3MQKC

Cbf5-nop10-gar1 complex binding with 17mer rna containing aca trinucleotide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
75
structure length
75
Chain Sequence
MKRLGKVLHYAKQGFLIVRTNWVPSLNDRVVDKRLQFVGIVKDVFGPVKMPYVAIKPKVSNPEIYVGEVLYVDER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA pseudouridine synthase B
publication title Structural and functional evidence of high specificity of Cbf5 for ACA trinucleotide.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
total genus 12
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2010-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.230 Mainly Beta Beta Barrel Thrombin, subunit H Probable tRNA pseudouridine synthase domain 3mqkC00
3U28C 3UAIC 2RFKC 2V3MA 2EY4C 2EQNA 2HVYB 3MQKC
chains in the Genus database with same CATH superfamily
1JMOH 1C2MA 1HLTH 1HCGA 2W7SA 4DOQA 1MCVA 2GCTC 4MNVA 3KL6A 5A0BA 4CBOA 1GJ6A 2GDEH 3RU4T 2ZFQH 3ATKA 1P9UA 1OHHD 4F4OC 1S85A 4ABIA 5KGOA 1HIAA 3UTUH 1H8DH 4FUHA 1PPCE 1LKBA 4WH6A 2JJ2D 4I8LA 1KYNA 2BDBA 2KAIB 1AD8H 4K1SA 1TAWA 4JYUH 1GL1A 2TGPZ 2VIVA 2LELA 4P00A 5FCRA 3PB1E 4I7YH 1O2HA 3EYDA 2LP6A 3LH1A 5EXLA 4FUCA 4AB8A 1LVOA 3U69H 5CDFE 2WSSD 2PTNA 4RKOB 3LU9B 1GDQA 1ZJDA 2ZU3A 2HWLB 3EA8A 2CF8H 4X8VH 3M61U 1FAXA 1PPBH 3MU4A 1P05A 3QGJA 1GJAB 1SFQB 1DDJA 1RJXB 4NFFA 3VXEH 2QCYA 1HAGE 1SHHB 2C8WB 8LPRA 6CHAC 2JETB 2WZQA 2FOBA 1EOLA 1Z8IB 1G30B 3LC3A 1N6YA 4AZ2B 2YMSD 5J4SA 1HAVA 2B8OH 3BTQE 1J9CH 4U2WA 3SNDA 2J94A 2ESTE 2BOHB 1GBDA 3T29A 1G37A 1DLEA 3M5LA 5DJ7A 2F9NA 1C5QA 3DUXH 3RXCA 1KDQA 1BA8B 1EAXA 1G9IE 1LHCH 1NRPH 2OBQA 4JK5A 1Z8JB 3A82A 3GCOA 4Q80A 1NFYA 4J2YB 1P2MA 2WPKS 3W95A 2XNDD 3QO6A 1Q2WA 1D3PB 3GY2A 1SSXA 1C2DA 2PTCE 2Q1JA 4RT1A 2C8ZB 5AHGH 7GCHG 4HG6A 1IQFA 1RD3B 3S7HB 2V0BA 1BTWA 1DXPA 1TNIA 3A7ZA 4LZ4B 1C5ZB 2BD2A 2BVXH 1UK3A 4O3TA 2TGAA 2SGPE 3V7TA 1MD7A 1TMUH 2H5DA 2AFQB 1TABE 1H9LB 2SNWA 3RU4D 5F8ZA 4JZEH 1P2OA 2FS8A 1PPZA 1XUJA 3RXSA 2BD4A 2KZ4A 3RXUA 3TGJE 1KIGH 1KXCA 2XOKD 3AVZA 3UFAA 5DP5A 5IDKA 3MH5A 2B7DH 2SGQE 3FO8D 1O2UA 3KQCA 4XBBA 3SN8A 1QL7A 1YCPK 2A2QH 3MWIU 1SGRE 1UK4A 4BAOB 2F91A 3I78A 3GY7A 3E0PB 3OEED 6CHAB 1Z1JA 1DM4B 2FOFA 2UWLA 1GI8B 3HK6B 3ZZBA 1Y5AT 1YPHE 3R0FA 4X2YA 2D2DA 1SFIA 1O3NA 1QBOA 2BD8A 3VPKA 3B8JA 4TWYA 4Y0ZE 1GL0E 1C1NA 1GBBA 1O5DH 4TPYA 5GDSH 3ZVBA 1LKAA 1L2EA 2OTVA 4GAWA 1MTSA 4KELA 3O8CA 1DY9A 2IPHA 3PMJA 2Z3CA 1SVPA 1AUJA 4AYVB 1SQRA 4CH2B 5JBBS 5JBTA 1GHXH 1C9PA 3H09A 1ABJH 2DE8A 1GMCF 3V13A 1W0JD 4IN1A 3QDZB 1FY4A 1Z6EA 2GMTC 1LO6A 5C1XA 3VGCC 4F49A 4E7NA 3UREA 1BZXE 2QIQA 2ZGXH 3ZVAA 1ZTLA 2QGRA 3ZV8A 5HXFA 4WXIA 2V3HH 4RKJB 3SV6A 2CF9H 4ABGA 3S9BA 1CGHA 2PKSB 2G5VA 3SGAE 3M3TA 5HKKD 1C1PA 2ODPA 2ODYB 5H4IB 2H6MA 4CR5A 3OU0A 3BF6H 1DWBH 1P03A 2VBCA 5DP8A 1ESBA 5BPEA 1E35B 3SU3A 3A7WA 9ESTA 1T4UH 3LGVA 3TK6A 1FY1A 5HM9A 4OS2A 1YBWA 2EY4C 1ELAA 1L1NA 1EJNA 2GD4B 2OK5A 1BCUH 2BDCA 1DVAH 1YPMH 2AGGX 1GI2A 1F5KU 2KAIA 2VIOA 2ZTYA 4K2YA 3ZYDA 2R3UA 2XBVA 1GMDF 1CBWB 3ZZ5A 1HAHH 4GHTA 1C5MD 4YT6H 4CH8B 1O5GH 3T25A 2PGBB 3LJOA 1HXEH 3OSYA 5DP6A 5C5OA 3RXLA 1GJBB 2G81E 2VVCA 5AF9H 1BTZA 1XUKA 1NN6A 2D1JA 2WINI 3O8RA 8KME2 2Q6FA 2L6OA 4KTCA 2ZPQA 1O37A 5B6LA 1FNIA 3V12A 1ZTKA 1AKSB 5E0GA 5J4QA 1KMHB 5DP7A 2HNTC 5C1YA 4OS1A 3HATH 1MKXK 1GI6A 3A8AA 4GLYA 1DUAA 4DCDA 2GMTB 2ZI2H 3BTWE 3I77A 4FVDA 1C2GA 2FODA 4BXWA 2IN2A 2J92A 3SU0A 4ZUHA 1XXDA 1C4Y2 2M5TA 1O39A 3RXHA 3M5OA 1GMHF 2AS9A 1O2QA 4XRNA 4OGYA 1P2QA 2RDLA 1GBKA 1TE0A 2FI4E 3FVFB 1O2XA 1KXBA 2Y80A 1VCPA 2FIRH 3FP6E 2HALA 1UCYK 1GVLA 2FOGA 2ZECA 1IQNA 1TPPA 2JKHA 1UTOA 2RDEA 2PUQH 2GJGA 5A8YA 3WWFA 2QF3A 3FKSD 1P0SH 2BLQA 3RC5A 4IGDA 1EATA 3RXVA 1GCTC 5K0HA 3JZ1B 3VB5A 1O32A 1K9OE 4VGCB 2V6NA 1UJ1A 3RXBA 4IMQA 1GHBF 2BX4A 2ZGHA 1DFPA 2C4FH 2HGTH 3KQ5A 2BY7X 3H7OA 1CU1A 3LGYA 1PJPA 2XBYA 3ATIA 5L2YH 1O33A 2VH0A 1P9SA 2BHGA 5A8XA 3PMBB 4Y11E 1O5FH 4TY7A 4WY3A 1GHAG 1A0JA 3RXRA 1DX5M 4ACBA 4ACAA 1OWJA 3FP8E 3QTOH 1W3CA 2SGFE 2JJ1D 1QFKH 3ZIAD 2WV5A 2XC5A 5SGAE 3MMGA 5ESTE 2GZ8A 4Q7XA 5AVDA 3UQOA 3D65E 2Z3EA 1IOEA 2P94A 2L74A 1P11E 3TIUA 5EW1H 1A61H 2CJIA 2FX6A 5EU8A 1WXRA 2BZ6H 4WJG2 3OFND 3E1XB 4ZKRU 3OTPA 4LZ1H 3PLBA 1O2KA 1O2SA 1TGNA 2PLXA 1IQHA 1C5PA 1NESE 1TOCB 2AEIH 2XBXA 3D23A 3FOAA 1C1RA 1Q3XA 3PMAB 1NFXA 1BTHH 2FI5E 4GVUA 3MH4A 2AMQA 2C90B 2HRVA 3T62A 1JIRA 3LPRA 4RI0A 1P3CA 4ZROA 1G36A 4JK6A 1BTUA 1T32A 2BDYA 2KCPA 4AFZA 2ZO3H 1ZPBA 1CT0E 2I6SA 2YNAA 1F5LA 2O8MA 3PROA 3A87A 2XC4A 1RGQA 3E0NB 4BAHB 3EE7A 3U1JB 1A7SA 5CE1A 1C5XB 3BTFE 2KR7A 1WOFA 2STAE 1DS2E 5T6FA 3CENA 2ZFRH 3TH3H 1TX6A 2XWBI 1YCPH 4BTTB 4D7GA 1BITA 1W7GH 2B9LA 4XDEA 1C2HA 2BQ6B 1TGTA 3PLPA 3U8OH 4UEHH 1NTPA 2R0KA 3ZVDA 1GJDB 1V2MT 1DPOA 1YPLH 5JBCS 1SQTA 5KEDA 1AMHA 4ABAA 4FUEA 4MNYA 5EJZA 3DSGA 1OKXA 3RLYH 5LGOA 4JZIA 1LPGB 1G3BA 2NU0E 2Z9GA 1DSTA 1IQLA 2FYQA 1PYTC 1TFXA 4H4FA 4O3UA 3KQDA 1NZQH 4ZHAA 1S83A 3PWCA 1C1SA 4E7RG 3SJ8A 1LDTT 5DO4H 4RT0A 1H8ED 3MU5A 1VKYA 1AFEH 2HNTE 3ZZ6A 4AFUA 3TITA 1SGNE 4WMDA 3BTHE 1EZXC 3RM2H 2EC9H 4Z6AH 1BBRK 1THPB 3DT0H 3GOVB 1UTNA 4QT8C 2ZFTA 3UNSA 3QN7A 1UVPA 5F03A 4NWLA 1AO5A 1PPGE 1WQSA 1QRZA 2OLGA 2ZHFH 4UDWH 4HFPB 3MU8A 1OPHB 3KYFA 2GCHF 1KXFA 1RTKA 1AKSA 3GCTF 2J97A 3NXPA 5CHAC 4BTIB 2GP9B 2W6ID 1A46H 2GGVB 1L4DA 4UFGH 1V2VT 4JCNA 3OAAD 1N8OB 1ZRBA 2ZPSA 1Z7KA 1T31A 1O2YA 2AYWA 3RXQA 1K28D 2ZDKA 1KXEA 2UUKB 2SFAA 2PW8H 4UE7H 2P8OC 2FOMB 1BB0B 1ZPZA 1TNKA 3TK9A 1SGYE 1CA8B 1E37B 1O2PA 3GYMA 4R8TB 2NWNA 1OWDA 1SGFA 3M7UA 4K1EA 3RXTA 8GCHF 3QTVH 5TJXA 1GBCA 1ZHMA 2PSXA 3ODFA 4NCYA 2A4GA 3HPTB 2G4UA 4TPIZ 3Q77A 2ZHQH 3RM0H 1E38B 1F0TA 3RLWH 1WSSH 3PV4A 4J1YA 1LPZB 1WV7H 4RN6A 2XTTB 4K8YA 1EZUC 1RRKA 1DT2A 1ZSKA 3A85A 2SNVA 1TQ0B 3KGPA 2J95A 4TWWA 3SUEA 3CNRA 3M5MA 1JIMA 1V6DA 1TYNA 5E0HA 1O2NA 3BTTE 2WUBA 2NU4E 2W26A 1FQ3A 2ZP0H 8ESTE 1CVWH 1OXGA 2XBWA 4ABDA 5EJ1A 1CA0C 2OCVB 2NU2E 1G3CA 1V2QT 4TY6A 4ASHA 1BJUA 2K0QA 1MKXH 1WTHD 4WWYA 1CE5A 3PYHA 4D7FA 2WYJA 3M3VA 3TJUA 2Z9LA 1P8VC 1ANEA 1W2KH 1C1MA 2FMJA 3QGNB 1FLEE 4ZXXH 1G2LA 3PMHB 1GGDC 1GVKB 1K1MA 2OC1A 2QE7D 4NA9H 2GV6A 3MOCA 1GHWH 4IBLH 1O5CB 5GPIB 1BHXF 4DY7B 2BLOA 5F8XA 1RFNA 1UCYH 5F6MA 2Z9IA 3K9XB 2VWLA 2A7JA 1SPJA 1KLTA 3PWBA 5EQRA 1E36B 3ATWA 5TCCA 1MZDA 4I8HA 1DXWA 1A1RA 3T26A 5JPMH 2UUYA 1Z8GA 1EAWA 2ZDMA 1QQ4A 5EODA 3KHVA 3VFEA 4UFDH 2THFB 5A0CA 3QX5H 5A09A 4RSPA 3SZNA 1P01A 1WUNH 2PHBA 3UNQA 3TH2H 1BTXA 3P92A 4DIHH 2CHAC 1ELVA 5C3NA 3RXMA 2K8IA 1A3EH 1P10A 2FYRA 1S0QA 2VIDA 3RXFA 4NFEA 3RXJA 4CRAA 2ANKH 2AIPA 3RXKA 4MPUA 1BRAA 4ISNA 2BY5X 5DSFA 1FIZA 2Z6BD 3A88A 1ANDA 7LPRA 5EGMA 1XKBC 4ABEA 1VITH 3H5CB 1QL9A 3L6PA 4A6LA 1Q31A 3LGUA 3MI4A 2FOAA 1TBRH 3RXEA 5E2OA 1CA0B 2FWWA 1SLVB 1FY3A 3M5NA 1SGFG 3TGIE 1GI3A 3T28A 5HMAA 5GCHG 1ANCA 2GV7A 1H9IE 1TPOA 1GI7B 3AASA 3BTEE 2O8TA 3TPIZ 2D26C 3DA9B 3SOSA 4B6FA 5HGGA 3D62A 3NK8A 3UR9A 4Z1MD 4UFFH 1SLWB 2QYIA 3GY8A 3MNXA 3V3MA 1QJ6B 2XW9A 1CHOG 1VZQH 2H5CA 3HKIB 1TGBA 1BDAA 2DUCA 4BXSA 1BMAA 4Y7AA 3TK5A 1F0UA 2A4OA 5FAHA 1NFWA 5L30H 1O34A 2A31A 1C5LH 1TMBH 1LVBA 1FAKH 1LVMA 3SU6A 1LHFH 3ZVFA 4MNXA 2FS9A 1P2IA 1UTPA 1HRTH 1QJ7B 5C5NA 1TOMH 1PYTD 2A4QA 1A2CH 4Y8ZA 4WF8A 3LGWA 2QC2A 2LPRA 4X2XA 2GCTB 2P59A 1MTNC 2VWMA 1HPGA 3V0XA 5DP4A 5E0JA 1DICA 3SU4A 3UUZA 1AVGH 1N1LA 5ABWA 2PGQB 1SHYA 4FU8A 1S81A 2W3KA 3ZZDA 1V2PT 3F68H 3BTGE 1CQQA 1FI8A 1UK2A 1J15A 2P3TB 1WQVH 1HAXB 4E05H 1OS8A 4INLA 3KEEA 3ZZ7A 3SV8A 2ILNA 1AUTC 2ZGCA 4FUIA 3SUDA 3GY6A 1MTWA 1YY3A 3O8BA 1K2I1 3S9AA 1FONA 4X6PA 3A80A 3ZYEA 1ELEE 3L33A 4KTSA 4THNH 3URDA 1MTVA 3SNBA 1EFRD 1NFUA 2JIZD 1OSSA 3TGKE 1LHGH 1C1VH 1V2UT 3OTJE 2OQ5A 5HIYA 1MKWK 1BTPA 1YWUA 3M3SA 4GUXA 1BBRH 1C5VA 4CRGA 3AAVA 1ZGVA 4ZXYH 2ODQA 3GS9A 1TA2A 2FTMA 2JH0D 3WWBA 4M7GA 1ZGIA 3SYJA 1QR3E 1NC6A 3TJOA 2Q6DA 3LIWA 2XYAA 3PO1C 4KGAA 4WXVA 2Q6GA 1DOJA 5PTPA 1K1PA 1Z71A 4X6MA 2KM0A 2RA3A 1DUEA 4F55A 3UY9A 3Q00A 3SU5A 1T8NA 1AIXH 2F9UA 1KLIH 2SGAA 1EQ9A 1H8HD 1IQMA 1DWDH 4AFSA 1KY9A 2ZWLH 5EPYA 1ZMJA 1EAIA 3U28C 1GJ7B 1COWD 4X2VA 4GPGA 1GHVH 4X6NA 3ZZ9A 3LJJA 2FM2A 2H1UA 1MTNB 1HAZB 1QTFA 1BMMH 3GY5A 3SJIA 4Q2KA 1C1OA 1DY8A 1NRRH 4ISHH 1UO6A 1SGPE 5C20A 2F9VA 5C17A 1A5HA 1W10U 1W11U 2VGCC 1LPKB 2FOEA 2WPHS 4XD7D 2BZAA 3SJKA 4XBCA 3RXDA 3DD2H 2J34A 4HGCA 2G55A 1DLKB 4Y8YA 3T27A 2AMDA 2TGDA 1EPTC 1GJ8B 5EQSA 4XE4A 1SOZA 1T8OA 1WAYB 3SW2B 1O3HA 3BG8A 2IOTA 3F0OA 1BMLA 1HXFH 1ZSJA 4Q7YA 2GCHG 3UOUA 4I8JA 3U8RH 2XWAA 1ABIH 4OM9A 4NZLA 1GI0A 1VCQA 2FO9A 2PWXA 2P95A 4IW4E 2AIQA 2HPPH 3F0PA 4YTAA 4BAMB 1K1NA 2ZCKP 3K65B 1E0FD 5FPSA 2H9TH 3FZZA 4D9QA 2BXUH 3OEHD 1HAPH 2CN0H 1WTGH 3MH6A 3LGTA 1UVTH 2ZFPH 1HFDA 1ETRH 1ANBA 2ZZUH 1O3IA 4NIVA 4YM9A 1FMGA 3SQEE 3A83A 1TQ7B 3A7XA 1YLNA 3SJ9A 1VITF 1TNGA 1SGEE 3RUOA 3RXPA 1O3JA 4U32A 4AC9A 2FPZA 4H6SB 1BMNH 4Y10E 1OP0A 2VIWA 1BJVA 5I25A 4I8KA 3LC5A 5LPFA 4MPXA 2BD9A 5DPAA 4Q63A 4XFQA 1QB9A 3MU1A 2VVVA 1MCTA 4B6EA 3UOPA 4GSOA 1N6XA 1FY5A 1OYQA 3K2UA 3VGCB 1YGCH 5ESBA 3F9GA 4FUJA 1C1QA 1T4VH 1TA6A 1WU1A 3SI3H 1AFQC 1SI5H 3EA7A 1TWXB 4OGXA 1CT4E 2YNBA 1O2OA 2QF0A 2Y7ZA 3EE0B 3JZ2B 1WDIA 1UCYE 4AORA 2BDHA 1EPTB 1AGJA 4DGJA 2AHME 3SU1A 5DN6D 1EX3A 3T2NA 2O8WA 1QZ8A 3A86A 4ZKOU 2HPQH 3GDSA 3O8DA 1GHZA 2UUFB 5TCAA 4DG4A 1K21H 3F2GA 1UTJA 1B0FA 1Z8RA 3LGIA 3TVJB 1XUHA 1YLDA 4GHQA 3ZVGA 1OYTH 5IK2D 2BD3A 1Y3YA 1QNJA 3ATMA 1MBMA 2Y5HA 1FPHH 3GICB 4MNWA 4Y79A 4FETA 2BTCE 3PTNA 1ZHRA 4X8UH 1FN8A 3PRBA 1GBEA 1JRSA 2WUCA 2AMPA 1D9IA 1C5YB 4WVPE 3AW1A 5GIBA 3SHAH 1QGFA 3EAJA 2ZGJA 2SGEE 6ESTA 1A4WH 1C1UH 1G2MA 3SO3A 3KIDU 3AW0A 3RMLH 3E91A 1GJ9B 1PFXC 3IWMA 3MO6A 2A5KA 4NA7A 5LPEA 1GBMA 2BYAX 1GBLA 2NU3E 4YT7H 3RXAA 3OE7D 2ZNKH 4BAQB 3GISB 3GCHC 1Y8TA 1ARBA 1W14U 7GCHF 1DITH 1HAOH 1PPFE 3ITIA 1HAYB 3LH3A 2ZKSA 1OWHA 4K69A 5C0TA 1HJ9A 2Z3DA 5AFZH 3BTDE 3GY3A 2OD3B 3GY4A 1AVWA 2JH6D 1XUGA 3FP7E 1UW7A 1O3BA 3A81A 1AZZA 4Z0KA 3MNSA 1C2FA 1A3BH 3P8GA 2K1QA 2A7HA 1SQAA 4GCHF 1BUIA 2W3IA 2BLWA 1BRCE 1V2WT 1GCTB 1AB9C 4A5TS 2CMYA 2EEKA 2QV1A 1C5RA 3BTME 3FN8A 4ISIH 4MLFB 4U30A 2OUAA 5EIYA 5GXPA 3A8BA 1NRNH 1M9UA 2Z7FE 1IQJA 2OC7A 1ORFA 1O5AB 3ZZCA 1CGIE 2VNTA 1AZ8A 5HYOA 3KNXA 1L1GA 4K60A 1SMFE 1MKWH 4KP0A 4YESB 1PQAA 2QAAA 4X2WA 3MO3A 4XBDA 5FXLA 1AE8H 2FEQH 5EOKA 2QXGA 3PTBA 4MG3A 3OY5U 1GDUA 4AFQA 4AYYB 2FOHA 1SGDE 1TALA 5DKMA 1SG8B 5JB9S 1K1JA 4B2AA 1QCPA 1GBFA 4E06H 2QF5A 4LK4A 4O03A 3U1IB 1Y5BT 2F83A 4F48B 2WPJS 4XSKU 2FLBH 2YMSC 4CRDA 1J8AA 2C8YB 2PP6A 2UUJB 2WV4A 1P02A 1THRH 1L4ZA 5C67A 2OBOA 1S84A 1GCDA 4DW2U 1W13U 2P16A 1KSNA 1IHTH 1ZTJA 3N7OA 3TU7H 3ZVEA 1EXFA 3MYWA 1BBRE 2VIQA 4KKDA 2PUXB 1XKAC 4X6OA 1UVOA 1XUFA 4JZFH 2EI7A 1HYLA 3MNCA 1C5WB 2ZDNA 3P70B 4MQAA 2AGEX 1OP8A 4ZKNU 1GI9B 1Y5UT 1GBJA 1K22H 4Y6DA 4ASUD 3T5FH 3LDXH 1FY8E 2VJ1A 1AWFH 1HB0B 3SGQE 3ODDA 3TNTA 4A1VA 4Y76A 1Y3VA 3UAIC 4WH8A 2VB0A 3STIA 2KX4A 1AVXA 4HZHA 4OS7A 2BD5A 1WYKA 1O3CA 4AG2A 3QLPH 3C27B 1EPTA 1F2SE 5T3HA 1NROH 1YM0A 2F9BH 1UTLM 1ELCA 2DE9A 4X8TH 2KFWA 1ZYOA 1D3DB 4X1SU 3F2HA 3ZZ4A 3E90B 1GMCG 4BANB 4FVBA 1PQ5A 3RMOH 1C1TA 1TPSA 2Y5FA 1SL3A 1O2IA 4MPVA 4ABHA 1KTSB 1K1LA 4INKA 2R2MB 5G4BA 1IHSH 2VINA 5E8EH 1YP9A 2BDGA 3G01A 2RG3A 4O9VA 4B76A 5B6OA 1QL8A 1X7AC 1TLDA 2F9OA 7ESTE 3N99A 2V3OH 1ETSH 1ELBA 3MO9A 4MTBA 2ANMH 5KECA 1V2JT 5LH8A 3MQKC 3NCLA 1QJ1B 3SJOA 4Q7ZA 1JWTA 3KF2A 1NU9A 4IMZA 2ZDVH 4NSYA 2GT7A 4YXWD 4Y0YE 4AX9H 1MH0A 3IG6B 2VVUA 1TNJA 3PLKA 2OINA 4I32A 1AU8A 5AFYH 2ZIQH 3W94A 5CHAB 1JXPA 5IYTA 1O2GH 5JYIA 4YLQH 5L2ZH 1DANH 3PRDA 2ANYA 2GKVE 4P02A 3QUMP 3A84A 1MU6B 1CGJE 2BMGB 3VB7A 1ID5H 1O3OA 2ZDLA 2QY0B 2P3FH 2ZEBA 1IQGA 1QIXB 3ZZ3A 5HIZA 1F5RA 1GMDG 1TX8A 2YOLA 1W0ZU 3NRLA 4D9RA 3EGKH 1SGQE 4AN7A 3Q3XA 1W0YH 2P8OB 2WYGA 1MU8B 2ASUB 1O30A 4A1XA 1P04A 2UWPA 4B73A 4KTUA 2I6QA 1O2MA 4UONA 2PKAB 1O0DH 2EQNA 2Y6TA 5DP3A 3P8OA 3VB3A 4X1RU 1SOTA 1NO9H 5FPYA 1GHAF 3BV9B 4YZUA 4K3JA 1GJ4H 1C2IA 3KN2A 2OP9A 2D8WA 2W7UA 1CO7E 1E79D 1OP2A 2BVSH 1V2LT 5K7RA 1Z6JH 3A7VA 4FUGA 3S0NA 2BDAA 4B71A 1PPEE 1UHBA 1Y3UA 1IQEA 4NGAH 3C1KA 2BQ7B 1QB6A 3F9HA 1V2RT 2IJD1 6GCHF 1FPCH 2ZQ2A 1GMHG 1V2ST 2QA9E 1C1WH 4ZH8A 4Y71A 1NS3A 3E16B 1D4PB 4B2CA 3NKKA 1W8BH 2WPDD 1U6QA 1JOUB 1V2KT 1NBME 1O2ZA 5T6DA 1G3EA 2O8LA 2J9NA 1TNHA 3MU0A 1L0ZA 1C2EA 2ZU5A 2ZU1A 3N7DA 1B7XB 2EI6A 3CS7A 1J16A 1FIWA 2C93B 1PQ7A 1GGDB 2GZ7A 1GJCB 4FUBA 1UTMA 4LXBH 3UIRA 3M7TA 5EPNA 1DE7H 2GZ9A 4SGAE 3RXOA 1GHBG 3P8NA 1TGSZ 2AERH 1TRNA 2ZFSA 1LHEH 1VJ9U 3PV5A 3UPEA 4DJZB 1QRWA 2SGDE 4X8SH 4NWKA 4BTUB 2OC0A 3STJA 4H6TA 2EA3A 2RA0A 3VG8A 1EASA 1C5SA 4LOYH 3MHWU 2NU1E 1JRTA 1ZRKA 2A45B 1ELGA 1QURH 4CBNA 4FU9A 3RU4E 3ZVCA 1QY6A 1LMWB 1EOJA 1JBUH 1DSUA 1NBMD 1QB1A 2PSYA 1ZOMA 1FV9A 5F53A 3NWUA 1UMAH 1Y3WA 4NA8A 3S9CA 1KXDA 3DSOA 3H7TA 4OS6A 2VU8E 1P2JA 2RFKC 1AWHB 2CHAB 4SGBE 1QA0A 1S6LA 2HOBA 1EJAA 3A8DA 4CHAC 1DWEH 1TRYA 2XCFA 1TONA 4ABFA 1ZR0A 5C94A 2G8TA 2BQWB 3TLOA 2BX3A 3VB6A 1PPHE 1HGTH 1H1BA 1SC8U 1MD8A 1HJ8A 3E3TA 1XVMA 2ZTZA 4JZDH 3BEIB 3VB4A 1V3XA 2KCAA 3SUFA 1S82A 3FAOA 3DFJA 3F2FA 1IQIA 3E6PH 5DGJA 5DK1A 3SV2H 3URCA 3GDVA 1O2LA 1QBVH 2PKSC 2H9EH 5FHTA 2Y7XA 4GCHG 1D3TB 2ZA5A 1AN1E 4YOJA 1TBZH 2OXSA 2F9PA 3WW7A 3QZQA 3RC4A 1EP5A 1AE5A 1OX1A 1LCYA 1W12U 3BSQA 2PV9B 1XXFA 1IQKA 2ZHDA 3DHKH 1TMTH 2Y81A 3NZIA 1F0SA 1A0HB 1P12E 2TPIZ 1UTQA 3TH4H 1B5GH 5CMXH 6LPRA 2Y82A 4X1QU 2VWOA 4ZHMU 2RCEA 3RDZA 1P2NA 1Y3XA 1GBIA 3IITA 2ZC9H 2ZCHP 4X1PU 5CHBA 1ETTH 1EB1H 3SNEA 3U98H 1QA7A 4NIXA 2HVYB 1CBWC 4ZMAH 4IS5A 1FZZA 1MBQA 4XOJA 1E1QD 5LPRA 4K5ZA 5FX5A 4NIYA 5GNDA 3UNRA 1EKBB 1C4U2 4NZQA 2Z94A 5A2MH 3LONA 3SBKA 2R2WU 4ABBA 5FPTA 1UVUH 3SHCH 1P2KA 1RS0A 1YLCA 3RC6A 1NRQH 2TIOA 2XRCA 1O3AA 4CHAB 2A7CA 1GI5A 3TJVA 1SGTA 2WHXA 1C2LA 2ANWA 2ZHWH 2WPIS 1XVOA 4AB9A 4CR9A 4B1TA 3M37A 2XC0A 1TBQH 1T8MA 4K1TA 5ETXA 5JBAS 3P6ZB 1YKTA 1O3GA 1C5TA 2PKAA 3SNCA 2OC8A 1O3MA 4B74A 2TGTA 1GBHA 2BY8X 1TGCA 2Y5GA 1V2OT 1NRSH 4YLUA 1TIOA 3QWCH 1OWEA 3B9FH 1MQ5A 3TJNA 2CK3D 1H4WA 1BTYA 3S69A 3SNAA 1YPGH 2AGIX 3GCTG 4DT4A 1HJAC 2J4IA 1HNEE 1MMJN 1BT7A 5C2ZA 1O3PB 2O9QA 1RIWC 3M7QA 2M2AA 1P09A 1W0KD 2A5IA 3ESTA 3LOXA 3HGNA 4H42U 1LQDB 3NPSA 1ZHPA 1SKYE 1UVSH 4VGCC 3U9AH 1XMNB 3UR6A 3BTKE 1S6HA 1FDPA 3PO1B 3SORA 1V2NT 1XX9A 1HUTH 3ELAH 3RXGA 1EUFA 4JMYA 3KQEA 3K6YA 8GCHG 3SGBE 1HDTH 1VR1H 1EZSC 3D49H 4YOGA 4B2BA 1O3KA 1C2KA 4CRFA 1BRBE 5I46H 3P95A 2ZF0H 1MAXA 1O5EH 2VIPA 3WY8A 1C5UA 2V35A 4I8GA 4DVAU 3SUGA 3UWJH 2GTBA 4CREA 4K8BA 1UTKA 1THSH 1OWIA 1YYY1 2WV9A 1A5IA 2VGCB 4ZHLU 1E34B 4MDSA 5GWZA 1AHTH 1TPAE 1DWCH 3GYLB 4U01A 3A8CA 3OY6U 2BLVA 2ZU4A 2JDID 3HKJB 4IC5A 2P93A 2VWNA 4AGKA 3OYPA 3GCNA 1BOQA 5FCKA 1SLUB 3SU2A 1ESAA 4WMFA 5EXNA 3LT3A 3DSPA 3MTYA 4I31A 1EAUA 1HJAB 3BEUA 5FBEA 2OQUA 3MFJA 1OOKB 5GCHF 1RIWB 1GI4A 2TRMA 2QXIA 2O8UA 4UFEH 3FANA 1AQ7A 3UWIA 3LKWA 1EP6A 2BY6X 1O2WA 3ZV9A 2G51A 3MH7A 2A32A 1SBWA 4TYDA 1SLXB 4X0WU 1RTLA 5EJLA 1S0RA 3SQHE 3EQ0H 1ZJKA 1K1OA 1CHOF 1ESTA 1C4V2 3I29A 1LQEA 1MABB 1KLJH 3A7YA 4ZAEA 3ATLA 2KCYA 2EI8A 2J38A 4M9FA 1F0RA 3FZDA 4FUFA 3F6UH 2ALPA 3BIUH 1GPZA 2Z9KA 5A8ZA 1GDNA 1NPMA 1NT1A 2FDAA 2XCNA 3BG4C 4DURA 4JYVH 2GDDA 1YCPM 3KQBA 4ZCNA 1O2VA 5HM2A 2HLCA 1G3DA 2W5EA 1SGCA 1O3LA 1MAYA 1P3EA 2FTLE 1Z1IA 2ZDAH 1J17T 3SI4H 4A92A 4MPWA 4CRBA 2R0LA 3KYGA 1GJ5H 2HLDD 3VXFH 1D6RA 2C3SA 3BIVH 3P8FA 1YC0A 4ABJA 6GCHG 2JH5D 2J98B 1ELTA 2HNTF 1INCA 1AFQB 2BY9X 1XM1A 1LVYA 1O2TA 3QZRA 1GHYH 1NM6A 2FP7B 1FX0B 2G4TA 1E1RD 5T6GA 1W7XH 1J14A 4BAKB 1YPEH 5GJ4B 1YF4A 3K6ZA 2GX4A 1A5GH 4TT3D 2PR3A 1O3DA 4OS5A 3OX7U 5C0UA 2FOCA 3BN9A 2BB4A 3R3GB 5C1UA 1ZZZA 2IPQX 5FL7D 1ACBE 2H9HA 3E8LA 5DP9A 1UHBB 1H8IH 2J2UA 1BIOA 1RTFB 1SR5C 1WBGB 4X1NU 1F7ZA 2A0QB 1RXPA 3F9EA 4WMEA 5FX6A 4A1TA 2ZFFH 3VEQB 2G5NA 5FBIA 2A4RA 3CS0A 5JB8S 1EZQA 1MQ6A 1MUEB 1N8OC 2KCOA 5E2PA 2ZG0H 1TNLA 2ZHEH 4YOIA 4NSVA 2QF4A 1HIAB 2AH4X 3SV7A 2GT8A 4YO9A 1V2TT 4O97A 1SGIB 2QN5T 1D6WA 1LHDH 3Q3YA 3W1EA 2F3CE 3PM3A 1MTUA 1TRMA 1HAIH 5EQQA 3EDXB 2HVXA 2A5AA 1QQUA 2FI3E 4MVNA 2GVFA 4AG1A 3BG4B 1A0LA 1BMFD 1O36A 4ZKSU 2ZGBH 4Q4LA 1VGCC 3DFLA 1S6FA 1GWAA 3A7TA 1O3EA 1O35A 1ZLRA 2FZZA 2QXHA 3RMMH 4IN2A 3MNBA 2CGAA 5BRRE 1C5OH 2ZU2A 4I86A 3GCHB 1AY6H 4CRCA 1GG6C 3AAUA 5EW2H 7KMEH 3A89A 3QK1A 3M35A 4UD9H 3U8TH 1CT2E 1O5BB 3P17H 3KCGH 1HAVB 2J5UA 2BXTH 4D8NA 5A0AE 9LPRA 1F92A 3UQVA 1BQYA 3Q76A 4JZ1A 3F1SB 3ENSB 1TB6H 3BEFB 4NG9H 3M36A 2BOKA 1H9HE 1AB9B 1IAUA 4FU7A 1ARCA 1KDQB 4ESTE 3NUMA 5EXMA 2W6JD 1T8LA 1FUJA 1CHGA 1VCWA 3RP2A 4FUDA 2XXLA 1YPJH 3S7KB 2P3UB 5JDUB 1GVZA 2XNIA 2BM2A 2A1DB 3DCLA 3F3BA 1XUIA 4I33A 2TBSA 1ZPCA 3EA9A 1FN6A 1D3QB 2FXRA 4HI3A 3SV9A 2ZTXA 1OWKA 1FXYA 3PV2A 1MZAA 2B0FA 1P57B 1L1JA 1KXAA 4NIWA 1P06A 5L6NH 1ZSLA 3HK3B 4D76A 2CV3A 1BRUP 4BNRA 1QBNA 3Q3KA 1VJAU 2B5TB 1GBTA 1KTTB 2R3YA 1AI8H 1O2RA 1QRXA 2STBE 1NY22 2VH6A 3GDUA 4ISLA 1TX7A 4DIIH 4R0IA 2G52A 3F9FA 1C9TA 1VGCB 2YMSB 4FXGH 2ZCLP 2BD7A 1EB2A 2ULLA 2WPLS 1QHRB 3ZZAA 2F43B 1ZMNA 1CSOE 5EG4A 5DG6A 2WPMS 2CXVA 4Y8XA 1S5SA 1HV7A 4OS4A 1ELDE 1GG6B 4ISOA 1NU7B 2G00A 1Y59T 2H2ZA 1SB1H 3TNSA 4HTCH 4IC6A 2FLRH 2ALVA 1HBTH 4BOHA 4JYTA 4FOUC 4B75A 2R9PA 1ZMLA 3CP7A 1SQOA 2BDIA 2LNCA 1K1IA 1BHXB 5F8TA 4AOQA 1YPKH 3ZZ8A 4AGJA 3B23B 2V7QD 2V3MA 2A2XH 2Z9JA 4DT7B 3AK5A 1C5NH 3N7EA 1LTOA 3HGPA 2IJOB 3RXIA 1K0HA 2UWOA 1B0EA 1O3FA 1YPHC 2J98A 1FJSA 4A7IB 2FESH 1EJMA 1O31A 1ELFA 2JETC 1GBAA 1T7CA 2PFEA 4TSFD 1O2JA 3L3TA 2FX4A 1VITG 4Y7BA 2C8XB 4INHA 1O38A 1C2JA 3RMNH 1GI1A 2F4LA 3UB0A 4PROA 3FFGA 5T1VA 1PQ8A 2ZPRA 2BVRH 1G32B 1WCZA 2ZQ1A 3SZEA 2QXJA
chains in the Genus database with same CATH topology
3U28C 3UAIC 2RFKC 2V3MA 2EY4C 2EQNA 2HVYB 3MQKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U28 C;  3UAI C;  2RFK C;  2V3M A;  2EY4 C;  2EQN A;  2HVY B;  3MQK C; 
#chains in the Genus database with same CATH topology
 1JMO H;  1C2M A;  1HLT H;  1HCG A;  2W7S A;  4DOQ A;  1MCV A;  2GCT C;  4MNV A;  3KL6 A;  5A0B A;  4CBO A;  1GJ6 A;  2GDE H;  3RU4 T;  2ZFQ H;  3ATK A;  1P9U A;  1OHH D;  4F4O C;  1S85 A;  4ABI A;  5KGO A;  1HIA A;  3UTU H;  1H8D H;  4FUH A;  1PPC E;  1LKB A;  4WH6 A;  2JJ2 D;  4I8L A;  1KYN A;  2BDB A;  2KAI B;  1AD8 H;  4K1S A;  1TAW A;  4JYU H;  1GL1 A;  2TGP Z;  2VIV A;  2LEL A;  4P00 A;  5FCR A;  3PB1 E;  4I7Y H;  1O2H A;  3EYD A;  2LP6 A;  3LH1 A;  5EXL A;  4FUC A;  4AB8 A;  1LVO A;  3U69 H;  5CDF E;  2WSS D;  2PTN A;  4RKO B;  3LU9 B;  1GDQ A;  1ZJD A;  2ZU3 A;  2HWL B;  3EA8 A;  2CF8 H;  4X8V H;  3M61 U;  1FAX A;  1PPB H;  3MU4 A;  1P05 A;  3QGJ A;  1GJA B;  1SFQ B;  1DDJ A;  1RJX B;  4NFF A;  3VXE H;  2QCY A;  1HAG E;  1SHH B;  2C8W B;  8LPR A;  6CHA C;  2JET B;  2WZQ A;  2FOB A;  1EOL A;  1Z8I B;  1G30 B;  3LC3 A;  1N6Y A;  4AZ2 B;  2YMS D;  5J4S A;  1HAV A;  2B8O H;  3BTQ E;  1J9C H;  4U2W A;  3SND A;  2J94 A;  2EST E;  2BOH B;  1GBD A;  3T29 A;  1G37 A;  1DLE A;  3M5L A;  5DJ7 A;  2F9N A;  1C5Q A;  3DUX H;  3RXC A;  1KDQ A;  1BA8 B;  1EAX A;  1G9I E;  1LHC H;  1NRP H;  2OBQ A;  4JK5 A;  1Z8J B;  3A82 A;  3GCO A;  4Q80 A;  1NFY A;  4J2Y B;  1P2M A;  2WPK S;  3W95 A;  2XND D;  3QO6 A;  1Q2W A;  1D3P B;  3GY2 A;  1SSX A;  1C2D A;  2PTC E;  2Q1J A;  4RT1 A;  2C8Z B;  5AHG H;  7GCH G;  4HG6 A;  1IQF A;  1RD3 B;  3S7H B;  2V0B A;  1BTW A;  1DXP A;  1TNI A;  3A7Z A;  4LZ4 B;  1C5Z B;  2BD2 A;  2BVX H;  1UK3 A;  4O3T A;  2TGA A;  2SGP E;  3V7T A;  1MD7 A;  1TMU H;  2H5D A;  2AFQ B;  1TAB E;  1H9L B;  2SNW A;  3RU4 D;  5F8Z A;  4JZE H;  1P2O A;  2FS8 A;  1PPZ A;  1XUJ A;  3RXS A;  2BD4 A;  2KZ4 A;  3RXU A;  3TGJ E;  1KIG H;  1KXC A;  2XOK D;  3AVZ A;  3UFA A;  5DP5 A;  5IDK A;  3MH5 A;  2B7D H;  2SGQ E;  3FO8 D;  1O2U A;  3KQC A;  4XBB A;  3SN8 A;  1QL7 A;  1YCP K;  2A2Q H;  3MWI U;  1SGR E;  1UK4 A;  4BAO B;  2F91 A;  3I78 A;  3GY7 A;  3E0P B;  3OEE D;  6CHA B;  1Z1J A;  1DM4 B;  2FOF A;  2UWL A;  1GI8 B;  3HK6 B;  3ZZB A;  1Y5A T;  1YPH E;  3R0F A;  4X2Y A;  2D2D A;  1SFI A;  1O3N A;  1QBO A;  2BD8 A;  3VPK A;  3B8J A;  4TWY A;  4Y0Z E;  1GL0 E;  1C1N A;  1GBB A;  1O5D H;  4TPY A;  5GDS H;  3ZVB A;  1LKA A;  1L2E A;  2OTV A;  4GAW A;  1MTS A;  4KEL A;  3O8C A;  1DY9 A;  2IPH A;  3PMJ A;  2Z3C A;  1SVP A;  1AUJ A;  4AYV B;  1SQR A;  4CH2 B;  5JBB S;  5JBT A;  1GHX H;  1C9P A;  3H09 A;  1ABJ H;  2DE8 A;  1GMC F;  3V13 A;  1W0J D;  4IN1 A;  3QDZ B;  1FY4 A;  1Z6E A;  2GMT C;  1LO6 A;  5C1X A;  3VGC C;  4F49 A;  4E7N A;  3URE A;  1BZX E;  2QIQ A;  2ZGX H;  3ZVA A;  1ZTL A;  2QGR A;  3ZV8 A;  5HXF A;  4WXI A;  2V3H H;  4RKJ B;  3SV6 A;  2CF9 H;  4ABG A;  3S9B A;  1CGH A;  2PKS B;  2G5V A;  3SGA E;  3M3T A;  5HKK D;  1C1P A;  2ODP A;  2ODY B;  5H4I B;  2H6M A;  4CR5 A;  3OU0 A;  3BF6 H;  1DWB H;  1P03 A;  2VBC A;  5DP8 A;  1ESB A;  5BPE A;  1E35 B;  3SU3 A;  3A7W A;  9EST A;  1T4U H;  3LGV A;  3TK6 A;  1FY1 A;  5HM9 A;  4OS2 A;  1YBW A;  2EY4 C;  1ELA A;  1L1N A;  1EJN A;  2GD4 B;  2OK5 A;  1BCU H;  2BDC A;  1DVA H;  1YPM H;  2AGG X;  1GI2 A;  1F5K U;  2KAI A;  2VIO A;  2ZTY A;  4K2Y A;  3ZYD A;  2R3U A;  2XBV A;  1GMD F;  1CBW B;  3ZZ5 A;  1HAH H;  4GHT A;  1C5M D;  4YT6 H;  4CH8 B;  1O5G H;  3T25 A;  2PGB B;  3LJO A;  1HXE H;  3OSY A;  5DP6 A;  5C5O A;  3RXL A;  1GJB B;  2G81 E;  2VVC A;  5AF9 H;  1BTZ A;  1XUK A;  1NN6 A;  2D1J A;  2WIN I;  3O8R A;  8KME 2;  2Q6F A;  2L6O A;  4KTC A;  2ZPQ A;  1O37 A;  5B6L A;  1FNI A;  3V12 A;  1ZTK A;  1AKS B;  5E0G A;  5J4Q A;  1KMH B;  5DP7 A;  2HNT C;  5C1Y A;  4OS1 A;  3HAT H;  1MKX K;  1GI6 A;  3A8A A;  4GLY A;  1DUA A;  4DCD A;  2GMT B;  2ZI2 H;  3BTW E;  3I77 A;  4FVD A;  1C2G A;  2FOD A;  4BXW A;  2IN2 A;  2J92 A;  3SU0 A;  4ZUH A;  1XXD A;  1C4Y 2;  2M5T A;  1O39 A;  3RXH A;  3M5O A;  1GMH F;  2AS9 A;  1O2Q A;  4XRN A;  4OGY A;  1P2Q A;  2RDL A;  1GBK A;  1TE0 A;  2FI4 E;  3FVF B;  1O2X A;  1KXB A;  2Y80 A;  1VCP A;  2FIR H;  3FP6 E;  2HAL A;  1UCY K;  1GVL A;  2FOG A;  2ZEC A;  1IQN A;  1TPP A;  2JKH A;  1UTO A;  2RDE A;  2PUQ H;  2GJG A;  5A8Y A;  3WWF A;  2QF3 A;  3FKS D;  1P0S H;  2BLQ A;  3RC5 A;  4IGD A;  1EAT A;  3RXV A;  1GCT C;  5K0H A;  3JZ1 B;  3VB5 A;  1O32 A;  1K9O E;  4VGC B;  2V6N A;  1UJ1 A;  3RXB A;  4IMQ A;  1GHB F;  2BX4 A;  2ZGH A;  1DFP A;  2C4F H;  2HGT H;  3KQ5 A;  2BY7 X;  3H7O A;  1CU1 A;  3LGY A;  1PJP A;  2XBY A;  3ATI A;  5L2Y H;  1O33 A;  2VH0 A;  1P9S A;  2BHG A;  5A8X A;  3PMB B;  4Y11 E;  1O5F H;  4TY7 A;  4WY3 A;  1GHA G;  1A0J A;  3RXR A;  1DX5 M;  4ACB A;  4ACA A;  1OWJ A;  3FP8 E;  3QTO H;  1W3C A;  2SGF E;  2JJ1 D;  1QFK H;  3ZIA D;  2WV5 A;  2XC5 A;  5SGA E;  3MMG A;  5EST E;  2GZ8 A;  4Q7X A;  5AVD A;  3UQO A;  3D65 E;  2Z3E A;  1IOE A;  2P94 A;  2L74 A;  1P11 E;  3TIU A;  5EW1 H;  1A61 H;  2CJI A;  2FX6 A;  5EU8 A;  1WXR A;  2BZ6 H;  4WJG 2;  3OFN D;  3E1X B;  4ZKR U;  3OTP A;  4LZ1 H;  3PLB A;  1O2K A;  1O2S A;  1TGN A;  2PLX A;  1IQH A;  1C5P A;  1NES E;  1TOC B;  2AEI H;  2XBX A;  3D23 A;  3FOA A;  1C1R A;  1Q3X A;  3PMA B;  1NFX A;  1BTH H;  2FI5 E;  4GVU A;  3MH4 A;  2AMQ A;  2C90 B;  2HRV A;  3T62 A;  1JIR A;  3LPR A;  4RI0 A;  1P3C A;  4ZRO A;  1G36 A;  4JK6 A;  1BTU A;  1T32 A;  2BDY A;  2KCP A;  4AFZ A;  2ZO3 H;  1ZPB A;  1CT0 E;  2I6S A;  2YNA A;  1F5L A;  2O8M A;  3PRO A;  3A87 A;  2XC4 A;  1RGQ A;  3E0N B;  4BAH B;  3EE7 A;  3U1J B;  1A7S A;  5CE1 A;  1C5X B;  3BTF E;  2KR7 A;  1WOF A;  2STA E;  1DS2 E;  5T6F A;  3CEN A;  2ZFR H;  3TH3 H;  1TX6 A;  2XWB I;  1YCP H;  4BTT B;  4D7G A;  1BIT A;  1W7G H;  2B9L A;  4XDE A;  1C2H A;  2BQ6 B;  1TGT A;  3PLP A;  3U8O H;  4UEH H;  1NTP A;  2R0K A;  3ZVD A;  1GJD B;  1V2M T;  1DPO A;  1YPL H;  5JBC S;  1SQT A;  5KED A;  1AMH A;  4ABA A;  4FUE A;  4MNY A;  5EJZ A;  3DSG A;  1OKX A;  3RLY H;  5LGO A;  4JZI A;  1LPG B;  1G3B A;  2NU0 E;  2Z9G A;  1DST A;  1IQL A;  2FYQ A;  1PYT C;  1TFX A;  4H4F A;  4O3U A;  3KQD A;  1NZQ H;  4ZHA A;  1S83 A;  3PWC A;  1C1S A;  4E7R G;  3SJ8 A;  1LDT T;  5DO4 H;  4RT0 A;  1H8E D;  3MU5 A;  1VKY A;  1AFE H;  2HNT E;  3ZZ6 A;  4AFU A;  3TIT A;  1SGN E;  4WMD A;  3BTH E;  1EZX C;  3RM2 H;  2EC9 H;  4Z6A H;  1BBR K;  1THP B;  3DT0 H;  3GOV B;  1UTN A;  4QT8 C;  2ZFT A;  3UNS A;  3QN7 A;  1UVP A;  5F03 A;  4NWL A;  1AO5 A;  1PPG E;  1WQS A;  1QRZ A;  2OLG A;  2ZHF H;  4UDW H;  4HFP B;  3MU8 A;  1OPH B;  3KYF A;  2GCH F;  1KXF A;  1RTK A;  1AKS A;  3GCT F;  2J97 A;  3NXP A;  5CHA C;  4BTI B;  2GP9 B;  2W6I D;  1A46 H;  2GGV B;  1L4D A;  4UFG H;  1V2V T;  4JCN A;  3OAA D;  1N8O B;  1ZRB A;  2ZPS A;  1Z7K A;  1T31 A;  1O2Y A;  2AYW A;  3RXQ A;  1K28 D;  2ZDK A;  1KXE A;  2UUK B;  2SFA A;  2PW8 H;  4UE7 H;  2P8O C;  2FOM B;  1BB0 B;  1ZPZ A;  1TNK A;  3TK9 A;  1SGY E;  1CA8 B;  1E37 B;  1O2P A;  3GYM A;  4R8T B;  2NWN A;  1OWD A;  1SGF A;  3M7U A;  4K1E A;  3RXT A;  8GCH F;  3QTV H;  5TJX A;  1GBC A;  1ZHM A;  2PSX A;  3ODF A;  4NCY A;  2A4G A;  3HPT B;  2G4U A;  4TPI Z;  3Q77 A;  2ZHQ H;  3RM0 H;  1E38 B;  1F0T A;  3RLW H;  1WSS H;  3PV4 A;  4J1Y A;  1LPZ B;  1WV7 H;  4RN6 A;  2XTT B;  4K8Y A;  1EZU C;  1RRK A;  1DT2 A;  1ZSK A;  3A85 A;  2SNV A;  1TQ0 B;  3KGP A;  2J95 A;  4TWW A;  3SUE A;  3CNR A;  3M5M A;  1JIM A;  1V6D A;  1TYN A;  5E0H A;  1O2N A;  3BTT E;  2WUB A;  2NU4 E;  2W26 A;  1FQ3 A;  2ZP0 H;  8EST E;  1CVW H;  1OXG A;  2XBW A;  4ABD A;  5EJ1 A;  1CA0 C;  2OCV B;  2NU2 E;  1G3C A;  1V2Q T;  4TY6 A;  4ASH A;  1BJU A;  2K0Q A;  1MKX H;  1WTH D;  4WWY A;  1CE5 A;  3PYH A;  4D7F A;  2WYJ A;  3M3V A;  3TJU A;  2Z9L A;  1P8V C;  1ANE A;  1W2K H;  1C1M A;  2FMJ A;  3QGN B;  1FLE E;  4ZXX H;  1G2L A;  3PMH B;  1GGD C;  1GVK B;  1K1M A;  2OC1 A;  2QE7 D;  4NA9 H;  2GV6 A;  3MOC A;  1GHW H;  4IBL H;  1O5C B;  5GPI B;  1BHX F;  4DY7 B;  2BLO A;  5F8X A;  1RFN A;  1UCY H;  5F6M A;  2Z9I A;  3K9X B;  2VWL A;  2A7J A;  1SPJ A;  1KLT A;  3PWB A;  5EQR A;  1E36 B;  3ATW A;  5TCC A;  1MZD A;  4I8H A;  1DXW A;  1A1R A;  3T26 A;  5JPM H;  2UUY A;  1Z8G A;  1EAW A;  2ZDM A;  1QQ4 A;  5EOD A;  3KHV A;  3VFE A;  4UFD H;  2THF B;  5A0C A;  3QX5 H;  5A09 A;  4RSP A;  3SZN A;  1P01 A;  1WUN H;  2PHB A;  3UNQ A;  3TH2 H;  1BTX A;  3P92 A;  4DIH H;  2CHA C;  1ELV A;  5C3N A;  3RXM A;  2K8I A;  1A3E H;  1P10 A;  2FYR A;  1S0Q A;  2VID A;  3RXF A;  4NFE A;  3RXJ A;  4CRA A;  2ANK H;  2AIP A;  3RXK A;  4MPU A;  1BRA A;  4ISN A;  2BY5 X;  5DSF A;  1FIZ A;  2Z6B D;  3A88 A;  1AND A;  7LPR A;  5EGM A;  1XKB C;  4ABE A;  1VIT H;  3H5C B;  1QL9 A;  3L6P A;  4A6L A;  1Q31 A;  3LGU A;  3MI4 A;  2FOA A;  1TBR H;  3RXE A;  5E2O A;  1CA0 B;  2FWW A;  1SLV B;  1FY3 A;  3M5N A;  1SGF G;  3TGI E;  1GI3 A;  3T28 A;  5HMA A;  5GCH G;  1ANC A;  2GV7 A;  1H9I E;  1TPO A;  1GI7 B;  3AAS A;  3BTE E;  2O8T A;  3TPI Z;  2D26 C;  3DA9 B;  3SOS A;  4B6F A;  5HGG A;  3D62 A;  3NK8 A;  3UR9 A;  4Z1M D;  4UFF H;  1SLW B;  2QYI A;  3GY8 A;  3MNX A;  3V3M A;  1QJ6 B;  2XW9 A;  1CHO G;  1VZQ H;  2H5C A;  3HKI B;  1TGB A;  1BDA A;  2DUC A;  4BXS A;  1BMA A;  4Y7A A;  3TK5 A;  1F0U A;  2A4O A;  5FAH A;  1NFW A;  5L30 H;  1O34 A;  2A31 A;  1C5L H;  1TMB H;  1LVB A;  1FAK H;  1LVM A;  3SU6 A;  1LHF H;  3ZVF A;  4MNX A;  2FS9 A;  1P2I A;  1UTP A;  1HRT H;  1QJ7 B;  5C5N A;  1TOM H;  1PYT D;  2A4Q A;  1A2C H;  4Y8Z A;  4WF8 A;  3LGW A;  2QC2 A;  2LPR A;  4X2X A;  2GCT B;  2P59 A;  1MTN C;  2VWM A;  1HPG A;  3V0X A;  5DP4 A;  5E0J A;  1DIC A;  3SU4 A;  3UUZ A;  1AVG H;  1N1L A;  5ABW A;  2PGQ B;  1SHY A;  4FU8 A;  1S81 A;  2W3K A;  3ZZD A;  1V2P T;  3F68 H;  3BTG E;  1CQQ A;  1FI8 A;  1UK2 A;  1J15 A;  2P3T B;  1WQV H;  1HAX B;  4E05 H;  1OS8 A;  4INL A;  3KEE A;  3ZZ7 A;  3SV8 A;  2ILN A;  1AUT C;  2ZGC A;  4FUI A;  3SUD A;  3GY6 A;  1MTW A;  1YY3 A;  3O8B A;  1K2I 1;  3S9A A;  1FON A;  4X6P A;  3A80 A;  3ZYE A;  1ELE E;  3L33 A;  4KTS A;  4THN H;  3URD A;  1MTV A;  3SNB A;  1EFR D;  1NFU A;  2JIZ D;  1OSS A;  3TGK E;  1LHG H;  1C1V H;  1V2U T;  3OTJ E;  2OQ5 A;  5HIY A;  1MKW K;  1BTP A;  1YWU A;  3M3S A;  4GUX A;  1BBR H;  1C5V A;  4CRG A;  3AAV A;  1ZGV A;  4ZXY H;  2ODQ A;  3GS9 A;  1TA2 A;  2FTM A;  2JH0 D;  3WWB A;  4M7G A;  1ZGI A;  3SYJ A;  1QR3 E;  1NC6 A;  3TJO A;  2Q6D A;  3LIW A;  2XYA A;  3PO1 C;  4KGA A;  4WXV A;  2Q6G A;  1DOJ A;  5PTP A;  1K1P A;  1Z71 A;  4X6M A;  2KM0 A;  2RA3 A;  1DUE A;  4F55 A;  3UY9 A;  3Q00 A;  3SU5 A;  1T8N A;  1AIX H;  2F9U A;  1KLI H;  2SGA A;  1EQ9 A;  1H8H D;  1IQM A;  1DWD H;  4AFS A;  1KY9 A;  2ZWL H;  5EPY A;  1ZMJ A;  1EAI A;  3U28 C;  1GJ7 B;  1COW D;  4X2V A;  4GPG A;  1GHV H;  4X6N A;  3ZZ9 A;  3LJJ A;  2FM2 A;  2H1U A;  1MTN B;  1HAZ B;  1QTF A;  1BMM H;  3GY5 A;  3SJI A;  4Q2K A;  1C1O A;  1DY8 A;  1NRR H;  4ISH H;  1UO6 A;  1SGP E;  5C20 A;  2F9V A;  5C17 A;  1A5H A;  1W10 U;  1W11 U;  2VGC C;  1LPK B;  2FOE A;  2WPH S;  4XD7 D;  2BZA A;  3SJK A;  4XBC A;  3RXD A;  3DD2 H;  2J34 A;  4HGC A;  2G55 A;  1DLK B;  4Y8Y A;  3T27 A;  2AMD A;  2TGD A;  1EPT C;  1GJ8 B;  5EQS A;  4XE4 A;  1SOZ A;  1T8O A;  1WAY B;  3SW2 B;  1O3H A;  3BG8 A;  2IOT A;  3F0O A;  1BML A;  1HXF H;  1ZSJ A;  4Q7Y A;  2GCH G;  3UOU A;  4I8J A;  3U8R H;  2XWA A;  1ABI H;  4OM9 A;  4NZL A;  1GI0 A;  1VCQ A;  2FO9 A;  2PWX A;  2P95 A;  4IW4 E;  2AIQ A;  2HPP H;  3F0P A;  4YTA A;  4BAM B;  1K1N A;  2ZCK P;  3K65 B;  1E0F D;  5FPS A;  2H9T H;  3FZZ A;  4D9Q A;  2BXU H;  3OEH D;  1HAP H;  2CN0 H;  1WTG H;  3MH6 A;  3LGT A;  1UVT H;  2ZFP H;  1HFD A;  1ETR H;  1ANB A;  2ZZU H;  1O3I A;  4NIV A;  4YM9 A;  1FMG A;  3SQE E;  3A83 A;  1TQ7 B;  3A7X A;  1YLN A;  3SJ9 A;  1VIT F;  1TNG A;  1SGE E;  3RUO A;  3RXP A;  1O3J A;  4U32 A;  4AC9 A;  2FPZ A;  4H6S B;  1BMN H;  4Y10 E;  1OP0 A;  2VIW A;  1BJV A;  5I25 A;  4I8K A;  3LC5 A;  5LPF A;  4MPX A;  2BD9 A;  5DPA A;  4Q63 A;  4XFQ A;  1QB9 A;  3MU1 A;  2VVV A;  1MCT A;  4B6E A;  3UOP A;  4GSO A;  1N6X A;  1FY5 A;  1OYQ A;  3K2U A;  3VGC B;  1YGC H;  5ESB A;  3F9G A;  4FUJ A;  1C1Q A;  1T4V H;  1TA6 A;  1WU1 A;  3SI3 H;  1AFQ C;  1SI5 H;  3EA7 A;  1TWX B;  4OGX A;  1CT4 E;  2YNB A;  1O2O A;  2QF0 A;  2Y7Z A;  3EE0 B;  3JZ2 B;  1WDI A;  1UCY E;  4AOR A;  2BDH A;  1EPT B;  1AGJ A;  4DGJ A;  2AHM E;  3SU1 A;  5DN6 D;  1EX3 A;  3T2N A;  2O8W A;  1QZ8 A;  3A86 A;  4ZKO U;  2HPQ H;  3GDS A;  3O8D A;  1GHZ A;  2UUF B;  5TCA A;  4DG4 A;  1K21 H;  3F2G A;  1UTJ A;  1B0F A;  1Z8R A;  3LGI A;  3TVJ B;  1XUH A;  1YLD A;  4GHQ A;  3ZVG A;  1OYT H;  5IK2 D;  2BD3 A;  1Y3Y A;  1QNJ A;  3ATM A;  1MBM A;  2Y5H A;  1FPH H;  3GIC B;  4MNW A;  4Y79 A;  4FET A;  2BTC E;  3PTN A;  1ZHR A;  4X8U H;  1FN8 A;  3PRB A;  1GBE A;  1JRS A;  2WUC A;  2AMP A;  1D9I A;  1C5Y B;  4WVP E;  3AW1 A;  5GIB A;  3SHA H;  1QGF A;  3EAJ A;  2ZGJ A;  2SGE E;  6EST A;  1A4W H;  1C1U H;  1G2M A;  3SO3 A;  3KID U;  3AW0 A;  3RML H;  3E91 A;  1GJ9 B;  1PFX C;  3IWM A;  3MO6 A;  2A5K A;  4NA7 A;  5LPE A;  1GBM A;  2BYA X;  1GBL A;  2NU3 E;  4YT7 H;  3RXA A;  3OE7 D;  2ZNK H;  4BAQ B;  3GIS B;  3GCH C;  1Y8T A;  1ARB A;  1W14 U;  7GCH F;  1DIT H;  1HAO H;  1PPF E;  3ITI A;  1HAY B;  3LH3 A;  2ZKS A;  1OWH A;  4K69 A;  5C0T A;  1HJ9 A;  2Z3D A;  5AFZ H;  3BTD E;  3GY3 A;  2OD3 B;  3GY4 A;  1AVW A;  2JH6 D;  1XUG A;  3FP7 E;  1UW7 A;  1O3B A;  3A81 A;  1AZZ A;  4Z0K A;  3MNS A;  1C2F A;  1A3B H;  3P8G A;  2K1Q A;  2A7H A;  1SQA A;  4GCH F;  1BUI A;  2W3I A;  2BLW A;  1BRC E;  1V2W T;  1GCT B;  1AB9 C;  4A5T S;  2CMY A;  2EEK A;  2QV1 A;  1C5R A;  3BTM E;  3FN8 A;  4ISI H;  4MLF B;  4U30 A;  2OUA A;  5EIY A;  5GXP A;  3A8B A;  1NRN H;  1M9U A;  2Z7F E;  1IQJ A;  2OC7 A;  1ORF A;  1O5A B;  3ZZC A;  1CGI E;  2VNT A;  1AZ8 A;  5HYO A;  3KNX A;  1L1G A;  4K60 A;  1SMF E;  1MKW H;  4KP0 A;  4YES B;  1PQA A;  2QAA A;  4X2W A;  3MO3 A;  4XBD A;  5FXL A;  1AE8 H;  2FEQ H;  5EOK A;  2QXG A;  3PTB A;  4MG3 A;  3OY5 U;  1GDU A;  4AFQ A;  4AYY B;  2FOH A;  1SGD E;  1TAL A;  5DKM A;  1SG8 B;  5JB9 S;  1K1J A;  4B2A A;  1QCP A;  1GBF A;  4E06 H;  2QF5 A;  4LK4 A;  4O03 A;  3U1I B;  1Y5B T;  2F83 A;  4F48 B;  2WPJ S;  4XSK U;  2FLB H;  2YMS C;  4CRD A;  1J8A A;  2C8Y B;  2PP6 A;  2UUJ B;  2WV4 A;  1P02 A;  1THR H;  1L4Z A;  5C67 A;  2OBO A;  1S84 A;  1GCD A;  4DW2 U;  1W13 U;  2P16 A;  1KSN A;  1IHT H;  1ZTJ A;  3N7O A;  3TU7 H;  3ZVE A;  1EXF A;  3MYW A;  1BBR E;  2VIQ A;  4KKD A;  2PUX B;  1XKA C;  4X6O A;  1UVO A;  1XUF A;  4JZF H;  2EI7 A;  1HYL A;  3MNC A;  1C5W B;  2ZDN A;  3P70 B;  4MQA A;  2AGE X;  1OP8 A;  4ZKN U;  1GI9 B;  1Y5U T;  1GBJ A;  1K22 H;  4Y6D A;  4ASU D;  3T5F H;  3LDX H;  1FY8 E;  2VJ1 A;  1AWF H;  1HB0 B;  3SGQ E;  3ODD A;  3TNT A;  4A1V A;  4Y76 A;  1Y3V A;  3UAI C;  4WH8 A;  2VB0 A;  3STI A;  2KX4 A;  1AVX A;  4HZH A;  4OS7 A;  2BD5 A;  1WYK A;  1O3C A;  4AG2 A;  3QLP H;  3C27 B;  1EPT A;  1F2S E;  5T3H A;  1NRO H;  1YM0 A;  2F9B H;  1UTL M;  1ELC A;  2DE9 A;  4X8T H;  2KFW A;  1ZYO A;  1D3D B;  4X1S U;  3F2H A;  3ZZ4 A;  3E90 B;  1GMC G;  4BAN B;  4FVB A;  1PQ5 A;  3RMO H;  1C1T A;  1TPS A;  2Y5F A;  1SL3 A;  1O2I A;  4MPV A;  4ABH A;  1KTS B;  1K1L A;  4INK A;  2R2M B;  5G4B A;  1IHS H;  2VIN A;  5E8E H;  1YP9 A;  2BDG A;  3G01 A;  2RG3 A;  4O9V A;  4B76 A;  5B6O A;  1QL8 A;  1X7A C;  1TLD A;  2F9O A;  7EST E;  3N99 A;  2V3O H;  1ETS H;  1ELB A;  3MO9 A;  4MTB A;  2ANM H;  5KEC A;  1V2J T;  5LH8 A;  3MQK C;  3NCL A;  1QJ1 B;  3SJO A;  4Q7Z A;  1JWT A;  3KF2 A;  1NU9 A;  4IMZ A;  2ZDV H;  4NSY A;  2GT7 A;  4YXW D;  4Y0Y E;  4AX9 H;  1MH0 A;  3IG6 B;  2VVU A;  1TNJ A;  3PLK A;  2OIN A;  4I32 A;  1AU8 A;  5AFY H;  2ZIQ H;  3W94 A;  5CHA B;  1JXP A;  5IYT A;  1O2G H;  5JYI A;  4YLQ H;  5L2Z H;  1DAN H;  3PRD A;  2ANY A;  2GKV E;  4P02 A;  3QUM P;  3A84 A;  1MU6 B;  1CGJ E;  2BMG B;  3VB7 A;  1ID5 H;  1O3O A;  2ZDL A;  2QY0 B;  2P3F H;  2ZEB A;  1IQG A;  1QIX B;  3ZZ3 A;  5HIZ A;  1F5R A;  1GMD G;  1TX8 A;  2YOL A;  1W0Z U;  3NRL A;  4D9R A;  3EGK H;  1SGQ E;  4AN7 A;  3Q3X A;  1W0Y H;  2P8O B;  2WYG A;  1MU8 B;  2ASU B;  1O30 A;  4A1X A;  1P04 A;  2UWP A;  4B73 A;  4KTU A;  2I6Q A;  1O2M A;  4UON A;  2PKA B;  1O0D H;  2EQN A;  2Y6T A;  5DP3 A;  3P8O A;  3VB3 A;  4X1R U;  1SOT A;  1NO9 H;  5FPY A;  1GHA F;  3BV9 B;  4YZU A;  4K3J A;  1GJ4 H;  1C2I A;  3KN2 A;  2OP9 A;  2D8W A;  2W7U A;  1CO7 E;  1E79 D;  1OP2 A;  2BVS H;  1V2L T;  5K7R A;  1Z6J H;  3A7V A;  4FUG A;  3S0N A;  2BDA A;  4B71 A;  1PPE E;  1UHB A;  1Y3U A;  1IQE A;  4NGA H;  3C1K A;  2BQ7 B;  1QB6 A;  3F9H A;  1V2R T;  2IJD 1;  6GCH F;  1FPC H;  2ZQ2 A;  1GMH G;  1V2S T;  2QA9 E;  1C1W H;  4ZH8 A;  4Y71 A;  1NS3 A;  3E16 B;  1D4P B;  4B2C A;  3NKK A;  1W8B H;  2WPD D;  1U6Q A;  1JOU B;  1V2K T;  1NBM E;  1O2Z A;  5T6D A;  1G3E A;  2O8L A;  2J9N A;  1TNH A;  3MU0 A;  1L0Z A;  1C2E A;  2ZU5 A;  2ZU1 A;  3N7D A;  1B7X B;  2EI6 A;  3CS7 A;  1J16 A;  1FIW A;  2C93 B;  1PQ7 A;  1GGD B;  2GZ7 A;  1GJC B;  4FUB A;  1UTM A;  4LXB H;  3UIR A;  3M7T A;  5EPN A;  1DE7 H;  2GZ9 A;  4SGA E;  3RXO A;  1GHB G;  3P8N A;  1TGS Z;  2AER H;  1TRN A;  2ZFS A;  1LHE H;  1VJ9 U;  3PV5 A;  3UPE A;  4DJZ B;  1QRW A;  2SGD E;  4X8S H;  4NWK A;  4BTU B;  2OC0 A;  3STJ A;  4H6T A;  2EA3 A;  2RA0 A;  3VG8 A;  1EAS A;  1C5S A;  4LOY H;  3MHW U;  2NU1 E;  1JRT A;  1ZRK A;  2A45 B;  1ELG A;  1QUR H;  4CBN A;  4FU9 A;  3RU4 E;  3ZVC A;  1QY6 A;  1LMW B;  1EOJ A;  1JBU H;  1DSU A;  1NBM D;  1QB1 A;  2PSY A;  1ZOM A;  1FV9 A;  5F53 A;  3NWU A;  1UMA H;  1Y3W A;  4NA8 A;  3S9C A;  1KXD A;  3DSO A;  3H7T A;  4OS6 A;  2VU8 E;  1P2J A;  2RFK C;  1AWH B;  2CHA B;  4SGB E;  1QA0 A;  1S6L A;  2HOB A;  1EJA A;  3A8D A;  4CHA C;  1DWE H;  1TRY A;  2XCF A;  1TON A;  4ABF A;  1ZR0 A;  5C94 A;  2G8T A;  2BQW B;  3TLO A;  2BX3 A;  3VB6 A;  1PPH E;  1HGT H;  1H1B A;  1SC8 U;  1MD8 A;  1HJ8 A;  3E3T A;  1XVM A;  2ZTZ A;  4JZD H;  3BEI B;  3VB4 A;  1V3X A;  2KCA A;  3SUF A;  1S82 A;  3FAO A;  3DFJ A;  3F2F A;  1IQI A;  3E6P H;  5DGJ A;  5DK1 A;  3SV2 H;  3URC A;  3GDV A;  1O2L A;  1QBV H;  2PKS C;  2H9E H;  5FHT A;  2Y7X A;  4GCH G;  1D3T B;  2ZA5 A;  1AN1 E;  4YOJ A;  1TBZ H;  2OXS A;  2F9P A;  3WW7 A;  3QZQ A;  3RC4 A;  1EP5 A;  1AE5 A;  1OX1 A;  1LCY A;  1W12 U;  3BSQ A;  2PV9 B;  1XXF A;  1IQK A;  2ZHD A;  3DHK H;  1TMT H;  2Y81 A;  3NZI A;  1F0S A;  1A0H B;  1P12 E;  2TPI Z;  1UTQ A;  3TH4 H;  1B5G H;  5CMX H;  6LPR A;  2Y82 A;  4X1Q U;  2VWO A;  4ZHM U;  2RCE A;  3RDZ A;  1P2N A;  1Y3X A;  1GBI A;  3IIT A;  2ZC9 H;  2ZCH P;  4X1P U;  5CHB A;  1ETT H;  1EB1 H;  3SNE A;  3U98 H;  1QA7 A;  4NIX A;  2HVY B;  1CBW C;  4ZMA H;  4IS5 A;  1FZZ A;  1MBQ A;  4XOJ A;  1E1Q D;  5LPR A;  4K5Z A;  5FX5 A;  4NIY A;  5GND A;  3UNR A;  1EKB B;  1C4U 2;  4NZQ A;  2Z94 A;  5A2M H;  3LON A;  3SBK A;  2R2W U;  4ABB A;  5FPT A;  1UVU H;  3SHC H;  1P2K A;  1RS0 A;  1YLC A;  3RC6 A;  1NRQ H;  2TIO A;  2XRC A;  1O3A A;  4CHA B;  2A7C A;  1GI5 A;  3TJV A;  1SGT A;  2WHX A;  1C2L A;  2ANW A;  2ZHW H;  2WPI S;  1XVO A;  4AB9 A;  4CR9 A;  4B1T A;  3M37 A;  2XC0 A;  1TBQ H;  1T8M A;  4K1T A;  5ETX A;  5JBA S;  3P6Z B;  1YKT A;  1O3G A;  1C5T A;  2PKA A;  3SNC A;  2OC8 A;  1O3M A;  4B74 A;  2TGT A;  1GBH A;  2BY8 X;  1TGC A;  2Y5G A;  1V2O T;  1NRS H;  4YLU A;  1TIO A;  3QWC H;  1OWE A;  3B9F H;  1MQ5 A;  3TJN A;  2CK3 D;  1H4W A;  1BTY A;  3S69 A;  3SNA A;  1YPG H;  2AGI X;  3GCT G;  4DT4 A;  1HJA C;  2J4I A;  1HNE E;  1MMJ N;  1BT7 A;  5C2Z A;  1O3P B;  2O9Q A;  1RIW C;  3M7Q A;  2M2A A;  1P09 A;  1W0K D;  2A5I A;  3EST A;  3LOX A;  3HGN A;  4H42 U;  1LQD B;  3NPS A;  1ZHP A;  1SKY E;  1UVS H;  4VGC C;  3U9A H;  1XMN B;  3UR6 A;  3BTK E;  1S6H A;  1FDP A;  3PO1 B;  3SOR A;  1V2N T;  1XX9 A;  1HUT H;  3ELA H;  3RXG A;  1EUF A;  4JMY A;  3KQE A;  3K6Y A;  8GCH G;  3SGB E;  1HDT H;  1VR1 H;  1EZS C;  3D49 H;  4YOG A;  4B2B A;  1O3K A;  1C2K A;  4CRF A;  1BRB E;  5I46 H;  3P95 A;  2ZF0 H;  1MAX A;  1O5E H;  2VIP A;  3WY8 A;  1C5U A;  2V35 A;  4I8G A;  4DVA U;  3SUG A;  3UWJ H;  2GTB A;  4CRE A;  4K8B A;  1UTK A;  1THS H;  1OWI A;  1YYY 1;  2WV9 A;  1A5I A;  2VGC B;  4ZHL U;  1E34 B;  4MDS A;  5GWZ A;  1AHT H;  1TPA E;  1DWC H;  3GYL B;  4U01 A;  3A8C A;  3OY6 U;  2BLV A;  2ZU4 A;  2JDI D;  3HKJ B;  4IC5 A;  2P93 A;  2VWN A;  4AGK A;  3OYP A;  3GCN A;  1BOQ A;  5FCK A;  1SLU B;  3SU2 A;  1ESA A;  4WMF A;  5EXN A;  3LT3 A;  3DSP A;  3MTY A;  4I31 A;  1EAU A;  1HJA B;  3BEU A;  5FBE A;  2OQU A;  3MFJ A;  1OOK B;  5GCH F;  1RIW B;  1GI4 A;  2TRM A;  2QXI A;  2O8U A;  4UFE H;  3FAN A;  1AQ7 A;  3UWI A;  3LKW A;  1EP6 A;  2BY6 X;  1O2W A;  3ZV9 A;  2G51 A;  3MH7 A;  2A32 A;  1SBW A;  4TYD A;  1SLX B;  4X0W U;  1RTL A;  5EJL A;  1S0R A;  3SQH E;  3EQ0 H;  1ZJK A;  1K1O A;  1CHO F;  1EST A;  1C4V 2;  3I29 A;  1LQE A;  1MAB B;  1KLJ H;  3A7Y A;  4ZAE A;  3ATL A;  2KCY A;  2EI8 A;  2J38 A;  4M9F A;  1F0R A;  3FZD A;  4FUF A;  3F6U H;  2ALP A;  3BIU H;  1GPZ A;  2Z9K A;  5A8Z A;  1GDN A;  1NPM A;  1NT1 A;  2FDA A;  2XCN A;  3BG4 C;  4DUR A;  4JYV H;  2GDD A;  1YCP M;  3KQB A;  4ZCN A;  1O2V A;  5HM2 A;  2HLC A;  1G3D A;  2W5E A;  1SGC A;  1O3L A;  1MAY A;  1P3E A;  2FTL E;  1Z1I A;  2ZDA H;  1J17 T;  3SI4 H;  4A92 A;  4MPW A;  4CRB A;  2R0L A;  3KYG A;  1GJ5 H;  2HLD D;  3VXF H;  1D6R A;  2C3S A;  3BIV H;  3P8F A;  1YC0 A;  4ABJ A;  6GCH G;  2JH5 D;  2J98 B;  1ELT A;  2HNT F;  1INC A;  1AFQ B;  2BY9 X;  1XM1 A;  1LVY A;  1O2T A;  3QZR A;  1GHY H;  1NM6 A;  2FP7 B;  1FX0 B;  2G4T A;  1E1R D;  5T6G A;  1W7X H;  1J14 A;  4BAK B;  1YPE H;  5GJ4 B;  1YF4 A;  3K6Z A;  2GX4 A;  1A5G H;  4TT3 D;  2PR3 A;  1O3D A;  4OS5 A;  3OX7 U;  5C0U A;  2FOC A;  3BN9 A;  2BB4 A;  3R3G B;  5C1U A;  1ZZZ A;  2IPQ X;  5FL7 D;  1ACB E;  2H9H A;  3E8L A;  5DP9 A;  1UHB B;  1H8I H;  2J2U A;  1BIO A;  1RTF B;  1SR5 C;  1WBG B;  4X1N U;  1F7Z A;  2A0Q B;  1RXP A;  3F9E A;  4WME A;  5FX6 A;  4A1T A;  2ZFF H;  3VEQ B;  2G5N A;  5FBI A;  2A4R A;  3CS0 A;  5JB8 S;  1EZQ A;  1MQ6 A;  1MUE B;  1N8O C;  2KCO A;  5E2P A;  2ZG0 H;  1TNL A;  2ZHE H;  4YOI A;  4NSV A;  2QF4 A;  1HIA B;  2AH4 X;  3SV7 A;  2GT8 A;  4YO9 A;  1V2T T;  4O97 A;  1SGI B;  2QN5 T;  1D6W A;  1LHD H;  3Q3Y A;  3W1E A;  2F3C E;  3PM3 A;  1MTU A;  1TRM A;  1HAI H;  5EQQ A;  3EDX B;  2HVX A;  2A5A A;  1QQU A;  2FI3 E;  4MVN A;  2GVF A;  4AG1 A;  3BG4 B;  1A0L A;  1BMF D;  1O36 A;  4ZKS U;  2ZGB H;  4Q4L A;  1VGC C;  3DFL A;  1S6F A;  1GWA A;  3A7T A;  1O3E A;  1O35 A;  1ZLR A;  2FZZ A;  2QXH A;  3RMM H;  4IN2 A;  3MNB A;  2CGA A;  5BRR E;  1C5O H;  2ZU2 A;  4I86 A;  3GCH B;  1AY6 H;  4CRC A;  1GG6 C;  3AAU A;  5EW2 H;  7KME H;  3A89 A;  3QK1 A;  3M35 A;  4UD9 H;  3U8T H;  1CT2 E;  1O5B B;  3P17 H;  3KCG H;  1HAV B;  2J5U A;  2BXT H;  4D8N A;  5A0A E;  9LPR A;  1F92 A;  3UQV A;  1BQY A;  3Q76 A;  4JZ1 A;  3F1S B;  3ENS B;  1TB6 H;  3BEF B;  4NG9 H;  3M36 A;  2BOK A;  1H9H E;  1AB9 B;  1IAU A;  4FU7 A;  1ARC A;  1KDQ B;  4EST E;  3NUM A;  5EXM A;  2W6J D;  1T8L A;  1FUJ A;  1CHG A;  1VCW A;  3RP2 A;  4FUD A;  2XXL A;  1YPJ H;  3S7K B;  2P3U B;  5JDU B;  1GVZ A;  2XNI A;  2BM2 A;  2A1D B;  3DCL A;  3F3B A;  1XUI A;  4I33 A;  2TBS A;  1ZPC A;  3EA9 A;  1FN6 A;  1D3Q B;  2FXR A;  4HI3 A;  3SV9 A;  2ZTX A;  1OWK A;  1FXY A;  3PV2 A;  1MZA A;  2B0F A;  1P57 B;  1L1J A;  1KXA A;  4NIW A;  1P06 A;  5L6N H;  1ZSL A;  3HK3 B;  4D76 A;  2CV3 A;  1BRU P;  4BNR A;  1QBN A;  3Q3K A;  1VJA U;  2B5T B;  1GBT A;  1KTT B;  2R3Y A;  1AI8 H;  1O2R A;  1QRX A;  2STB E;  1NY2 2;  2VH6 A;  3GDU A;  4ISL A;  1TX7 A;  4DII H;  4R0I A;  2G52 A;  3F9F A;  1C9T A;  1VGC B;  2YMS B;  4FXG H;  2ZCL P;  2BD7 A;  1EB2 A;  2ULL A;  2WPL S;  1QHR B;  3ZZA A;  2F43 B;  1ZMN A;  1CSO E;  5EG4 A;  5DG6 A;  2WPM S;  2CXV A;  4Y8X A;  1S5S A;  1HV7 A;  4OS4 A;  1ELD E;  1GG6 B;  4ISO A;  1NU7 B;  2G00 A;  1Y59 T;  2H2Z A;  1SB1 H;  3TNS A;  4HTC H;  4IC6 A;  2FLR H;  2ALV A;  1HBT H;  4BOH A;  4JYT A;  4FOU C;  4B75 A;  2R9P A;  1ZML A;  3CP7 A;  1SQO A;  2BDI A;  2LNC A;  1K1I A;  1BHX B;  5F8T A;  4AOQ A;  1YPK H;  3ZZ8 A;  4AGJ A;  3B23 B;  2V7Q D;  2V3M A;  2A2X H;  2Z9J A;  4DT7 B;  3AK5 A;  1C5N H;  3N7E A;  1LTO A;  3HGP A;  2IJO B;  3RXI A;  1K0H A;  2UWO A;  1B0E A;  1O3F A;  1YPH C;  2J98 A;  1FJS A;  4A7I B;  2FES H;  1EJM A;  1O31 A;  1ELF A;  2JET C;  1GBA A;  1T7C A;  2PFE A;  4TSF D;  1O2J A;  3L3T A;  2FX4 A;  1VIT G;  4Y7B A;  2C8X B;  4INH A;  1O38 A;  1C2J A;  3RMN H;  1GI1 A;  2F4L A;  3UB0 A;  4PRO A;  3FFG A;  5T1V A;  1PQ8 A;  2ZPR A;  2BVR H;  1G32 B;  1WCZ A;  2ZQ1 A;  3SZE A;  2QXJ A; 
#chains in the Genus database with same CATH homology
 3U28 C;  3UAI C;  2RFK C;  2V3M A;  2EY4 C;  2EQN A;  2HVY B;  3MQK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...