3MQLA

Crystal structure of the fibronectin 6fni1-2fnii7fni fragment
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
209
structure length
209
Chain Sequence
b'YGDCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibronectin 1
publication title Implications for collagen binding from the crystallographic structure of fibronectin 6FnI1-2FnII7FnI
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 38
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00039 fn1 Fibronectin type I domain
A PF00040 fn2 Fibronectin type II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 3mqlA03
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 3mqlA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3mqlA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3mqlA04
1QO6A 1OK9A 2W80A 2MCZA 3T5OA 1CKLA 1UOTP 2RKZA 2RKYA 3RJ3D 2ERJA 3O8EB 1HFHA 3MQLA 1MD8A 2XRBA 4MUCA 1VVCA 1H04P 4B2SA 1H2QP 2KMSA 3ERBA 1GXDA 1NWVA 2A55A 1E88A 1GKNA 4PZ5A 2FN2A 1KS0A 2BZMA 1U5MA 2EC3A 3CALA 2JGWA 1GHQB 3OP8A 3OEDC 3TVJA 4AYIA 1OJVA 2CG7A 5FO8C 2W81A 4A5WB 1GKGA 1C1ZA 1FBRA 1OJYA 3R62A 2XWJI 1H8PA 1SS2A 2V5OA 1L6JA 2CKUA 2LOJA 1OK3A 3OXUD 1Q3XA 2JGXA 4AYMA 3IU3I 1ZJKA 3GOVA 1E8BA 3INBC 4LOTA 5HYUB 1SRZA 3M7PA 4YNXA 1J7MA 2IZ4A 4F4OC 2V8EA 1HFIA 4AYDA 1TPNA 1HCCA 2WIIC 5HYPA 1O9AA 2CG6A 4AYEA 2IZ3A 4KKDA 1H03P 1QGBA 1OJWA 2YBYA 1H2PP 4IGDA 4JHSA 5HZPB 1QUBA 4K12A 2B5ID 1EAKA 1CK7A 1PPQA 3ZD1A 2UWNA 1OK1A 3EJHA 4FXGG 1LY2A 1CXWA 2RLPA 1TPGA 5JPMG 4B2RA 4ONTD 2MCYA 1PDCA 1GPZA 2EHFA 3NFPI 2JRAA 3KXVA 2KRIA 1MD7A 1OK2A 1Z92B 2YRAA 1TPMA 3ZD2A 3SW0X 1E5GA 1VVDA 5I0QB 1G4FA 1ELVA 2RLQA 2XRDA 2O39C 4J38B 4ZH1D 3L89M 3KZJA 5HYTB 4CSYA 3ZRZA 4C16A 2RL0A 4DJZA 1G4GA 2XWBF 3GXEA 3IX0A 4LOSA 2G7IA 4WJG2 2QY0A 2XQWC
chains in the Genus database with same CATH superfamily
1QO6A 4HMEA 4NZ1A 1OK9A 2MCZA 2W80A 3T5OA 1CKLA 4IBIA 5BPVA 1UOTP 2RKZA 4APLA 2FFFB 3HONA 2RKYA 4IBEA 2ERJA 3RJ3D 4IBDA 1HFHA 3O8EB 4PO7A 4Z2LA 3WD2A 2Y2HA 4Z2JA 4IBBA 1E6RA 3MQLA 4NYUA 1MD8A 2XRBA 4MUCA 1VVCA 1H04P 2QY0A 2Y2GA 4NY2A 4B2SA 3N3FA 1YU1A 3WD1A 4IBFA 5DN4A 4BWCA 4YIZA 1H2QP 1OGBA 1YUEA 4OJ5A 2KMSA 3ERBA 1GXDA 2D49A 2XD1A 1E88A 1NWVA 2A55A 2Y2MA 1W1PA 1YU4A 1GKNA 4PZ5A 2FN2A 4IBKA 3WD3A 1KS0A 1E6NA 2BZMA 1U5MA 1E15A 2EC3A 2JGWA 4GHLA 4HMDA 3CALA 1GHQB 4TX8A 3OEDC 3OP8A 3TVJA 4AYIA 1OJVA 2CG7A 5FO8C 2Y2JA 1W1YA 4Z2GA 2W81A 4A5WB 1GKGA 1C1ZA 2XQWC 2JCHA 1RLHA 1FBRA 4IBJA 1OJYA 3R62A 2Y8TA 2XWJI 1H8PA 3FKEA 1SS2A 2V5OA 2Y2NA 2Y2QA 3ZLDA 1L6JA 1W1VA 2CKUA 4NYYA 2LOJA 1AIWA 1OK3A 1Q3XA 2JGXA 3OXUD 4AYMA 2Y2IA 3IU3I 4IJEA 1ZJKA 2Y2KA 2Y8SA 5DN5A 3GOVA 1E8BA 2I2LA 3INBC 4LOTA 3WD4A 5HYUB 2JE5A 4NZ5A 1SRZA 2IOUA 3M7PA 4YNXA 1J7MA 2IZ4A 4F4OC 2V8EA 1HFIA 3WX7A 4AYDA 1E6PA 2UWXA 1TPNA 1HCCA 3KS8A 2WIIC 5HYPA 1O9AA 1GOIA 3WSYA 2CG6A 4AYEA 2IZ3A 4KKDA 4Z2IA 3F6KA 1H03P 3K3TA 1QGBA 1OJWA 1W1TA 4MSLA 2YBYA 1O6IA 3VWOA 1H2PP 4IGDA 4JHSA 1ED7A 2XD5A 5HZPB 4OJPA 1QUBA 4K12A 2B5ID 1EAKA 4Z2HA 1CK7A 2Y2OA 1PPQA 2ZYCA 3ZD1A 2UWNA 4MB3A 3CI0J 1OK1A 3L29A 3L2AA 3L26A 1UR9A 3WD0A 3EJHA 2Y2LA 4FXGG 1GPFA 1LY2A 1CXWA 2RLPA 4QNLA 3L25A 4OUIA 4IBCA 1TPGA 4B2RA 4ONTD 5JPMG 1YU2A 3L27A 2MCYA 1PDCA 4OJOA 1GPZA 4NZ4A 2EHFA 3NFPI 2JRAA 1YU0A 2KRIA 1MD7A 1OK2A 3KXVA 4GH9A 4NZ3A 1TPMA 1Z92B 2YRAA 3ZD2A 4LG2A 1VVDA 3SW0X 1E5GA 3KS4A 5I0QB 3FGRA 3WSXA 4OJLA 4MB5A 1G4FA 1ELVA 2RLQA 2XRDA 2O39C 4J38B 1H0IA 1OGGA 1UR8A 4IBGA 4Z2KA 3L89M 4ZH1D 4MB4A 3L28A 3KZJA 2RTSA 4HMCA 2Y8RA 3NJAA 4N7EA 3ZLEA 4CSYA 5HYTB 1H0GA 3ZRZA 4C16A 2RL0A 2X2ZA 4DJZA 1G4GA 2XWBF 3FGTA 3GXEA 3IX0A 4OJ6A 4GHAA 1E6ZA 4LOSA 4IJFA 2G7IA 4WJG2 2BG1A 3HSHA 1YU3A 2Y2PA
chains in the Genus database with same CATH topology
1QO6A 1OK9A 2W80A 2MCZA 3T5OA 1CKLA 1UOTP 2RKZA 2RKYA 3RJ3D 2ERJA 3O8EB 1HFHA 3MQLA 1MD8A 2XRBA 4MUCA 1VVCA 1H04P 4B2SA 1H2QP 2KMSA 3ERBA 1GXDA 1NWVA 2A55A 1E88A 1GKNA 4PZ5A 2FN2A 1KS0A 2BZMA 1U5MA 2EC3A 3CALA 2JGWA 1GHQB 3OP8A 3OEDC 3TVJA 4AYIA 1OJVA 2CG7A 5FO8C 2W81A 4A5WB 1GKGA 1C1ZA 1FBRA 1OJYA 3R62A 2XWJI 1H8PA 1SS2A 2V5OA 1L6JA 2CKUA 2LOJA 1OK3A 3OXUD 1Q3XA 2JGXA 4AYMA 3IU3I 1ZJKA 3GOVA 1E8BA 3INBC 4LOTA 5HYUB 1SRZA 3M7PA 4YNXA 1J7MA 2IZ4A 4F4OC 2V8EA 1HFIA 4AYDA 1TPNA 1HCCA 2WIIC 5HYPA 1O9AA 2CG6A 4AYEA 2IZ3A 4KKDA 1H03P 1QGBA 1OJWA 2YBYA 1H2PP 4IGDA 4JHSA 5HZPB 1QUBA 4K12A 2B5ID 1EAKA 1CK7A 1PPQA 3ZD1A 2UWNA 1OK1A 3EJHA 4FXGG 1LY2A 1CXWA 2RLPA 1TPGA 5JPMG 4B2RA 4ONTD 2MCYA 1PDCA 1GPZA 2EHFA 3NFPI 2JRAA 3KXVA 2KRIA 1MD7A 1OK2A 1Z92B 2YRAA 1TPMA 3ZD2A 3SW0X 1E5GA 1VVDA 5I0QB 1G4FA 1ELVA 2RLQA 2XRDA 2O39C 4J38B 4ZH1D 3L89M 3KZJA 5HYTB 4CSYA 3ZRZA 4C16A 2RL0A 4DJZA 1G4GA 2XWBF 3GXEA 3IX0A 4LOSA 2G7IA 4WJG2 2QY0A 2XQWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QO6 A;  1OK9 A;  2W80 A;  2MCZ A;  3T5O A;  1CKL A;  1UOT P;  2RKZ A;  2RKY A;  3RJ3 D;  2ERJ A;  3O8E B;  1HFH A;  3MQL A;  1MD8 A;  2XRB A;  4MUC A;  1VVC A;  1H04 P;  4B2S A;  1H2Q P;  2KMS A;  3ERB A;  1GXD A;  1NWV A;  2A55 A;  1E88 A;  1GKN A;  4PZ5 A;  2FN2 A;  1KS0 A;  2BZM A;  1U5M A;  2EC3 A;  3CAL A;  2JGW A;  1GHQ B;  3OP8 A;  3OED C;  3TVJ A;  4AYI A;  1OJV A;  2CG7 A;  5FO8 C;  2W81 A;  4A5W B;  1GKG A;  1C1Z A;  1FBR A;  1OJY A;  3R62 A;  2XWJ I;  1H8P A;  1SS2 A;  2V5O A;  1L6J A;  2CKU A;  2LOJ A;  1OK3 A;  3OXU D;  1Q3X A;  2JGX A;  4AYM A;  3IU3 I;  1ZJK A;  3GOV A;  1E8B A;  3INB C;  4LOT A;  5HYU B;  1SRZ A;  3M7P A;  4YNX A;  1J7M A;  2IZ4 A;  4F4O C;  2V8E A;  1HFI A;  4AYD A;  1TPN A;  1HCC A;  2WII C;  5HYP A;  1O9A A;  2CG6 A;  4AYE A;  2IZ3 A;  4KKD A;  1H03 P;  1QGB A;  1OJW A;  2YBY A;  1H2P P;  4IGD A;  4JHS A;  5HZP B;  1QUB A;  4K12 A;  2B5I D;  1EAK A;  1CK7 A;  1PPQ A;  3ZD1 A;  2UWN A;  1OK1 A;  3EJH A;  4FXG G;  1LY2 A;  1CXW A;  2RLP A;  1TPG A;  5JPM G;  4B2R A;  4ONT D;  2MCY A;  1PDC A;  1GPZ A;  2EHF A;  3NFP I;  2JRA A;  3KXV A;  2KRI A;  1MD7 A;  1OK2 A;  1Z92 B;  2YRA A;  1TPM A;  3ZD2 A;  3SW0 X;  1E5G A;  1VVD A;  5I0Q B;  1G4F A;  1ELV A;  2RLQ A;  2XRD A;  2O39 C;  4J38 B;  4ZH1 D;  3L89 M;  3KZJ A;  5HYT B;  4CSY A;  3ZRZ A;  4C16 A;  2RL0 A;  4DJZ A;  1G4G A;  2XWB F;  3GXE A;  3IX0 A;  4LOS A;  2G7I A;  4WJG 2;  2QY0 A;  2XQW C; 
#chains in the Genus database with same CATH topology
 1QO6 A;  4HME A;  4NZ1 A;  1OK9 A;  2MCZ A;  2W80 A;  3T5O A;  1CKL A;  4IBI A;  5BPV A;  1UOT P;  2RKZ A;  4APL A;  2FFF B;  3HON A;  2RKY A;  4IBE A;  2ERJ A;  3RJ3 D;  4IBD A;  1HFH A;  3O8E B;  4PO7 A;  4Z2L A;  3WD2 A;  2Y2H A;  4Z2J A;  4IBB A;  1E6R A;  3MQL A;  4NYU A;  1MD8 A;  2XRB A;  4MUC A;  1VVC A;  1H04 P;  2QY0 A;  2Y2G A;  4NY2 A;  4B2S A;  3N3F A;  1YU1 A;  3WD1 A;  4IBF A;  5DN4 A;  4BWC A;  4YIZ A;  1H2Q P;  1OGB A;  1YUE A;  4OJ5 A;  2KMS A;  3ERB A;  1GXD A;  2D49 A;  2XD1 A;  1E88 A;  1NWV A;  2A55 A;  2Y2M A;  1W1P A;  1YU4 A;  1GKN A;  4PZ5 A;  2FN2 A;  4IBK A;  3WD3 A;  1KS0 A;  1E6N A;  2BZM A;  1U5M A;  1E15 A;  2EC3 A;  2JGW A;  4GHL A;  4HMD A;  3CAL A;  1GHQ B;  4TX8 A;  3OED C;  3OP8 A;  3TVJ A;  4AYI A;  1OJV A;  2CG7 A;  5FO8 C;  2Y2J A;  1W1Y A;  4Z2G A;  2W81 A;  4A5W B;  1GKG A;  1C1Z A;  2XQW C;  2JCH A;  1RLH A;  1FBR A;  4IBJ A;  1OJY A;  3R62 A;  2Y8T A;  2XWJ I;  1H8P A;  3FKE A;  1SS2 A;  2V5O A;  2Y2N A;  2Y2Q A;  3ZLD A;  1L6J A;  1W1V A;  2CKU A;  4NYY A;  2LOJ A;  1AIW A;  1OK3 A;  1Q3X A;  2JGX A;  3OXU D;  4AYM A;  2Y2I A;  3IU3 I;  4IJE A;  1ZJK A;  2Y2K A;  2Y8S A;  5DN5 A;  3GOV A;  1E8B A;  2I2L A;  3INB C;  4LOT A;  3WD4 A;  5HYU B;  2JE5 A;  4NZ5 A;  1SRZ A;  2IOU A;  3M7P A;  4YNX A;  1J7M A;  2IZ4 A;  4F4O C;  2V8E A;  1HFI A;  3WX7 A;  4AYD A;  1E6P A;  2UWX A;  1TPN A;  1HCC A;  3KS8 A;  2WII C;  5HYP A;  1O9A A;  1GOI A;  3WSY A;  2CG6 A;  4AYE A;  2IZ3 A;  4KKD A;  4Z2I A;  3F6K A;  1H03 P;  3K3T A;  1QGB A;  1OJW A;  1W1T A;  4MSL A;  2YBY A;  1O6I A;  3VWO A;  1H2P P;  4IGD A;  4JHS A;  1ED7 A;  2XD5 A;  5HZP B;  4OJP A;  1QUB A;  4K12 A;  2B5I D;  1EAK A;  4Z2H A;  1CK7 A;  2Y2O A;  1PPQ A;  2ZYC A;  3ZD1 A;  2UWN A;  4MB3 A;  3CI0 J;  1OK1 A;  3L29 A;  3L2A A;  3L26 A;  1UR9 A;  3WD0 A;  3EJH A;  2Y2L A;  4FXG G;  1GPF A;  1LY2 A;  1CXW A;  2RLP A;  4QNL A;  3L25 A;  4OUI A;  4IBC A;  1TPG A;  4B2R A;  4ONT D;  5JPM G;  1YU2 A;  3L27 A;  2MCY A;  1PDC A;  4OJO A;  1GPZ A;  4NZ4 A;  2EHF A;  3NFP I;  2JRA A;  1YU0 A;  2KRI A;  1MD7 A;  1OK2 A;  3KXV A;  4GH9 A;  4NZ3 A;  1TPM A;  1Z92 B;  2YRA A;  3ZD2 A;  4LG2 A;  1VVD A;  3SW0 X;  1E5G A;  3KS4 A;  5I0Q B;  3FGR A;  3WSX A;  4OJL A;  4MB5 A;  1G4F A;  1ELV A;  2RLQ A;  2XRD A;  2O39 C;  4J38 B;  1H0I A;  1OGG A;  1UR8 A;  4IBG A;  4Z2K A;  3L89 M;  4ZH1 D;  4MB4 A;  3L28 A;  3KZJ A;  2RTS A;  4HMC A;  2Y8R A;  3NJA A;  4N7E A;  3ZLE A;  4CSY A;  5HYT B;  1H0G A;  3ZRZ A;  4C16 A;  2RL0 A;  2X2Z A;  4DJZ A;  1G4G A;  2XWB F;  3FGT A;  3GXE A;  3IX0 A;  4OJ6 A;  4GHA A;  1E6Z A;  4LOS A;  4IJF A;  2G7I A;  4WJG 2;  2BG1 A;  3HSH A;  1YU3 A;  2Y2P A; 
#chains in the Genus database with same CATH homology
 1QO6 A;  1OK9 A;  2W80 A;  2MCZ A;  3T5O A;  1CKL A;  1UOT P;  2RKZ A;  2RKY A;  3RJ3 D;  2ERJ A;  3O8E B;  1HFH A;  3MQL A;  1MD8 A;  2XRB A;  4MUC A;  1VVC A;  1H04 P;  4B2S A;  1H2Q P;  2KMS A;  3ERB A;  1GXD A;  1NWV A;  2A55 A;  1E88 A;  1GKN A;  4PZ5 A;  2FN2 A;  1KS0 A;  2BZM A;  1U5M A;  2EC3 A;  3CAL A;  2JGW A;  1GHQ B;  3OP8 A;  3OED C;  3TVJ A;  4AYI A;  1OJV A;  2CG7 A;  5FO8 C;  2W81 A;  4A5W B;  1GKG A;  1C1Z A;  1FBR A;  1OJY A;  3R62 A;  2XWJ I;  1H8P A;  1SS2 A;  2V5O A;  1L6J A;  2CKU A;  2LOJ A;  1OK3 A;  3OXU D;  1Q3X A;  2JGX A;  4AYM A;  3IU3 I;  1ZJK A;  3GOV A;  1E8B A;  3INB C;  4LOT A;  5HYU B;  1SRZ A;  3M7P A;  4YNX A;  1J7M A;  2IZ4 A;  4F4O C;  2V8E A;  1HFI A;  4AYD A;  1TPN A;  1HCC A;  2WII C;  5HYP A;  1O9A A;  2CG6 A;  4AYE A;  2IZ3 A;  4KKD A;  1H03 P;  1QGB A;  1OJW A;  2YBY A;  1H2P P;  4IGD A;  4JHS A;  5HZP B;  1QUB A;  4K12 A;  2B5I D;  1EAK A;  1CK7 A;  1PPQ A;  3ZD1 A;  2UWN A;  1OK1 A;  3EJH A;  4FXG G;  1LY2 A;  1CXW A;  2RLP A;  1TPG A;  5JPM G;  4B2R A;  4ONT D;  2MCY A;  1PDC A;  1GPZ A;  2EHF A;  3NFP I;  2JRA A;  3KXV A;  2KRI A;  1MD7 A;  1OK2 A;  1Z92 B;  2YRA A;  1TPM A;  3ZD2 A;  3SW0 X;  1E5G A;  1VVD A;  5I0Q B;  1G4F A;  1ELV A;  2RLQ A;  2XRD A;  2O39 C;  4J38 B;  4ZH1 D;  3L89 M;  3KZJ A;  5HYT B;  4CSY A;  3ZRZ A;  4C16 A;  2RL0 A;  4DJZ A;  1G4G A;  2XWB F;  3GXE A;  3IX0 A;  4LOS A;  2G7I A;  4WJG 2;  2QY0 A;  2XQW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...