A;  1H8D H;  2FYR A;  3V0X A;  3HGN A;  5B6L A;  3PM3 A;  3FO8 D;  1AZZ A;  5EQQ A;  3MTY A;  1C9T A;  3H5C B;  3OAA D;  4LK4 A;  1A5H A;  4K3J A;  3BEU A;  1LPG B;  3F68 H;  1SGR E;  2J5U A;  2FI5 E;  5E8E H;  2R2M B;  3ZVE A;  4ZHM U;  5F8T A;  3TGJ E;  1AU8 A;  1MBQ A;  1EP6 A;  1LQE A;  5F53 A;  1K1P A;  1HAZ B;  1SC8 U;  1KDQ A;  1LHF H;  5HKK D;  1O3B A;  1Y5B T;  3ATL A;  1MAB B;  1QNJ A;  3S7H B;  2Y5G A;  3MH6 A;  1VGC B;  2GV7 A;  2CMY A;  5F6M A;  1ZR0 A;  1TOM H;  2JET B;  5EGM A;  3U28 C;  4MNV A;  1TYN A;  4DW2 U;  2FOM B;  3OYP A;  1KXC A;  1W10 U;  2A5I A;  2SNW A;  4WXI A;  3NCL A;  3E3T A;  3U8O H;  1EQ9 A;  4JZF H;  4YLU A;  1AKS A;  2CGA A;  4AB8 A;  4Z1M D;  3C1K A;  3EE7 A;  1IQN A;  1SGT A;  1CSO E;  3H09 A;  2G5N A;  2BY6 X;  4B6F A;  4RKO B;  1TE0 A;  4U01 A;  4CH8 B;  1GI6 A;  1E35 B;  3QTO H;  4ISH H;  1ZTJ A;  1HAX B;  1O5E H;  1JRT A;  2QXJ A;  3V7T A;  2NU4 E;  1IQH A;  5HIZ A;  5DP7 A;  8LPR A;  3BG8 A;  1S81 A;  4ISN A;  1ZHM A;  3SJ8 A;  1O2Z A;  1SMF E;  1EAW A;  2GT7 A;  1O2U A;  1P04 A;  5FXL A;  3UNQ A;  1OXG A;  2CHA B;  3VGC C;  1L2E A;  1C5T A;  1NES E;  1IQJ A;  2OC8 A;  1WOF A;  1GG6 B;  3F6U H;  2OTV A;  3T26 A;  1D3P B;  1SQT A;  4ZCN A;  4D8N A;  4DY7 B;  1GBJ A;  3FP8 E;  3GDU A;  3SO3 A;  3MU1 A;  1ETT H;  4X0W U;  1IQF A;  1Y3W A;  2QF0 A;  1A7S A;  3F9F A;  3FP6 E;  2ALV A;  1PFX C;  2XCN A;  3K6Y A;  2F9N A;  4H6T A;  3GDS A;  1K1I A;  1WSS H;  2ODP A;  1UCY H;  4JYU H;  7LPR A;  1GVZ A;  3OFN D;  2A2X H;  1DS2 E;  2W5E A;  3DA9 B;  2BDC A;  2AIQ A;  5CHA C;  3DSP A;  2G5V A;  1SLX B;  1TRN A;  1PPG E;  4I8G A;  5EXN A;  1HNE E;  1K1L A;  2EEK A;  1VZQ H;  1C1M A;  1QGF A;  3D23 A;  2G81 E;  2P93 A;  2C3S A;  2A32 A;  4OGX A;  1ELG A;  2RDL A;  1FIW A;  1A5G H;  3STI A;  3VPK A;  1Y3Y A;  4TPI Z;  1MTV A;  3O8R A;  1MD7 A;  2VIQ A;  3MNC A;  4WME A;  1BQY A;  1WAY B;  4ABB A;  3PLP A;  1AZ8 A;  1P3E A;  3RXA A;  4IC6 A;  5IDK A;  3RM0 H;  4ABA A;  3LH1 A;  4FXG H;  1D3T B;  1UVS H;  3PO1 C;  4NA8 A;  2WYG A;  3LGI A;  4JZ1 A;  5A0B A;  4EST E;  1SHH B;  2BXU H;  2F3C E;  3ENS B;  5FBE A;  2ZPR A;  1A3B H;  2THF B;  2QE7 D;  1SLV B;  5EXL A;  1A5I A;  3TNS A;  3NXP A;  1G2L A;  3ZVF A;  3S9B A;  3AW1 A;  1C1V H;  1L4Z A;  3Q3X A;  1K9O E;  1MKW H;  2GDE H;  1C1T A;  1CHO G;  5DP3 A;  3KQD A;  1P9S A;  2G4U A;  1XUG A;  3MO6 A;  3SJI A;  1EKB B;  2B5T B;  2FOC A;  4Y10 E;  2ULL A;  3NUM A;  4FUH A;  4MDS A;  2ZHE H;  5C0T A;  5GDS H;  2KCO A;  1C5S A;  1W0J D;  1N8O B;  4YLQ H;  1GDQ A;  3SGQ E;  2OQ5 A;  1LVM A;  3MMG A;  3AVZ A;  3MU0 A;  4MPV A;  5JBT A;  1T8M A;  2EI6 A;  1TX7 A;  2JJ2 D;  1ZTL A;  1JIR A;  2QGR A;  4A92 A;  1ETS H;  1LO6 A;  1OWJ A;  4X8U H;  5T6D A;  4YT6 H;  5L2Y H;  1VGC C;  3RC5 A;  4YT7 H;  3PTB A;  1EZX C;  1BRU P;  1BTY A;  2J95 A;  2Q1J A;  2OC1 A;  2P94 A;  2STA E;  3MNS A;  1HPG A;  2ILN A;  2QXI A;  2ZHW H;  1TGN A;  2PUQ H;  3SV8 A;  3BTQ E;  5T3H A;  1FAX A;  1UHB B;  1HAY B;  5C5N A;  5C20 A;  3A7T A;  1BCU H;  2ZCK P;  3TPI Z;  1YF4 A;  1O5D H;  1KIG H;  3QO6 A;  4D76 A;  1KXA A;  1WTH D;  1A2C H;  3B9F H;  1G9I E;  2VIW A;  2Y6T A;  4IN2 A;  3OEH D;  1LHD H;  1CHG A;  2ZDN A;  1QCP A;  3DHK H;  2F9O A;  3EA8 A;  1UVU H;  1EAU A;  3M5N A;  1EOL A;  3BEI B;  1H9I E;  2FLB H;  2WIN I;  1O2W A;  1A0H B;  1OP0 A;  2FX4 A;  4ABH A;  2ZF0 H;  4ASH A;  2KZ4 A;  1FY1 A;  4IW4 E;  4X6N A;  2K0Q A;  2BD8 A;  2BD9 A;  1CGJ E;  2RA0 A;  3FOA A;  4JZD H;  2CHA C;  4FOU C;  1EST A;  2V7Q D;  1W11 U;  3DT0 H;  2FOD A;  4XE4 A;  4Y7A A;  1VJ9 U;  3PRB A;  4FUD A;  1TNL A;  1F0T A;  3EST A;  2BD7 A;  4FU7 A;  4RSP A;  6CHA B;  3BTM E;  4BAM B;  4XRN A;  1O5G H;  1QRX A;  1O3D A;  7KME H;  1JIM A;  4K1S A;  3TH4 H;  5G4B A;  1TRM A;  1OHH D;  6GCH F;  1AMH A;  2YOL A;  1TMB H;  1BTX A;  1ESA A;  3PYH A;  3P8F A;  4YZU A;  2ZIQ H;  5FPY A;  4Y11 E;  1AVW A;  1SGC A;  2IJD 1;  3GIS B;  3PV5 A;  2VVV A;  2YNB A;  1S85 A;  1ZGV A;  3IG6 B;  3DUX H;  1C5X B;  2AGG X;  4XFQ A;  2R9P A;  2XW9 A;  1WUN H;  1HJA B;  2GMT C;  1YPK H;  3W95 A;  4F4O C;  2SNV A;  5B6O A;  5EXM A;  3RXT A;  1X7A C;  4E7R G;  1QL9 A;  4X2V A;  2XWA A;  1ESB A;  2K8I A;  3MFJ A;  3RXK A;  4J2Y B;  3UFA A;  4FUB A;  1GI1 A;  1CO7 E;  3VG8 A;  5GCH G;  1KYN A;  3F2G A;  4DUR A;  1WQV H;  2Z9L A;  1NZQ H;  1B7X B;  1O2Q A;  2Q6G A;  1GMD F;  3S9C A;  4MPU A;  5TCC A;  4AG2 A;  4BOH A;  2ZDM A;  1TBR H;  4X2X A;  2A4R A;  4OS2 A;  2G8T A;  2LNC A;  1SB1 H;  4ZUH A;  2A7C A;  4TYD A;  5BRR E;  3MYW A;  1AB9 B;  1TB6 H;  1SR5 C;  4ZKS U;  5A0C A;  1H8E D;  4X1S U;  1GBD A;  1XVM A;  1TNK A;  2QYI A;  2ZDA H;  2WPJ S;  3SBK A;  5GJ4 B;  5HMA A;  1O2X A;  2ANY A;  3SU1 A;  1RRK A;  5EST E;  4D9Q A;  2V3H H;  3SI4 H;  1BMN H;  4Q2K A;  1EZU C;  3E0N B;  3P8N A;  4B2B A;  1IHS H;  5A8X A;  2W6I D;  3RMN H;  3GY8 A;  1P11 E;  1IQK A;  3RXD A;  1TNG A;  2H9E H;  2EY4 C;  4ABE A;  1O31 A;  3RU4 E;  3TK6 A;  4AN7 A;  2ZNK H;  5FL7 D;  1O32 A;  1TAL A;  2PSX A;  3T28 A;  5KEC A;  3UWJ H;  1GCT B;  2AMP A;  2P3T B;  2V3O H;  2Z6B D;  1PQ7 A;  3UWI A;  3SJ9 A;  2BXT H;  1KXB A;  1CGI E;  3KQC A;  2C8Z B;  1HIA B;  1SOZ A;  2TRM A;  1UTQ A;  2ZP0 H;  3A85 A;  8EST E;  4ZKO U;  4YOG A;  2W7U A;  1GHY H;  2BX3 A;  1BA8 B;  1HAI H;  2VNT A;  3UQV A;  1QL8 A;  1GBK A;  1W3C A;  5CE1 A;  4UFE H;  1T4V H;  1SI5 H;  2ANK H;  4OS4 A;  2EQN A;  3SV9 A;  1DUE A;  1YPG H;  1O5A B;  1ELB A;  1FMG A;  3EYD A;  1MTU A;  3ZZ3 A;  1THP B;  2F9V A;  5L2Z H;  3ZZ5 A;  4CH2 B;  2BM2 A;  4BTU B;  3RXF A;  3R0F A;  4GUX A;  4HTC H;  4X8V H;  1ZMJ A;  1HXF H;  3ITI A;  3M37 A;  1W0Y H;  3B8J A;  3A7Y A;  3NK8 A;  3DCL A;  3A8C A;  1LQD B;  4AYY B;  3GCH C;  1O3G A;  3ATM A;  3ZZ6 A;  3M61 U;  3O8C A;  1NT1 A;  2BOK A;  1BMM H;  3BTW E;  1S6H A;  3HGP A;  2O8M A;  3A7X A;  3TJV A;  4ZKN U;  1TA2 A;  3SYJ A;  4A1X A;  1DLE A;  1B5G H;  2ASU B;  3RDZ A;  3SU2 A;  1CQQ A;  1Q2W A;  3RUO A;  4DII H;  3LIW A;  2XXL A;  2EST E;  3ZZ7 A;  1F7Z A;  4WMD A;  3RXL A;  1MCV A;  1XKB C;  5HM2 A;  4ZKR U;  1SGD E;  1OKX A;  1E1Q D;  1SQO A;  3P95 A;  3U1I B;  2ZCH P;  1S83 A;  1MTN B;  2C90 B;  3NRL A;  3UNR A;  2PSY A;  4U30 A;  1QA0 A;  2DUC A;  3FZZ A;  2KCP A;  1Y59 T;  2ZKS A;  1L4D A;  3PLK A;  2C4F H;  1ZGI A;  2A7J A;  2FXR A;  2UUY A;  1YCP M;  1GMC F;  1F5L A;  1DT2 A;  3D49 H;  4X8S H;  3I77 A;  1B0E A;  5EG4 A;  1KXE A;  5HIY A;  5JBC S;  3RP2 A;  3TH3 H;  4NZQ A;  1V2W T;  1O0D H;  2KAI B;  1HLT H;  1ZLR A;  1EZQ A;  2Z9I A;  3SNB A;  2FZZ A;  1C2D A;  1NU7 B;  1QL7 A;  1J14 A;  2VU8 E;  3LON A;  2OP9 A;  2XWB I;  4X1N U;  3IWM A;  2PGQ B;  1F5R A;  2ZFR H;  1NFU A;  1P0S H;  5JYI A;  3CS7 A;  1AHT H;  1W0Z U;  1Y3X A;  4IMZ A;  1FJS A;  2WPI S;  4I8K A;  3VGC B;  1E0F D;  1LKA A;  1V2U T;  3QDZ B;  3AAV A;  3NZI A;  1TNI A;  1EX3 A;  3HK6 B;  1C1U H;  3QGJ A;  4JZI A;  1O2G H;  2ZU2 A;  4ZRO A;  4ZMA H;  1AB9 C;  2BD5 A;  6EST A;  4A1V A;  2XBW A;  5AFY H;  3LT3 A;  4B2C A;  2AEI H;  1HJ9 A;  1SL3 A;  3OY6 U;  3TU7 H;  2WZQ A;  3NPS A;  2BLO A;  1DE7 H;  3OTJ E;  1MKX K;  3E0P B;  1BTH H;  1PPB H;  2F9P A;  1O35 A;  1IQG A;  1NFX A;  3SQE E;  1BMA A;  3VXE H;  1KMH B;  3A88 A;  4P00 A;  4XBC A;  3RXV A;  4NIV A;  2HWL B;  5CHA B;  1SGI B;  2AGE X;  2ZFT A;  3CNR A;  3VB7 A;  1GDN A;  2GZ9 A;  1UHB A;  1Z1J A;  1BML A;  1BRA A;  2BYA X;  1O3K A;  3HK3 B;  2HVX A;  1GBB A;  3M5O A;  2VWL A;  4RKJ B;  2WPL S;  5FCK A;  1Z6J H;  2NWN A;  4CRA A;  1VCW A;  3KNX A;  3E6P H;  4RN6 A;  1SLU B;  4VGC B;  3E16 B;  1TAB E;  2C93 B;  1O3N A;  4AB9 A;  2IPQ X;  4JYT A;  4NA9 H;  4H6S B;  2AGI X;  1Z8R A;  1TGT A;  3ZZA A;  2PLX A;  2GCH G;  1XUK A;  2CK3 D;  5EQR A;  1GVL A;  2FDA A;  6LPR A;  1K21 H;  2IOT A;  4B76 A;  2O8T A;  1SGY E;  1BDA A;  3SU0 A;  5I25 A;  3EE0 B;  2H9H A;  3SUE A;  5AFZ H;  3A8A A;  1GL0 E;  1LHG H;  1V2K T;  1V3X A;  1OPH B;  4GAW A;  5C3N A;  3QTV H;  4DG4 A;  1AWF H;  4DIH H;  1L0Z A;  1NM6 A;  2Z3E A;  1UTM A;  4FET A;  1ARC A;  1F0U A;  3CS0 A;  1TIO A;  4NIY A;  4Y7B A;  1FN6 A;  1GBC A;  1XVO A;  3UR6 A;  3VEQ B;  3WW7 A;  5DJ7 A;  2VH0 A;  1EUF A;  2R0K A;  1O3I A;  1MD8 A;  5EJL A;  3K2U A;  3PB1 E;  2OUA A;  1TLD A;  1HAO H;  1CT0 E;  3OTP A;  4P02 A;  2B0F A;  3TNT A;  4OM9 A;  2TGD A;  1MZA A;  1YLD A;  3ATW A;  4H42 U;  2ZGH A;  3VB6 A;  4NWL A;  2GCT C;  1EB1 H;  4CBO A;  2L74 A;  4Y6D A;  5DP9 A;  1E1R D;  4Y71 A;  1VR1 H;  2ZFF H;  1YP9 A;  5FX5 A;  2FIR H;  1MTN C;  4AGK A;  3L3T A;  3T5F H;  1UTJ A;  4OS6 A;  4J1Y A;  2H1U A;  3FP7 E;  1DWC H;  3SOS A;  2CJI A;  1UVT H;  4ACA A;  1KSN A;  1YCP K;  1ZPZ A;  1E34 B;  1NRQ H;  3SUF A;  3A87 A;  5GPI B;  3MQK C;  4NGA H;  3BTE E;  1T32 A;  2J94 A;  3ATI A;  1C1O A;  1IQE A;  3A8B A;  1PPC E;  1G30 B;  4WVP E;  3UNS A;  1O34 A;  1P05 A;  5HYO A;  1CA0 C;  2P8O B;  2GCH F;  2ZCL P;  1TOC B;  3ZVC A;  3NKK A;  2Y5H A;  2QXG A;  2BVX H;  3RU4 D;  4IN1 A;  1PJP A;  3MU5 A;  1DVA H;  4CHA C;  3Q3Y A;  3M5M A;  2QAA A;  2BDA A;  3KQ5 A;  2G00 A;  4Q4L A;  1VCQ A;  1AY6 H;  4NCY A;  5ESB A;  1AND A;  3KCG H;  1TPO A;  1DWE H;  5J4S A;  5E2P A;  3LC3 A;  1HAG E;  3UPE A;  1WXR A;  1QRW A;  4JYV H;  1C1Q A;  1F92 A;  4TY7 A;  3WWF A;  3Q77 A;  5IK2 D;  2J97 A;  1YM0 A;  5GND A;  3O8D A;  2WSS D;  1XX9 A;  3F1S B;  2B8O H;  1P8V C;  3AAS A;  3BV9 B;  1D6W A;  1HIA A;  1FDP A;  1UO6 A;  1ZRB A;  5A8Y A;  1SGF G;  3URC A;  4IMQ A;  2J4I A;  3BEF B;  3PV2 A;  4TWW A;  4MNX A;  1KLT A;  4X1P U;  2GMT B;  4X1R U;  1A3E H;  1LHE H;  1EXF A;  2PHB A;  2Z9K A;  1TA6 A;  2PW8 H;  3PLB A;  2ZQ1 A;  4RI0 A;  3JZ1 B;  2F83 A;  1QRZ A;  1BTP A;  1TQ7 B;  3RC4 A;  3BSQ A;  2BY9 X;  1Q3X A;  1Z8J B;  1RTL A;  3RXO A;  1E79 D;  3RLW H;  1MKX H;  2BLQ A;  2OC7 A;  4Z0K A;  3UY9 A;  1YWU A;  1GBE A;  1HB0 B;  4VGC C;  4UFD H;  4MPW A;  3SV7 A;  5JB9 S;  4XBD A;  2A0Q B;  4DVA U;  3ZV9 A;  3V13 A;  4JMY A;  4Z6A H;  4B1T A;  2FYQ A;  3AAU A;  1EJA A;  1CBW B;  1K1O A;  4YES B;  2VGC B;  5JBB S;  4AYV B;  5HM9 A;  1ZJD A;  1L1N A;  2AMD A;  1BHX B;  1GI2 A;  2F9U A;  4QT8 C;  4RT1 A;  1OX1 A;  1K28 D;  1P2O A;  4KGA A;  1DXW A;  4DT7 B;  2BLW A;  2W3K A;  1ZPB A;  2ZU3 A;  3UAI C;  1O5F H;  1WTG H;  2KCY A;  1THR H;  1G3B A;  2D2D A;  1V2O T;  2BDY A;  2J2U A;  1C2I A;  2D26 C;  1MU6 B;  4LXB H;  1SGN E;  1V2Q T;  2BY5 X;  1QJ6 B;  1CT4 E;  2OXS A;  1NY2 2;  3V3M A;  1IQI A;  1QBO A;  1YPJ H;  2A1D B;  1A61 H;  3GY7 A;  4JZE H;  4ABJ A;  1P06 A;  3Q3K A;  5EW1 H;  5DP8 A;  1PYT C;  2Z9J A;  3RXQ A;  1KTS B;  2M5T A;  3P70 B;  1FUJ A;  1O2O A;  1NBM E;  5EJ1 A;  5E0J A;  3KF2 A;  1OWI A;  2PWX A;  2BQ6 B;  6GCH G;  5DG6 A;  1QBN A;  1LHC H;  3H7T A;  1TPS A;  1DAN H;  2AS9 A;  1DIC A;  2DE8 A;  1T7C A;  2JH5 D;  4TSF D;  4I32 A;  1FY4 A;  3U8T H;  1CA8 B;  1GI8 B;  3CEN A;  3JZ2 B;  1J17 T;  1MTS A;  5E0G A;  2KAI A;  1OWK A;  4U2W A;  2A31 A;  1GHZ A;  1Y5U T;  1NO9 H;  3KQB A;  3T62 A;  1W2K H;  2XND D;  3HPT B;  3MNX A;  1O2P A;  4UFG H;  2J9N A;  2VVC A;  1DXP A;  3LJO A;  1V2M T;  4CRB A;  3ODF A;  4ZXY H;  1QA7 A;  1C5P A;  1ZSJ A;  2VVU A;  1GMD G;  1BOQ A;  1WU1 A;  1ETR H;  4B71 A;  1D4P B;  2Y7Z A;  4A1T A;  2ZTY A;  3RMO H;  3M7U A;  2A4Q A;  3GCH B;  1FPH H;  1O3L A;  2P8O C;  4ZH8 A;  3M5L A;  1P57 B;  3KN2 A;  5KGO A;  1AFQ C;  2OC0 A;  1C5W B;  3T2N A;  2Z3C A;  4E7N A;  1O30 A;  1YCP H;  5DN6 D;  1C1S A;  1HCG A;  3DFJ A;  1V2N T;  2NU1 E;  2VIV A;  1HJ8 A;  4FUF A;  3AW0 A;  2XC4 A;  4THN H;  1ZSK A;  1C2L A;  1GJ8 B;  1GMH F;  1XXD A;  1SGF A;  1GJA B;  2K1Q A;  2QCY A;  1QJ1 B;  2WV9 A;  4GHT A;  1OWE A;  1ZSL A;  3ELA H;  1SHY A;  2BOH B;  1C2K A;  3MU8 A;  1C1P A;  1CGH A;  1LVY A;  2SGD E;  3VB3 A;  1O3F A;  3MI4 A;  1MAY A;  3P92 A;  3VB5 A;  1AWH B;  1TPA E;  4HG6 A;  1KTT B;  3E91 A;  1TBQ H;  2ZC9 H;  1GI7 B;  1GJD B;  5E2O A;  2H2Z A;  1G3D A;  1O3H A;  3PWC A;  2GZ8 A;  3MO3 A;  5GWZ A;  4KTC A;  2HLD D;  3RM2 H;  3OU0 A;  3URD A;  5SGA E;  1Z6E A;  2UUF B;  3U8R H;  2A5A A;  2BLV A;  2P3F H;  5LPF A;  1LVO A;  1ZTK A;  2A2Q H;  4ZAE A;  3A7Z A;  4HGC A;  2ZFQ H;  4R0I A;  3N7E A;  4A6L A;  2JJ1 D;  3DSO A;  4Y0Y E;  3FKS D;  1GI0 A;  1JMO H;  2ZDL A;  4K5Z A;  5T6F A;  1ZRK A;  1YPL H;  2W7S A;  1D3Q B;  2FP7 B;  4AG1 A;  4M9F A;  4K8B A;  5HGG A;  4Y0Z E;  3E90 B;  4AGJ A;  2XOK D;  5C1Y A;  1KXD A;  1N1L A;  1CBW C;  2B9L A;  2Q6D A;  1C2E A;  1V2P T;  3RXC A;  2VGC C;  5F03 A;  3P17 H;  1SG8 B;  3DD2 H;  2L6O A;  1O5B B;  1SSX A;  1F0S A;  3QUM P;  1O2V A;  3H7O A;  1TAW A;  1GI5 A;  4BTI B;  5KED A;  4INH A;  3W94 A;  1O3M A;  2GVF A;  5JBA S;  1NRO H;  5EU8 A;  4YOJ A;  1P2N A;  1GHW H;  1D6R A;  2B7D H;  3SUG A;  1IQM A;  1OSS A;  1O37 A;  1AE8 H;  1EPT B;  2Z9G A;  3STJ A;  2O8U A;  1FZZ A;  2ZZU H;  2ZG0 H;  1K22 H;  1ZMN A;  3GCO A;  4Q7Z A;  1RIW C;  2ZI2 H;  1O2S A;  1K1N A;  2P16 A;  2QF3 A;  3D62 A;  1S0R A;  1VCP A;  2R3Y A;  1XUI A;  2J92 A;  3FAN A;  3W1E A;  1O3C A;  3M36 A;  5LGO A;  1KXF A;  1Y5A T;  4LZ1 H;  3BTT E;  1EAT A;  1INC A;  1W13 U;  2LP6 A;  1THS H;  1FN8 A;  4HZH A;  1EOJ A;  4SGB E;  4XBB A;  5EJZ A;  5FPT A;  1DM4 B;  2VWO A;  1GMC G;  2CF8 H;  2BDI A;  1GPZ A;  1VIT F;  5F8X A;  1O2I A;  1FQ3 A;  3RU4 T;  1MU8 B;  2ZEB A;  1D9I A;  3B23 B;  4GCH F;  4O3U A;  1UK4 A;  1PPF E;  4JK6 A;  1MBM A;  2FM2 A;  3LJJ A;  5C67 A;  1N6X A;  1GJ5 H;  2XNI A;  1LTO A;  4YOI A;  1KLI H;  3S9A A;  4AZ2 B;  3SN8 A;  1ELD E;  5C1U A;  1ID5 H;  1SFQ B;  1ZPC A;  4WXV A;  2QC2 A;  4MTB A;  2OD3 B;  8KME 2;  1C4V 2;  5L30 H;  2FOF A;  4ZHA A;  1PYT D;  3T25 A;  1TWX B;  2A5K A;  4F55 A;  2PV9 B;  4X2W A;  3SGB E;  3SZE A;  1SBW A;  2FS9 A;  4WJG 2;  3F9H A;  4NA7 A;  5K7R A;  2WHX A;  4ABF A;  2SGE E;  1GBM A;  3LGV A;  3GCN A;  5DK1 A;  1GHB G;  1HDT H;  1GI9 B;  1PQA A;  2QF4 A;  5EQS A;  3TJO A;  4I7Y H;  2HPQ H;  1AGJ A;  1EB2 A;  1DWD H;  1HBT H;  3UIR A;  4Q63 A;  1BHX F;  2SGF E;  1AVG H;  2P3U B;  1ABI H;  1NC6 A;  2ANW A;  1T31 A;  5I46 H;  4K69 A;  3SGA E;  1OWH A;  1J9C H;  2FTM A;  2C8X B;  3C27 B;  2Z3D A;  1O2H A;  1T8N A;  1DLK B;  4AFU A;  1C2F A;  2FEQ H;  2GCT B;  1TFX A;  2QA9 E;  2H5C A;  1XKA C;  2Y7X A;  3A84 A;  4UEH H;  5FBI A;  1LKB A;  1YYY 1;  1A1R A;  1AE5 A;  4FUE A;  3T29 A;  1YPH E;  2W6J D;  1BIO A;  3GY2 A;  1GGD B;  2GP9 B;  4IBL H;  3U9A H;  3KGP A;  1DY9 A;  2O8L A;  1TQ0 B;  1EZS C;  2GX4 A;  2ZGB H;  1YBW A;  2LPR A;  2FI4 E;  3N99 A;  1TX6 A;  3E1X B;  3P6Z B;  4CR9 A;  1W8B H;  1O2N A;  1O2R A;  1GBI A;  1P12 E;  2ANM H;  2Z94 A;  3L6P A;  4CR5 A;  1QTF A;  3SNE A;  3KEE A;  2HAL A;  3VXF H;  2O8W A;  1UTN A;  1CA0 B;  4OS5 A;  5TJX A;  3TGK E;  5A0A E;  3EDX B;  4BAH B;  1AUJ A;  3TK5 A;  3QX5 H;  1NBM D;  1WYK A;  1P2Q A;  2OCV B;  1OYT H;  2OLG A;  3GOV B;  4WWY A;  1V2L T;  2BVS H;  3OEE D;  4CHA B;  2BD4 A;  1O3J A;  1VKY A;  1BTZ A;  3FAO A;  2QF5 A;  2XCF A;  3D65 E;  1G32 B;  2UWP A;  2NU2 E;  3F3B A;  1KY9 A;  2BY8 X;  2AER H;  3RXP A;  1C5M D;  1GHB F;  4OS7 A;  1NPM A;  5H4I B;  2PP6 A;  1HAH H;  5TCA A;  1FY8 E;  4X6M A;  5LPR A;  2YMS C;  1AN1 E;  2F91 A;  2YNA A;  4NSY A;  1XUF A;  2A4O A;  2EI8 A;  1NN6 A;  1UW7 A;  3GY4 A;  2PKS C;  4B74 A;  3M3T A;  1TMU H;  1SGP E;  1DDJ A;  2FES H;  1H1B A;  1C2G A;  3EAJ A;  3RMM H;  1C5L H;  1EPT C;  1O2T A;  2KX4 A;  5HXF A;  1UJ1 A;  2ZTZ A;  4LZ4 B;  1J16 A;  5A2M H;  1YPH C;  4NIX A;  2J38 A;  3VB4 A;  2FPZ A;  1K1M A;  2BDB A;  1BMF D;  3SZN A;  4BNR A;  1SOT A;  2HNT E;  4IS5 A;  1AQ7 A;  1G36 A;  5L6N H;  5F8Z A;  1CT2 E;  1XM1 A;  4UE7 H;  1FLE E;  3SHA H;  1BBR E;  4K1E A;  1GI4 A;  3OE7 D; 
#chains in the Genus database with same CATH homology
 3MQK C;  2EY4 C;  3U28 C;  2RFK C;  2V3M A;  3UAI C;  2HVY B;  2EQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...