3MQLA

Crystal structure of the fibronectin 6fni1-2fnii7fni fragment
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
209
structure length
209
Chain Sequence
YGDCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibronectin 1
publication title Implications for collagen binding from the crystallographic structure of fibronectin 6FnI1-2FnII7FnI
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 38
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00039 fn1 Fibronectin type I domain
A PF00040 fn2 Fibronectin type II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 3mqlA03
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 3mqlA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3mqlA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3mqlA04
2EC3A 1PDCA 4AYEA 5HZPB 1QO6A 1CXWA 4KKDA 1HFHA 2LOJA 3TVJA 1LY2A 1SRZA 4B2SA 3IX0A 5I0QB 2RL0A 4A5WB 4F4OC 2KMSA 2XWJI 2XRDA 1E5GA 3GOVA 2JGWA 1PPQA 2YRAA 3L89M 1HFIA 1GPZA 3R62A 4ONTD 2XWBF 3EJHA 1MD7A 4WJG2 1TPGA 1GKNA 1J7MA 2FN2A 1MD8A 3SW0X 2IZ4A 1NWVA 1H8PA 5FO8C 1Q3XA 2UWNA 2B5ID 2XQWC 3KZJA 1QUBA 1VVDA 1UOTP 2RKZA 1ZJKA 2RKYA 1SS2A 1H2QP 2CG6A 2W81A 1OK2A 4LOSA 4YNXA 1H04P 4J38B 1G4GA 3OEDC 1ELVA 4AYDA 3OP8A 2XRBA 1OJYA 1H2PP 2RLPA 5JPMG 4K12A 1O9AA 3KXVA 2W80A 3T5OA 4MUCA 2BZMA 4AYMA 4C16A 4B2RA 1E8BA 2A55A 1Z92B 1EAKA 1FBRA 1TPNA 3INBC 3ERBA 2CKUA 1CKLA 1CK7A 3GXEA 3MQLA 5HYPA 2G7IA 2MCYA 2ERJA 4PZ5A 3M7PA 1G4FA 1L6JA 1VVCA 3ZD2A 2V5OA 1OJVA 1H03P 1OK3A 4AYIA 1C1ZA 1TPMA 4LOTA 1GKGA 3ZD1A 1OK9A 3O8EB 3OXUD 1HCCA 1E88A 4ZH1D 2JGXA 2RLQA 2KRIA 1U5MA 5HYUB 1KS0A 2MCZA 3RJ3D 2IZ3A 2CG7A 1GXDA 2O39C 2EHFA 3IU3I 2JRAA 3NFPI 4IGDA 1OK1A 2V8EA 3CALA 4JHSA 4CSYA 2WIIC 3ZRZA 1GHQB 2YBYA 4FXGG 5HYTB 4DJZA 2QY0A 1OJWA 1QGBA
chains in the Genus database with same CATH superfamily
2EC3A 4OJPA 2ZYCA 1PDCA 3HSHA 4Z2IA 4AYEA 4NZ3A 5HZPB 1QO6A 1CXWA 3WD1A 4KKDA 1HFHA 2LOJA 3TVJA 4Z2HA 1H0IA 4NYYA 3L29A 3L27A 1LY2A 1SRZA 4IBCA 5DN5A 3IX0A 1W1TA 3CI0J 4B2SA 5I0QB 2RL0A 3F6KA 2Y2QA 4A5WB 4F4OC 1E6RA 2KMSA 3WSXA 2XWJI 2XRDA 1E5GA 3NJAA 4IJEA 3GOVA 2Y2MA 2JGWA 1PPQA 1UR9A 1RLHA 2X2ZA 2YRAA 3L89M 3L28A 1OGGA 4HMCA 3ZLDA 3ZLEA 2JCHA 4GH9A 1HFIA 1GPZA 3R62A 4ONTD 2XWBF 3EJHA 4IBJA 3WD0A 4IBKA 1MD7A 2I2LA 1E6ZA 4OJ6A 4WJG2 1TPGA 1GKNA 1J7MA 2FFFB 4HMEA 4NY2A 2FN2A 1MD8A 3SW0X 3L26A 2IZ4A 1NWVA 1H8PA 4QNLA 5FO8C 1Q3XA 2UWNA 2B5ID 2XQWC 3KZJA 1W1YA 3L25A 4IBIA 2Y2JA 1QUBA 4PO7A 2Y2LA 1VVDA 1UOTP 2RKZA 1ZJKA 2Y2HA 2RKYA 3K3TA 1SS2A 1H2QP 2CG6A 2W81A 1OK2A 4LOSA 4YNXA 1H04P 4J38B 4TX8A 1G4GA 1ELVA 3OEDC 4MB4A 4AYDA 4GHAA 4OUIA 3OP8A 1W1PA 3WD4A 2XRBA 1OJYA 2Y2NA 1H2PP 2XD5A 4GHLA 2RLPA 5JPMG 2Y8TA 4K12A 1O9AA 3KXVA 2W80A 2JE5A 3FKEA 1YUEA 3T5OA 3KS4A 2Y8SA 4OJLA 2D49A 2BZMA 4MUCA 4OJOA 4AYMA 4C16A 5DN4A 4IJFA 4B2RA 1E8BA 2UWXA 4HMDA 2A55A 4NZ4A 3N3FA 1W1VA 1Z92B 1EAKA 1FBRA 3L2AA 1TPNA 1YU2A 3INBC 3ERBA 2CKUA 1CKLA 4N7EA 1H0GA 4IBEA 1CK7A 1YU3A 3KS8A 2Y2IA 2Y2GA 3GXEA 3MQLA 5HYPA 4NYUA 2G7IA 2MCYA 2ERJA 1E6PA 3M7PA 1AIWA 1L6JA 4PZ5A 1G4FA 1VVCA 2RTSA 2V5OA 3ZD2A 1OJVA 2Y8RA 4IBDA 1H03P 1OK3A 4MB5A 4YIZA 2XD1A 3FGTA 4MB3A 4OJ5A 1C1ZA 3HONA 1TPMA 4LOTA 4AYIA 3VWOA 3ZD1A 1GKGA 3WD3A 1OK9A 4NZ5A 1ED7A 3O8EB 3OXUD 1HCCA 2Y2PA 1E88A 4ZH1D 1GOIA 2JGXA 2RLQA 4NZ1A 1OGBA 1YU1A 4IBGA 4LG2A 1U5MA 1KS0A 4Z2LA 2KRIA 5HYUB 4Z2JA 1E6NA 2MCZA 3RJ3D 1YU0A 2IZ3A 2CG7A 1GXDA 2BG1A 2O39C 1UR8A 3FGRA 2EHFA 3IU3I 2JRAA 3NFPI 4IGDA 1OK1A 4IBBA 2V8EA 3CALA 4JHSA 2WIIC 3WX7A 4CSYA 4Z2GA 3ZRZA 4MSLA 5BPVA 1GHQB 2YBYA 1GPFA 4IBFA 3WD2A 4FXGG 1O6IA 2Y2OA 1E15A 1YU4A 2QY0A 3WSYA 4DJZA 2IOUA 5HYTB 4BWCA 4Z2KA 4APLA 1OJWA 1QGBA 2Y2KA
chains in the Genus database with same CATH topology
2EC3A 1PDCA 4AYEA 5HZPB 1QO6A 1CXWA 4KKDA 1HFHA 2LOJA 3TVJA 1LY2A 1SRZA 4B2SA 3IX0A 5I0QB 2RL0A 4A5WB 4F4OC 2KMSA 2XWJI 2XRDA 1E5GA 3GOVA 2JGWA 1PPQA 2YRAA 3L89M 1HFIA 1GPZA 3R62A 4ONTD 2XWBF 3EJHA 1MD7A 4WJG2 1TPGA 1GKNA 1J7MA 2FN2A 1MD8A 3SW0X 2IZ4A 1NWVA 1H8PA 5FO8C 1Q3XA 2UWNA 2B5ID 2XQWC 3KZJA 1QUBA 1VVDA 1UOTP 2RKZA 1ZJKA 2RKYA 1SS2A 1H2QP 2CG6A 2W81A 1OK2A 4LOSA 4YNXA 1H04P 4J38B 1G4GA 3OEDC 1ELVA 4AYDA 3OP8A 2XRBA 1OJYA 1H2PP 2RLPA 5JPMG 4K12A 1O9AA 3KXVA 2W80A 3T5OA 4MUCA 2BZMA 4AYMA 4C16A 4B2RA 1E8BA 2A55A 1Z92B 1EAKA 1FBRA 1TPNA 3INBC 3ERBA 2CKUA 1CKLA 1CK7A 3GXEA 3MQLA 5HYPA 2G7IA 2MCYA 2ERJA 4PZ5A 3M7PA 1G4FA 1L6JA 1VVCA 3ZD2A 2V5OA 1OJVA 1H03P 1OK3A 4AYIA 1C1ZA 1TPMA 4LOTA 1GKGA 3ZD1A 1OK9A 3O8EB 3OXUD 1HCCA 1E88A 4ZH1D 2JGXA 2RLQA 2KRIA 1U5MA 5HYUB 1KS0A 2MCZA 3RJ3D 2IZ3A 2CG7A 1GXDA 2O39C 2EHFA 3IU3I 2JRAA 3NFPI 4IGDA 1OK1A 2V8EA 3CALA 4JHSA 4CSYA 2WIIC 3ZRZA 1GHQB 2YBYA 4FXGG 5HYTB 4DJZA 2QY0A 1OJWA 1QGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EC3 A;  1PDC A;  4AYE A;  5HZP B;  1QO6 A;  1CXW A;  4KKD A;  1HFH A;  2LOJ A;  3TVJ A;  1LY2 A;  1SRZ A;  4B2S A;  3IX0 A;  5I0Q B;  2RL0 A;  4A5W B;  4F4O C;  2KMS A;  2XWJ I;  2XRD A;  1E5G A;  3GOV A;  2JGW A;  1PPQ A;  2YRA A;  3L89 M;  1HFI A;  1GPZ A;  3R62 A;  4ONT D;  2XWB F;  3EJH A;  1MD7 A;  4WJG 2;  1TPG A;  1GKN A;  1J7M A;  2FN2 A;  1MD8 A;  3SW0 X;  2IZ4 A;  1NWV A;  1H8P A;  5FO8 C;  1Q3X A;  2UWN A;  2B5I D;  2XQW C;  3KZJ A;  1QUB A;  1VVD A;  1UOT P;  2RKZ A;  1ZJK A;  2RKY A;  1SS2 A;  1H2Q P;  2CG6 A;  2W81 A;  1OK2 A;  4LOS A;  4YNX A;  1H04 P;  4J38 B;  1G4G A;  3OED C;  1ELV A;  4AYD A;  3OP8 A;  2XRB A;  1OJY A;  1H2P P;  2RLP A;  5JPM G;  4K12 A;  1O9A A;  3KXV A;  2W80 A;  3T5O A;  4MUC A;  2BZM A;  4AYM A;  4C16 A;  4B2R A;  1E8B A;  2A55 A;  1Z92 B;  1EAK A;  1FBR A;  1TPN A;  3INB C;  3ERB A;  2CKU A;  1CKL A;  1CK7 A;  3GXE A;  3MQL A;  5HYP A;  2G7I A;  2MCY A;  2ERJ A;  4PZ5 A;  3M7P A;  1G4F A;  1L6J A;  1VVC A;  3ZD2 A;  2V5O A;  1OJV A;  1H03 P;  1OK3 A;  4AYI A;  1C1Z A;  1TPM A;  4LOT A;  1GKG A;  3ZD1 A;  1OK9 A;  3O8E B;  3OXU D;  1HCC A;  1E88 A;  4ZH1 D;  2JGX A;  2RLQ A;  2KRI A;  1U5M A;  5HYU B;  1KS0 A;  2MCZ A;  3RJ3 D;  2IZ3 A;  2CG7 A;  1GXD A;  2O39 C;  2EHF A;  3IU3 I;  2JRA A;  3NFP I;  4IGD A;  1OK1 A;  2V8E A;  3CAL A;  4JHS A;  4CSY A;  2WII C;  3ZRZ A;  1GHQ B;  2YBY A;  4FXG G;  5HYT B;  4DJZ A;  2QY0 A;  1OJW A;  1QGB A; 
#chains in the Genus database with same CATH topology
 2EC3 A;  4OJP A;  2ZYC A;  1PDC A;  3HSH A;  4Z2I A;  4AYE A;  4NZ3 A;  5HZP B;  1QO6 A;  1CXW A;  3WD1 A;  4KKD A;  1HFH A;  2LOJ A;  3TVJ A;  4Z2H A;  1H0I A;  4NYY A;  3L29 A;  3L27 A;  1LY2 A;  1SRZ A;  4IBC A;  5DN5 A;  3IX0 A;  1W1T A;  3CI0 J;  4B2S A;  5I0Q B;  2RL0 A;  3F6K A;  2Y2Q A;  4A5W B;  4F4O C;  1E6R A;  2KMS A;  3WSX A;  2XWJ I;  2XRD A;  1E5G A;  3NJA A;  4IJE A;  3GOV A;  2Y2M A;  2JGW A;  1PPQ A;  1UR9 A;  1RLH A;  2X2Z A;  2YRA A;  3L89 M;  3L28 A;  1OGG A;  4HMC A;  3ZLD A;  3ZLE A;  2JCH A;  4GH9 A;  1HFI A;  1GPZ A;  3R62 A;  4ONT D;  2XWB F;  3EJH A;  4IBJ A;  3WD0 A;  4IBK A;  1MD7 A;  2I2L A;  1E6Z A;  4OJ6 A;  4WJG 2;  1TPG A;  1GKN A;  1J7M A;  2FFF B;  4HME A;  4NY2 A;  2FN2 A;  1MD8 A;  3SW0 X;  3L26 A;  2IZ4 A;  1NWV A;  1H8P A;  4QNL A;  5FO8 C;  1Q3X A;  2UWN A;  2B5I D;  2XQW C;  3KZJ A;  1W1Y A;  3L25 A;  4IBI A;  2Y2J A;  1QUB A;  4PO7 A;  2Y2L A;  1VVD A;  1UOT P;  2RKZ A;  1ZJK A;  2Y2H A;  2RKY A;  3K3T A;  1SS2 A;  1H2Q P;  2CG6 A;  2W81 A;  1OK2 A;  4LOS A;  4YNX A;  1H04 P;  4J38 B;  4TX8 A;  1G4G A;  1ELV A;  3OED C;  4MB4 A;  4AYD A;  4GHA A;  4OUI A;  3OP8 A;  1W1P A;  3WD4 A;  2XRB A;  1OJY A;  2Y2N A;  1H2P P;  2XD5 A;  4GHL A;  2RLP A;  5JPM G;  2Y8T A;  4K12 A;  1O9A A;  3KXV A;  2W80 A;  2JE5 A;  3FKE A;  1YUE A;  3T5O A;  3KS4 A;  2Y8S A;  4OJL A;  2D49 A;  2BZM A;  4MUC A;  4OJO A;  4AYM A;  4C16 A;  5DN4 A;  4IJF A;  4B2R A;  1E8B A;  2UWX A;  4HMD A;  2A55 A;  4NZ4 A;  3N3F A;  1W1V A;  1Z92 B;  1EAK A;  1FBR A;  3L2A A;  1TPN A;  1YU2 A;  3INB C;  3ERB A;  2CKU A;  1CKL A;  4N7E A;  1H0G A;  4IBE A;  1CK7 A;  1YU3 A;  3KS8 A;  2Y2I A;  2Y2G A;  3GXE A;  3MQL A;  5HYP A;  4NYU A;  2G7I A;  2MCY A;  2ERJ A;  1E6P A;  3M7P A;  1AIW A;  1L6J A;  4PZ5 A;  1G4F A;  1VVC A;  2RTS A;  2V5O A;  3ZD2 A;  1OJV A;  2Y8R A;  4IBD A;  1H03 P;  1OK3 A;  4MB5 A;  4YIZ A;  2XD1 A;  3FGT A;  4MB3 A;  4OJ5 A;  1C1Z A;  3HON A;  1TPM A;  4LOT A;  4AYI A;  3VWO A;  3ZD1 A;  1GKG A;  3WD3 A;  1OK9 A;  4NZ5 A;  1ED7 A;  3O8E B;  3OXU D;  1HCC A;  2Y2P A;  1E88 A;  4ZH1 D;  1GOI A;  2JGX A;  2RLQ A;  4NZ1 A;  1OGB A;  1YU1 A;  4IBG A;  4LG2 A;  1U5M A;  1KS0 A;  4Z2L A;  2KRI A;  5HYU B;  4Z2J A;  1E6N A;  2MCZ A;  3RJ3 D;  1YU0 A;  2IZ3 A;  2CG7 A;  1GXD A;  2BG1 A;  2O39 C;  1UR8 A;  3FGR A;  2EHF A;  3IU3 I;  2JRA A;  3NFP I;  4IGD A;  1OK1 A;  4IBB A;  2V8E A;  3CAL A;  4JHS A;  2WII C;  3WX7 A;  4CSY A;  4Z2G A;  3ZRZ A;  4MSL A;  5BPV A;  1GHQ B;  2YBY A;  1GPF A;  4IBF A;  3WD2 A;  4FXG G;  1O6I A;  2Y2O A;  1E15 A;  1YU4 A;  2QY0 A;  3WSY A;  4DJZ A;  2IOU A;  5HYT B;  4BWC A;  4Z2K A;  4APL A;  1OJW A;  1QGB A;  2Y2K A; 
#chains in the Genus database with same CATH homology
 2EC3 A;  1PDC A;  4AYE A;  5HZP B;  1QO6 A;  1CXW A;  4KKD A;  1HFH A;  2LOJ A;  3TVJ A;  1LY2 A;  1SRZ A;  4B2S A;  3IX0 A;  5I0Q B;  2RL0 A;  4A5W B;  4F4O C;  2KMS A;  2XWJ I;  2XRD A;  1E5G A;  3GOV A;  2JGW A;  1PPQ A;  2YRA A;  3L89 M;  1HFI A;  1GPZ A;  3R62 A;  4ONT D;  2XWB F;  3EJH A;  1MD7 A;  4WJG 2;  1TPG A;  1GKN A;  1J7M A;  2FN2 A;  1MD8 A;  3SW0 X;  2IZ4 A;  1NWV A;  1H8P A;  5FO8 C;  1Q3X A;  2UWN A;  2B5I D;  2XQW C;  3KZJ A;  1QUB A;  1VVD A;  1UOT P;  2RKZ A;  1ZJK A;  2RKY A;  1SS2 A;  1H2Q P;  2CG6 A;  2W81 A;  1OK2 A;  4LOS A;  4YNX A;  1H04 P;  4J38 B;  1G4G A;  3OED C;  1ELV A;  4AYD A;  3OP8 A;  2XRB A;  1OJY A;  1H2P P;  2RLP A;  5JPM G;  4K12 A;  1O9A A;  3KXV A;  2W80 A;  3T5O A;  4MUC A;  2BZM A;  4AYM A;  4C16 A;  4B2R A;  1E8B A;  2A55 A;  1Z92 B;  1EAK A;  1FBR A;  1TPN A;  3INB C;  3ERB A;  2CKU A;  1CKL A;  1CK7 A;  3GXE A;  3MQL A;  5HYP A;  2G7I A;  2MCY A;  2ERJ A;  4PZ5 A;  3M7P A;  1G4F A;  1L6J A;  1VVC A;  3ZD2 A;  2V5O A;  1OJV A;  1H03 P;  1OK3 A;  4AYI A;  1C1Z A;  1TPM A;  4LOT A;  1GKG A;  3ZD1 A;  1OK9 A;  3O8E B;  3OXU D;  1HCC A;  1E88 A;  4ZH1 D;  2JGX A;  2RLQ A;  2KRI A;  1U5M A;  5HYU B;  1KS0 A;  2MCZ A;  3RJ3 D;  2IZ3 A;  2CG7 A;  1GXD A;  2O39 C;  2EHF A;  3IU3 I;  2JRA A;  3NFP I;  4IGD A;  1OK1 A;  2V8E A;  3CAL A;  4JHS A;  4CSY A;  2WII C;  3ZRZ A;  1GHQ B;  2YBY A;  4FXG G;  5HYT B;  4DJZ A;  2QY0 A;  1OJW A;  1QGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...