3MQZA

Crystal structure of conserved protein duf1054 from pink subaerial biofilm microbial leptospirillum sp. group ii uba.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
205
structure length
205
Chain Sequence
b'IERLQDYLLPEWVSIFDIADFSGRMLRIRGDIRPALLRLASRLAELLNESPGPRPWYPHVASHMRRRVNPPPETWLALGPEKRGYKSYAHSGVFIGGRGLSVRFILKDEAIEERKNLGRWMSRSGPAFEQWKKKVGDLRDFGPVHDDPMADPPKVEWDPRVFGERLGSLKSASLDIGFRVTFDTSLAGIVKTIRTFDLLYAEAEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized Conserved Protein DUF1054
publication title Crystal Structure of Conserved Protein DUF1054 from Pink Subaerial Biofilm Microbial Leptospirillum sp. Group II UBA.
rcsb
source organism Leptospirillum rubarum
molecule tags Structural genomics, unknown function
total genus 64
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2010-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.20 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 3mqzA00
2A8EA 3MQZA
chains in the Genus database with same CATH superfamily
2ZT5A 1BBUA 4AH6A 1H4VB 2EJ9A 3MF2A 2Q7GA 3HXUA 4RQEA 3E9HA 2ZXFA 3HFVA 1E24A 1EVKA 2E65A 2AMCB 4HWOA 4P3NA 2CJAA 3VQYA 5K1PA 1USYA 4P75A 4WI1A 4YPFA 2HNIA 4G84A 3NENA 2ODRD 1EIYB 3L4GA 4H2XA 4CH5A 4RDXA 3RKXA 3MEYA 4LNSA 3HXVA 2DTIA 1PYSB 3RGLA 3VBBA 3PCOA 3A7UA 4CS2A 2DXUA 4YRKA 3HXYA 4XTUA 4XEMA 4L87A 5KNNA 4LVIA 2ZR3A 3M4QA 4YRLA 4H2VA 4YCUA 3G1ZA 4CS3A 1B8AA 4YRIA 3CMQA 3A32A 1NJ6A 4HWPA 4YRFA 2AMCA 4YRMA 1GGMA 3LC0A 4HWSA 4TWAA 4XEOA 3V8LA 2QHUA 4DQ2A 2ZT8A 2DU7A 4TQFA 1LYLA 4CH4A 1EIYA 5K1XA 2CIMA 4UPAA 1YFRA 2DTHA 1BIAA 4YRGA 2E3CA 4HWRA 3A74A 3V8KA 1E1TA 4J15A 2DXTA 4ZIBA 1NJ1A 1RIQA 2E5AA 4KR2A 1WU7A 2ZCEA 2C7IA 3P8YA 5C52B 2DJZA 4TVWA 1H4TA 4H2XB 2RHQA 2ZTGA 2E10A 2Q5HA 1NYQA 3KFUA 4YRPA 1USYC 4P75C 4P71A 3V7SA 1B76A 3PCOB 1HTTA 4HVCA 3W3SA 4XTWA 4OLFA 2E64A 2ZNJA 1G5IA 4YRTA 1BIBA 1X54A 2DDZA 1EOVA 2EL9A 4K88A 1C0AA 2DVEA 1HC7A 4UP9A 4XU1A 3MF1A 4H02A 4XU0A 3UH0A 3REUA 2PMEA 2ZR2A 1Z7MA 3REXA 1IL2A 3A7RA 4Q6GA 4YRQA 2ZIMA 2ALYA 4O2DA 4CH6A 4LVJA 4H2SA 5C53B 4H2WA 4WJ4A 3PZCA 2DTOA 4P74C 3HFZA 3RF1A 1B70B 4TVAB 2CJ9A 4K87A 4DPGA 3I7FA 1KOGA 5HGQA 2PMFA 4YRNA 3A7AA 1E1OA 2I4NA 4PHCA 2FYKA 11ASA 1NJ2A 1YB3A 5C51B 2IY5A 1QF6A 3E9IA 4XTZA 4P3PA 4YRJA 3UGTA 2ZINA 3QO8A 1E22A 4XU2A 5E3IA 3RL6A 4G85A 2RHQB 3NEMA 4PG3A 4CS4A 3TEHA 3BFMA 4ZTUB 2E41A 2EAYA 3HXWA 2ODRC 4WF2A 3ICAA 1X55A 12ASA 2P5IA 4TQDA 2EJFA 3HXXA 1B70A 3MQZA 3R07A 4TVAA 2I4MA 3A5YA 4WJ3M 1SRYA 2DEQA 2G4CA 4ZTZB 3RIRA 4KR3A 2DZ9A 4P71C 5F5WA 4H2TA 3V7CA 2ZNIA 1B7YA 2Q7HA 3IALA 5ELOA 4HA8A 3VQVA 1X2GA 4Q15A 2ALYB 3ERRA 1KMNA 2DKGA 1BBWA 3M4PA 1X56A 1KMMA 4NCXA 1EVLA 2I4LA 2C8MA 3HFZB 4XTYA 4YCVA 4YRRA 2ZZGA 3HRIA 2DQ3A 2ZT7A 4XTVA 4LVKA 3P8TA 3QNEA 3QO7A 4XU3A 1SETA 4P73A 2ZZEA 4KQEA 2QHTA 1ASZA 3DSQA 4TVYA 2IY5B 3HRKA 3EFSA 2CJBA 4X5OA 4P72A 1ADYA 1JJCA 4YCWA 3L2ZA 1EQRA 3RKYA 3TEHB 3NELA 1WPYA 1X01A 4TTVA 1EFWA 3FJPA 4BW9A 4LVLA 3A31A 3HTZA 3EFRA 4H2UA 4UP7A 4P3OA 4YRCA 3UGQA 2DQ0A 1NJ5A 4E51A 2P0LA 2AKWB 1X2HA 1Z7NA 2RHSB 1G51A 4BWAA 4YYEA 1B7YB 1SESA 1G5HA 4EX5A 1ADJA 3VQXA 2J3MA 1ATIA 2ARUA 1H4QA 4YROA 1NJ8A 3TUPA 1HXDA 2I4OA 2XTIA 1ASYA 2ZGWA 2CGHA 1FYFA 1VQZA 2ARSA 2EJGA 4LVMA 1YGBA 4OP0A 1L0WA 1YFSA 3NETA 1N9WA 2Q7EA 2EWNA 3IKMB 2XGTA 4P74A 1NNHA 3A5ZA 2ZZFA 2AKWA 2A8EA 3BJUA 3V8JA 2RHSA 1JJCB 2Q5IA 4RMFA 2ARTA 4HWTA 4P73C 4K86A 3OD1A 3LSSA 4YREA 1NYRA 3RUXA 3HY0A 4YRSA 1YFTA 1PYSA 4EO4A 1WLEA 4P72C 4UP8A 4YP0A 1J5WA 4YDQA 3RKWA 1WQWA 3TEGA 3WQZA 3VQWA 2DU5A 1QE0A 3QO5A 2NS6A 4CH3A 4XTXA 3QTCA 1WQ7A 2ZT6A 5ELNA 2QHSA 2ZIOA 3HXZA 1W66A 3L4GB 2DZCA 1WYDA 3IKLA 3IG2A 4RQFA 1SERA 3LSQA 1WNLA 3L1AA 3UFGA 2E1HA 4HT4A 2QHVA 3HY1A 3P8VA 3RACA 3V7RA 1H4SA 2J3LA 4H2YA
chains in the Genus database with same CATH topology
2ZT5A 1BBUA 4AH6A 1H4VB 2EJ9A 3MF2A 2Q7GA 3HXUA 4RQEA 3E9HA 2ZXFA 3HFVA 1E24A 1EVKA 2E65A 2AMCB 4HWOA 4P3NA 2CJAA 3VQYA 5K1PA 1USYA 4P75A 4WI1A 4YPFA 2HNIA 4G84A 3NENA 2ODRD 1EIYB 3L4GA 4H2XA 4CH5A 4RDXA 3RKXA 3MEYA 4LNSA 3HXVA 2DTIA 1PYSB 3RGLA 3VBBA 3PCOA 3A7UA 4CS2A 2DXUA 4YRKA 3HXYA 4XTUA 4XEMA 4L87A 5KNNA 4LVIA 2ZR3A 3M4QA 4YRLA 4H2VA 4YCUA 3G1ZA 4CS3A 1B8AA 4YRIA 3CMQA 3A32A 1NJ6A 4HWPA 4YRFA 2AMCA 4YRMA 1GGMA 3LC0A 4HWSA 4TWAA 4XEOA 3V8LA 2QHUA 4DQ2A 2ZT8A 2DU7A 4TQFA 1LYLA 4CH4A 1EIYA 5K1XA 2CIMA 4UPAA 1YFRA 2DTHA 1BIAA 4YRGA 2E3CA 4HWRA 3A74A 3V8KA 1E1TA 4J15A 2DXTA 4ZIBA 1NJ1A 1RIQA 2E5AA 4KR2A 1WU7A 2ZCEA 2C7IA 3P8YA 5C52B 2DJZA 4TVWA 1H4TA 4H2XB 2RHQA 2ZTGA 2E10A 2Q5HA 1NYQA 3KFUA 4YRPA 1USYC 4P75C 4P71A 3V7SA 1B76A 3PCOB 1HTTA 4HVCA 3W3SA 4XTWA 4OLFA 2E64A 2ZNJA 1G5IA 4YRTA 1BIBA 1X54A 2DDZA 1EOVA 2EL9A 4K88A 1C0AA 2DVEA 1HC7A 4UP9A 4XU1A 3MF1A 4H02A 4XU0A 3UH0A 3REUA 2PMEA 2ZR2A 1Z7MA 3REXA 1IL2A 3A7RA 4Q6GA 4YRQA 2ZIMA 2ALYA 4O2DA 4CH6A 4LVJA 4H2SA 5C53B 4H2WA 4WJ4A 3PZCA 2DTOA 4P74C 3HFZA 3RF1A 1B70B 4TVAB 2CJ9A 4K87A 4DPGA 3I7FA 1KOGA 5HGQA 2PMFA 4YRNA 3A7AA 1E1OA 2I4NA 4PHCA 2FYKA 11ASA 1NJ2A 1YB3A 5C51B 2IY5A 1QF6A 3E9IA 4XTZA 4P3PA 4YRJA 3UGTA 2ZINA 3QO8A 1E22A 4XU2A 5E3IA 3RL6A 4G85A 2RHQB 3NEMA 4PG3A 4CS4A 3TEHA 3BFMA 4ZTUB 2E41A 2EAYA 3HXWA 2ODRC 4WF2A 3ICAA 1X55A 12ASA 2P5IA 4TQDA 2EJFA 3HXXA 1B70A 3MQZA 3R07A 4TVAA 2I4MA 3A5YA 4WJ3M 1SRYA 2DEQA 2G4CA 4ZTZB 3RIRA 4KR3A 2DZ9A 4P71C 5F5WA 4H2TA 3V7CA 2ZNIA 1B7YA 2Q7HA 3IALA 5ELOA 4HA8A 3VQVA 1X2GA 4Q15A 2ALYB 3ERRA 1KMNA 2DKGA 1BBWA 3M4PA 1X56A 1KMMA 4NCXA 1EVLA 2I4LA 2C8MA 3HFZB 4XTYA 4YCVA 4YRRA 2ZZGA 3HRIA 2DQ3A 2ZT7A 4XTVA 4LVKA 3P8TA 3QNEA 3QO7A 4XU3A 1SETA 4P73A 2ZZEA 4KQEA 2QHTA 1ASZA 3DSQA 4TVYA 2IY5B 3HRKA 3EFSA 2CJBA 4X5OA 4P72A 1ADYA 1JJCA 4YCWA 3L2ZA 1EQRA 3RKYA 3TEHB 3NELA 1WPYA 1X01A 4TTVA 1EFWA 3FJPA 4BW9A 4LVLA 3A31A 3HTZA 3EFRA 4H2UA 4UP7A 4P3OA 4YRCA 3UGQA 2DQ0A 1NJ5A 4E51A 2P0LA 2AKWB 1X2HA 1Z7NA 2RHSB 1G51A 4BWAA 4YYEA 1B7YB 1SESA 1G5HA 4EX5A 1ADJA 3VQXA 2J3MA 1ATIA 2ARUA 1H4QA 4YROA 1NJ8A 3TUPA 1HXDA 2I4OA 2XTIA 1ASYA 2ZGWA 2CGHA 1FYFA 1VQZA 2ARSA 2EJGA 4LVMA 1YGBA 4OP0A 1L0WA 1YFSA 3NETA 1N9WA 2Q7EA 2EWNA 3IKMB 2XGTA 4P74A 1NNHA 3A5ZA 2ZZFA 2AKWA 2A8EA 3BJUA 3V8JA 2RHSA 1JJCB 2Q5IA 4RMFA 2ARTA 4HWTA 4P73C 4K86A 3OD1A 3LSSA 4YREA 1NYRA 3RUXA 3HY0A 4YRSA 1YFTA 1PYSA 4EO4A 1WLEA 4P72C 4UP8A 4YP0A 1J5WA 4YDQA 3RKWA 1WQWA 3TEGA 3WQZA 3VQWA 2DU5A 1QE0A 3QO5A 2NS6A 4CH3A 4XTXA 3QTCA 1WQ7A 2ZT6A 5ELNA 2QHSA 2ZIOA 3HXZA 1W66A 3L4GB 2DZCA 1WYDA 3IKLA 3IG2A 4RQFA 1SERA 3LSQA 1WNLA 3L1AA 3UFGA 2E1HA 4HT4A 2QHVA 3HY1A 3P8VA 3RACA 3V7RA 1H4SA 2J3LA 4H2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A8E A;  3MQZ A; 
#chains in the Genus database with same CATH topology
 2ZT5 A;  1BBU A;  4AH6 A;  1H4V B;  2EJ9 A;  3MF2 A;  2Q7G A;  3HXU A;  4RQE A;  3E9H A;  2ZXF A;  3HFV A;  1E24 A;  1EVK A;  2E65 A;  2AMC B;  4HWO A;  4P3N A;  2CJA A;  3VQY A;  5K1P A;  1USY A;  4P75 A;  4WI1 A;  4YPF A;  2HNI A;  4G84 A;  3NEN A;  2ODR D;  1EIY B;  3L4G A;  4H2X A;  4CH5 A;  4RDX A;  3RKX A;  3MEY A;  4LNS A;  3HXV A;  2DTI A;  1PYS B;  3RGL A;  3VBB A;  3PCO A;  3A7U A;  4CS2 A;  2DXU A;  4YRK A;  3HXY A;  4XTU A;  4XEM A;  4L87 A;  5KNN A;  4LVI A;  2ZR3 A;  3M4Q A;  4YRL A;  4H2V A;  4YCU A;  3G1Z A;  4CS3 A;  1B8A A;  4YRI A;  3CMQ A;  3A32 A;  1NJ6 A;  4HWP A;  4YRF A;  2AMC A;  4YRM A;  1GGM A;  3LC0 A;  4HWS A;  4TWA A;  4XEO A;  3V8L A;  2QHU A;  4DQ2 A;  2ZT8 A;  2DU7 A;  4TQF A;  1LYL A;  4CH4 A;  1EIY A;  5K1X A;  2CIM A;  4UPA A;  1YFR A;  2DTH A;  1BIA A;  4YRG A;  2E3C A;  4HWR A;  3A74 A;  3V8K A;  1E1T A;  4J15 A;  2DXT A;  4ZIB A;  1NJ1 A;  1RIQ A;  2E5A A;  4KR2 A;  1WU7 A;  2ZCE A;  2C7I A;  3P8Y A;  5C52 B;  2DJZ A;  4TVW A;  1H4T A;  4H2X B;  2RHQ A;  2ZTG A;  2E10 A;  2Q5H A;  1NYQ A;  3KFU A;  4YRP A;  1USY C;  4P75 C;  4P71 A;  3V7S A;  1B76 A;  3PCO B;  1HTT A;  4HVC A;  3W3S A;  4XTW A;  4OLF A;  2E64 A;  2ZNJ A;  1G5I A;  4YRT A;  1BIB A;  1X54 A;  2DDZ A;  1EOV A;  2EL9 A;  4K88 A;  1C0A A;  2DVE A;  1HC7 A;  4UP9 A;  4XU1 A;  3MF1 A;  4H02 A;  4XU0 A;  3UH0 A;  3REU A;  2PME A;  2ZR2 A;  1Z7M A;  3REX A;  1IL2 A;  3A7R A;  4Q6G A;  4YRQ A;  2ZIM A;  2ALY A;  4O2D A;  4CH6 A;  4LVJ A;  4H2S A;  5C53 B;  4H2W A;  4WJ4 A;  3PZC A;  2DTO A;  4P74 C;  3HFZ A;  3RF1 A;  1B70 B;  4TVA B;  2CJ9 A;  4K87 A;  4DPG A;  3I7F A;  1KOG A;  5HGQ A;  2PMF A;  4YRN A;  3A7A A;  1E1O A;  2I4N A;  4PHC A;  2FYK A;  11AS A;  1NJ2 A;  1YB3 A;  5C51 B;  2IY5 A;  1QF6 A;  3E9I A;  4XTZ A;  4P3P A;  4YRJ A;  3UGT A;  2ZIN A;  3QO8 A;  1E22 A;  4XU2 A;  5E3I A;  3RL6 A;  4G85 A;  2RHQ B;  3NEM A;  4PG3 A;  4CS4 A;  3TEH A;  3BFM A;  4ZTU B;  2E41 A;  2EAY A;  3HXW A;  2ODR C;  4WF2 A;  3ICA A;  1X55 A;  12AS A;  2P5I A;  4TQD A;  2EJF A;  3HXX A;  1B70 A;  3MQZ A;  3R07 A;  4TVA A;  2I4M A;  3A5Y A;  4WJ3 M;  1SRY A;  2DEQ A;  2G4C A;  4ZTZ B;  3RIR A;  4KR3 A;  2DZ9 A;  4P71 C;  5F5W A;  4H2T A;  3V7C A;  2ZNI A;  1B7Y A;  2Q7H A;  3IAL A;  5ELO A;  4HA8 A;  3VQV A;  1X2G A;  4Q15 A;  2ALY B;  3ERR A;  1KMN A;  2DKG A;  1BBW A;  3M4P A;  1X56 A;  1KMM A;  4NCX A;  1EVL A;  2I4L A;  2C8M A;  3HFZ B;  4XTY A;  4YCV A;  4YRR A;  2ZZG A;  3HRI A;  2DQ3 A;  2ZT7 A;  4XTV A;  4LVK A;  3P8T A;  3QNE A;  3QO7 A;  4XU3 A;  1SET A;  4P73 A;  2ZZE A;  4KQE A;  2QHT A;  1ASZ A;  3DSQ A;  4TVY A;  2IY5 B;  3HRK A;  3EFS A;  2CJB A;  4X5O A;  4P72 A;  1ADY A;  1JJC A;  4YCW A;  3L2Z A;  1EQR A;  3RKY A;  3TEH B;  3NEL A;  1WPY A;  1X01 A;  4TTV A;  1EFW A;  3FJP A;  4BW9 A;  4LVL A;  3A31 A;  3HTZ A;  3EFR A;  4H2U A;  4UP7 A;  4P3O A;  4YRC A;  3UGQ A;  2DQ0 A;  1NJ5 A;  4E51 A;  2P0L A;  2AKW B;  1X2H A;  1Z7N A;  2RHS B;  1G51 A;  4BWA A;  4YYE A;  1B7Y B;  1SES A;  1G5H A;  4EX5 A;  1ADJ A;  3VQX A;  2J3M A;  1ATI A;  2ARU A;  1H4Q A;  4YRO A;  1NJ8 A;  3TUP A;  1HXD A;  2I4O A;  2XTI A;  1ASY A;  2ZGW A;  2CGH A;  1FYF A;  1VQZ A;  2ARS A;  2EJG A;  4LVM A;  1YGB A;  4OP0 A;  1L0W A;  1YFS A;  3NET A;  1N9W A;  2Q7E A;  2EWN A;  3IKM B;  2XGT A;  4P74 A;  1NNH A;  3A5Z A;  2ZZF A;  2AKW A;  2A8E A;  3BJU A;  3V8J A;  2RHS A;  1JJC B;  2Q5I A;  4RMF A;  2ART A;  4HWT A;  4P73 C;  4K86 A;  3OD1 A;  3LSS A;  4YRE A;  1NYR A;  3RUX A;  3HY0 A;  4YRS A;  1YFT A;  1PYS A;  4EO4 A;  1WLE A;  4P72 C;  4UP8 A;  4YP0 A;  1J5W A;  4YDQ A;  3RKW A;  1WQW A;  3TEG A;  3WQZ A;  3VQW A;  2DU5 A;  1QE0 A;  3QO5 A;  2NS6 A;  4CH3 A;  4XTX A;  3QTC A;  1WQ7 A;  2ZT6 A;  5ELN A;  2QHS A;  2ZIO A;  3HXZ A;  1W66 A;  3L4G B;  2DZC A;  1WYD A;  3IKL A;  3IG2 A;  4RQF A;  1SER A;  3LSQ A;  1WNL A;  3L1A A;  3UFG A;  2E1H A;  4HT4 A;  2QHV A;  3HY1 A;  3P8V A;  3RAC A;  3V7R A;  1H4S A;  2J3L A;  4H2Y A; 
#chains in the Genus database with same CATH homology
 2ZT5 A;  1BBU A;  4AH6 A;  1H4V B;  2EJ9 A;  3MF2 A;  2Q7G A;  3HXU A;  4RQE A;  3E9H A;  2ZXF A;  3HFV A;  1E24 A;  1EVK A;  2E65 A;  2AMC B;  4HWO A;  4P3N A;  2CJA A;  3VQY A;  5K1P A;  1USY A;  4P75 A;  4WI1 A;  4YPF A;  2HNI A;  4G84 A;  3NEN A;  2ODR D;  1EIY B;  3L4G A;  4H2X A;  4CH5 A;  4RDX A;  3RKX A;  3MEY A;  4LNS A;  3HXV A;  2DTI A;  1PYS B;  3RGL A;  3VBB A;  3PCO A;  3A7U A;  4CS2 A;  2DXU A;  4YRK A;  3HXY A;  4XTU A;  4XEM A;  4L87 A;  5KNN A;  4LVI A;  2ZR3 A;  3M4Q A;  4YRL A;  4H2V A;  4YCU A;  3G1Z A;  4CS3 A;  1B8A A;  4YRI A;  3CMQ A;  3A32 A;  1NJ6 A;  4HWP A;  4YRF A;  2AMC A;  4YRM A;  1GGM A;  3LC0 A;  4HWS A;  4TWA A;  4XEO A;  3V8L A;  2QHU A;  4DQ2 A;  2ZT8 A;  2DU7 A;  4TQF A;  1LYL A;  4CH4 A;  1EIY A;  5K1X A;  2CIM A;  4UPA A;  1YFR A;  2DTH A;  1BIA A;  4YRG A;  2E3C A;  4HWR A;  3A74 A;  3V8K A;  1E1T A;  4J15 A;  2DXT A;  4ZIB A;  1NJ1 A;  1RIQ A;  2E5A A;  4KR2 A;  1WU7 A;  2ZCE A;  2C7I A;  3P8Y A;  5C52 B;  2DJZ A;  4TVW A;  1H4T A;  4H2X B;  2RHQ A;  2ZTG A;  2E10 A;  2Q5H A;  1NYQ A;  3KFU A;  4YRP A;  1USY C;  4P75 C;  4P71 A;  3V7S A;  1B76 A;  3PCO B;  1HTT A;  4HVC A;  3W3S A;  4XTW A;  4OLF A;  2E64 A;  2ZNJ A;  1G5I A;  4YRT A;  1BIB A;  1X54 A;  2DDZ A;  1EOV A;  2EL9 A;  4K88 A;  1C0A A;  2DVE A;  1HC7 A;  4UP9 A;  4XU1 A;  3MF1 A;  4H02 A;  4XU0 A;  3UH0 A;  3REU A;  2PME A;  2ZR2 A;  1Z7M A;  3REX A;  1IL2 A;  3A7R A;  4Q6G A;  4YRQ A;  2ZIM A;  2ALY A;  4O2D A;  4CH6 A;  4LVJ A;  4H2S A;  5C53 B;  4H2W A;  4WJ4 A;  3PZC A;  2DTO A;  4P74 C;  3HFZ A;  3RF1 A;  1B70 B;  4TVA B;  2CJ9 A;  4K87 A;  4DPG A;  3I7F A;  1KOG A;  5HGQ A;  2PMF A;  4YRN A;  3A7A A;  1E1O A;  2I4N A;  4PHC A;  2FYK A;  11AS A;  1NJ2 A;  1YB3 A;  5C51 B;  2IY5 A;  1QF6 A;  3E9I A;  4XTZ A;  4P3P A;  4YRJ A;  3UGT A;  2ZIN A;  3QO8 A;  1E22 A;  4XU2 A;  5E3I A;  3RL6 A;  4G85 A;  2RHQ B;  3NEM A;  4PG3 A;  4CS4 A;  3TEH A;  3BFM A;  4ZTU B;  2E41 A;  2EAY A;  3HXW A;  2ODR C;  4WF2 A;  3ICA A;  1X55 A;  12AS A;  2P5I A;  4TQD A;  2EJF A;  3HXX A;  1B70 A;  3MQZ A;  3R07 A;  4TVA A;  2I4M A;  3A5Y A;  4WJ3 M;  1SRY A;  2DEQ A;  2G4C A;  4ZTZ B;  3RIR A;  4KR3 A;  2DZ9 A;  4P71 C;  5F5W A;  4H2T A;  3V7C A;  2ZNI A;  1B7Y A;  2Q7H A;  3IAL A;  5ELO A;  4HA8 A;  3VQV A;  1X2G A;  4Q15 A;  2ALY B;  3ERR A;  1KMN A;  2DKG A;  1BBW A;  3M4P A;  1X56 A;  1KMM A;  4NCX A;  1EVL A;  2I4L A;  2C8M A;  3HFZ B;  4XTY A;  4YCV A;  4YRR A;  2ZZG A;  3HRI A;  2DQ3 A;  2ZT7 A;  4XTV A;  4LVK A;  3P8T A;  3QNE A;  3QO7 A;  4XU3 A;  1SET A;  4P73 A;  2ZZE A;  4KQE A;  2QHT A;  1ASZ A;  3DSQ A;  4TVY A;  2IY5 B;  3HRK A;  3EFS A;  2CJB A;  4X5O A;  4P72 A;  1ADY A;  1JJC A;  4YCW A;  3L2Z A;  1EQR A;  3RKY A;  3TEH B;  3NEL A;  1WPY A;  1X01 A;  4TTV A;  1EFW A;  3FJP A;  4BW9 A;  4LVL A;  3A31 A;  3HTZ A;  3EFR A;  4H2U A;  4UP7 A;  4P3O A;  4YRC A;  3UGQ A;  2DQ0 A;  1NJ5 A;  4E51 A;  2P0L A;  2AKW B;  1X2H A;  1Z7N A;  2RHS B;  1G51 A;  4BWA A;  4YYE A;  1B7Y B;  1SES A;  1G5H A;  4EX5 A;  1ADJ A;  3VQX A;  2J3M A;  1ATI A;  2ARU A;  1H4Q A;  4YRO A;  1NJ8 A;  3TUP A;  1HXD A;  2I4O A;  2XTI A;  1ASY A;  2ZGW A;  2CGH A;  1FYF A;  1VQZ A;  2ARS A;  2EJG A;  4LVM A;  1YGB A;  4OP0 A;  1L0W A;  1YFS A;  3NET A;  1N9W A;  2Q7E A;  2EWN A;  3IKM B;  2XGT A;  4P74 A;  1NNH A;  3A5Z A;  2ZZF A;  2AKW A;  2A8E A;  3BJU A;  3V8J A;  2RHS A;  1JJC B;  2Q5I A;  4RMF A;  2ART A;  4HWT A;  4P73 C;  4K86 A;  3OD1 A;  3LSS A;  4YRE A;  1NYR A;  3RUX A;  3HY0 A;  4YRS A;  1YFT A;  1PYS A;  4EO4 A;  1WLE A;  4P72 C;  4UP8 A;  4YP0 A;  1J5W A;  4YDQ A;  3RKW A;  1WQW A;  3TEG A;  3WQZ A;  3VQW A;  2DU5 A;  1QE0 A;  3QO5 A;  2NS6 A;  4CH3 A;  4XTX A;  3QTC A;  1WQ7 A;  2ZT6 A;  5ELN A;  2QHS A;  2ZIO A;  3HXZ A;  1W66 A;  3L4G B;  2DZC A;  1WYD A;  3IKL A;  3IG2 A;  4RQF A;  1SER A;  3LSQ A;  1WNL A;  3L1A A;  3UFG A;  2E1H A;  4HT4 A;  2QHV A;  3HY1 A;  3P8V A;  3RAC A;  3V7R A;  1H4S A;  2J3L A;  4H2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...