3MQZA

Crystal structure of conserved protein duf1054 from pink subaerial biofilm microbial leptospirillum sp. group ii uba.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
205
structure length
205
Chain Sequence
IERLQDYLLPEWVSIFDIADFSGRMLRIRGDIRPALLRLASRLAELLNESPGPRPWYPHVASHMRRRVNPPPETWLALGPEKRGYKSYAHSGVFIGGRGLSVRFILKDEAIEERKNLGRWMSRSGPAFEQWKKKVGDLRDFGPVHDDPMADPPKVEWDPRVFGERLGSLKSASLDIGFRVTFDTSLAGIVKTIRTFDLLYAEAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Conserved Protein DUF1054 from Pink Subaerial Biofilm Microbial Leptospirillum sp. Group II UBA.
rcsb
source organism Leptospirillum rubarum
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized Conserved Protein DUF1054
total genus 64
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2010-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.20 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 3mqzA00
3MQZA 2A8EA
chains in the Genus database with same CATH superfamily
1X54A 3BFMA 1ASYA 2EJ9A 4PG3A 4YRJA 4TVYA 3ERRA 4YRLA 1E22A 4XU3A 2DZ9A 2ARTA 2Q7HA 2EAYA 3W3SA 4CH3A 4YCVA 3M4PA 3IKLA 3A31A 4CH5A 3VQXA 4G84A 1H4SA 2ZINA 4P75A 4LVIA 2E10A 1BBWA 4YPFA 3HXUA 2ALYA 3HTZA 4Q6GA 4DQ2A 2ODRC 1VQZA 4TVAA 5K1PA 4P71A 4G85A 4YRGA 1E1TA 3UGTA 1B8AA 1NJ1A 2DQ0A 2RHQA 2ZT7A 3L1AA 3REUA 3RUXA 4YP0A 1WPYA 2AMCA 3P8VA 2ZCEA 4Q15A 3V8KA 2ZT8A 1J5WA 4XTVA 2C8MA 3RGLA 3NEMA 4XTZA 3HFVA 3LSQA 3BJUA 2ZTGA 2EL9A 1JJCA 4YRCA 1EVKA 2E1HA 3VQYA 1G51A 1YFRA 1WLEA 1E1OA 3PCOA 4HA8A 4EO4A 1ATIA 3EFRA 3MF1A 5F5WA 1NJ6A 2QHUA 3CMQA 1BIAA 2CIMA 4ZIBA 2Q5IA 4LVJA 2IY5B 2I4LA 2ZNJA 4XU0A 4P75C 2PMEA 4PHCA 4E51A 3L2ZA 1HTTA 2I4NA 4BWAA 2ARSA 3IALA 4WI1A 1NJ2A 4HT4A 3PCOB 3WQZA 3A7UA 3TEHA 4K88A 3TEHB 4XTWA 1X01A 3E9HA 3QNEA 4H02A 3MQZA 3A74A 2DQ3A 2ZZFA 1WU7A 3QTCA 4YRFA 2DXUA 2G4CA 3HRIA 1YFSA 2DZCA 4HWTA 5C53B 2DDZA 4YYEA 3G1ZA 4P72C 1L0WA 1Z7NA 4LVLA 12ASA 4BW9A 5E3IA 4H2TA 2P0LA 1NYQA 3MEYA 2RHSA 3RKXA 3A5YA 3RKWA 4YRTA 4XU1A 2P5IA 3A5ZA 1JJCB 3IKMB 1PYSB 2Q7GA 1N9WA 4OP0A 4P3NA 2DTHA 4WF2A 4HWRA 1FYFA 1KMNA 3LSSA 4KQEA 2I4OA 3A7AA 1HXDA 4XEMA 1X56A 2CJAA 4ZTUB 4CS2A 3P8YA 4X5OA 1Z7MA 4TVWA 4TWAA 4YRSA 4H2VA 3RL6A 2XGTA 1G5IA 4DPGA 1WNLA 3HFZA 2ALYB 2J3LA 2ZGWA 1LYLA 2CGHA 3R07A 1SRYA 4RQEA 3UFGA 1NJ8A 3E9IA 1B70A 4KR2A 3QO8A 1EQRA 1YFTA 3I7FA 4XEOA 4TQDA 3V8JA 4P73C 4P71C 3QO5A 3HXVA 1B7YA 3HY0A 5ELOA 1H4QA 1B7YB 4OLFA 2ZZEA 4HWPA 4YROA 2QHVA 1W66A 1ASZA 4H2SA 4UP7A 3TUPA 1EIYA 1EIYB 4UPAA 2E3CA 1PYSA 4HWOA 4YRKA 4H2UA 4YRRA 1USYA 2ZIOA 2ZT5A 5HGQA 3ICAA 4HWSA 4YRQA 3DSQA 3V7SA 2QHTA 4YRMA 1HC7A 2PMFA 2ZZGA 3A7RA 1EOVA 4H2YA 3L4GA 3HXXA 2ZIMA 2E41A 4LVKA 2DKGA 4YCUA 1KMMA 3M4QA 3HFZB 1H4TA 4XTYA 4RDXA 3TEGA 2FYKA 4P72A 1EFWA 1QE0A 1C0AA 4RQFA 3NELA 4K87A 4YCWA 4H2XA 4AH6A 1GGMA 2DXTA 4YRPA 3UH0A 2IY5A 2C7IA 4CS4A 4WJ3M 1EVLA 1NNHA 3HXWA 4YRIA 3HY1A 2Q5HA 2DTOA 3RACA 2EJGA 1E24A 3L4GB 2NS6A 1WQWA 2I4MA 3UGQA 2A8EA 3VQVA 4YREA 5KNNA 2ZXFA 4CH4A 4WJ4A 3OD1A 1USYC 1WQ7A 2DEQA 2EWNA 3HRKA 4KR3A 1SETA 2AMCB 3IG2A 2Q7EA 2QHSA 3REXA 4XTXA 3PZCA 3V7RA 4LNSA 2XTIA 4HVCA 1YGBA 4UP9A 2DU5A 2E5AA 1X2HA 4XU2A 1ADYA 4YDQA 3FJPA 4H2WA 2DJZA 2EJFA 4K86A 1BBUA 11ASA 1WYDA 1BIBA 4TTVA 3RF1A 4P74A 3P8TA 2E65A 4P74C 3VQWA 3HXZA 1QF6A 5C51B 2AKWB 4L87A 1B76A 1B70B 1IL2A 1G5HA 1X2GA 2DU7A 2ZT6A 3QO7A 2ZR2A 4YRNA 1KOGA 1H4VB 4EX5A 4H2XB 4CH6A 5ELNA 5K1XA 3V7CA 4NCXA 3RIRA 4ZTZB 1NYRA 3LC0A 4P3PA 5C52B 3KFUA 4LVMA 4P3OA 1YB3A 2DVEA 3A32A 2AKWA 3HXYA 4TQFA 4TVAB 2ZNIA 1RIQA 2ODRD 4O2DA 3VBBA 2ZR3A 3NETA 3MF2A 2CJBA 2DTIA 4J15A 4P73A 2J3MA 2RHQB 4CS3A 3NENA 1ADJA 1X55A 2RHSB 1SERA 1SESA 2E64A 2ARUA 4RMFA 3EFSA 2HNIA 4XTUA 4UP8A 3RKYA 2CJ9A 3V8LA 1NJ5A
chains in the Genus database with same CATH topology
1X54A 3BFMA 1ASYA 2EJ9A 4PG3A 4YRJA 4TVYA 3ERRA 4YRLA 1E22A 4XU3A 2DZ9A 2ARTA 2Q7HA 2EAYA 3W3SA 4CH3A 4YCVA 3M4PA 3IKLA 3A31A 4CH5A 3VQXA 4G84A 1H4SA 2ZINA 4P75A 4LVIA 2E10A 1BBWA 4YPFA 3HXUA 2ALYA 3HTZA 4Q6GA 4DQ2A 2ODRC 1VQZA 4TVAA 5K1PA 4P71A 4G85A 4YRGA 1E1TA 3UGTA 1B8AA 1NJ1A 2DQ0A 2RHQA 2ZT7A 3L1AA 3REUA 3RUXA 4YP0A 1WPYA 2AMCA 3P8VA 2ZCEA 4Q15A 3V8KA 2ZT8A 1J5WA 4XTVA 2C8MA 3RGLA 3NEMA 4XTZA 3HFVA 3LSQA 3BJUA 2ZTGA 2EL9A 1JJCA 4YRCA 1EVKA 2E1HA 3VQYA 1G51A 1YFRA 1WLEA 1E1OA 3PCOA 4HA8A 4EO4A 1ATIA 3EFRA 3MF1A 5F5WA 1NJ6A 2QHUA 3CMQA 1BIAA 2CIMA 4ZIBA 2Q5IA 4LVJA 2IY5B 2I4LA 2ZNJA 4XU0A 4P75C 2PMEA 4PHCA 4E51A 3L2ZA 1HTTA 2I4NA 4BWAA 2ARSA 3IALA 4WI1A 1NJ2A 4HT4A 3PCOB 3WQZA 3A7UA 3TEHA 4K88A 3TEHB 4XTWA 1X01A 3E9HA 3QNEA 4H02A 3MQZA 3A74A 2DQ3A 2ZZFA 1WU7A 3QTCA 4YRFA 2DXUA 2G4CA 3HRIA 1YFSA 2DZCA 4HWTA 5C53B 2DDZA 4YYEA 3G1ZA 4P72C 1L0WA 1Z7NA 4LVLA 12ASA 4BW9A 5E3IA 4H2TA 2P0LA 1NYQA 3MEYA 2RHSA 3RKXA 3A5YA 3RKWA 4YRTA 4XU1A 2P5IA 3A5ZA 1JJCB 3IKMB 1PYSB 2Q7GA 1N9WA 4OP0A 4P3NA 2DTHA 4WF2A 4HWRA 1FYFA 1KMNA 3LSSA 4KQEA 2I4OA 3A7AA 1HXDA 4XEMA 1X56A 2CJAA 4ZTUB 4CS2A 3P8YA 4X5OA 1Z7MA 4TVWA 4TWAA 4YRSA 4H2VA 3RL6A 2XGTA 1G5IA 4DPGA 1WNLA 3HFZA 2ALYB 2J3LA 2ZGWA 1LYLA 2CGHA 3R07A 1SRYA 4RQEA 3UFGA 1NJ8A 3E9IA 1B70A 4KR2A 3QO8A 1EQRA 1YFTA 3I7FA 4XEOA 4TQDA 3V8JA 4P73C 4P71C 3QO5A 3HXVA 1B7YA 3HY0A 5ELOA 1H4QA 1B7YB 4OLFA 2ZZEA 4HWPA 4YROA 2QHVA 1W66A 1ASZA 4H2SA 4UP7A 3TUPA 1EIYA 1EIYB 4UPAA 2E3CA 1PYSA 4HWOA 4YRKA 4H2UA 4YRRA 1USYA 2ZIOA 2ZT5A 5HGQA 3ICAA 4HWSA 4YRQA 3DSQA 3V7SA 2QHTA 4YRMA 1HC7A 2PMFA 2ZZGA 3A7RA 1EOVA 4H2YA 3L4GA 3HXXA 2ZIMA 2E41A 4LVKA 2DKGA 4YCUA 1KMMA 3M4QA 3HFZB 1H4TA 4XTYA 4RDXA 3TEGA 2FYKA 4P72A 1EFWA 1QE0A 1C0AA 4RQFA 3NELA 4K87A 4YCWA 4H2XA 4AH6A 1GGMA 2DXTA 4YRPA 3UH0A 2IY5A 2C7IA 4CS4A 4WJ3M 1EVLA 1NNHA 3HXWA 4YRIA 3HY1A 2Q5HA 2DTOA 3RACA 2EJGA 1E24A 3L4GB 2NS6A 1WQWA 2I4MA 3UGQA 2A8EA 3VQVA 4YREA 5KNNA 2ZXFA 4CH4A 4WJ4A 3OD1A 1USYC 1WQ7A 2DEQA 2EWNA 3HRKA 4KR3A 1SETA 2AMCB 3IG2A 2Q7EA 2QHSA 3REXA 4XTXA 3PZCA 3V7RA 4LNSA 2XTIA 4HVCA 1YGBA 4UP9A 2DU5A 2E5AA 1X2HA 4XU2A 1ADYA 4YDQA 3FJPA 4H2WA 2DJZA 2EJFA 4K86A 1BBUA 11ASA 1WYDA 1BIBA 4TTVA 3RF1A 4P74A 3P8TA 2E65A 4P74C 3VQWA 3HXZA 1QF6A 5C51B 2AKWB 4L87A 1B76A 1B70B 1IL2A 1G5HA 1X2GA 2DU7A 2ZT6A 3QO7A 2ZR2A 4YRNA 1KOGA 1H4VB 4EX5A 4H2XB 4CH6A 5ELNA 5K1XA 3V7CA 4NCXA 3RIRA 4ZTZB 1NYRA 3LC0A 4P3PA 5C52B 3KFUA 4LVMA 4P3OA 1YB3A 2DVEA 3A32A 2AKWA 3HXYA 4TQFA 4TVAB 2ZNIA 1RIQA 2ODRD 4O2DA 3VBBA 2ZR3A 3NETA 3MF2A 2CJBA 2DTIA 4J15A 4P73A 2J3MA 2RHQB 4CS3A 3NENA 1ADJA 1X55A 2RHSB 1SERA 1SESA 2E64A 2ARUA 4RMFA 3EFSA 2HNIA 4XTUA 4UP8A 3RKYA 2CJ9A 3V8LA 1NJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQZ A;  2A8E A; 
#chains in the Genus database with same CATH topology
 1X54 A;  3BFM A;  1ASY A;  2EJ9 A;  4PG3 A;  4YRJ A;  4TVY A;  3ERR A;  4YRL A;  1E22 A;  4XU3 A;  2DZ9 A;  2ART A;  2Q7H A;  2EAY A;  3W3S A;  4CH3 A;  4YCV A;  3M4P A;  3IKL A;  3A31 A;  4CH5 A;  3VQX A;  4G84 A;  1H4S A;  2ZIN A;  4P75 A;  4LVI A;  2E10 A;  1BBW A;  4YPF A;  3HXU A;  2ALY A;  3HTZ A;  4Q6G A;  4DQ2 A;  2ODR C;  1VQZ A;  4TVA A;  5K1P A;  4P71 A;  4G85 A;  4YRG A;  1E1T A;  3UGT A;  1B8A A;  1NJ1 A;  2DQ0 A;  2RHQ A;  2ZT7 A;  3L1A A;  3REU A;  3RUX A;  4YP0 A;  1WPY A;  2AMC A;  3P8V A;  2ZCE A;  4Q15 A;  3V8K A;  2ZT8 A;  1J5W A;  4XTV A;  2C8M A;  3RGL A;  3NEM A;  4XTZ A;  3HFV A;  3LSQ A;  3BJU A;  2ZTG A;  2EL9 A;  1JJC A;  4YRC A;  1EVK A;  2E1H A;  3VQY A;  1G51 A;  1YFR A;  1WLE A;  1E1O A;  3PCO A;  4HA8 A;  4EO4 A;  1ATI A;  3EFR A;  3MF1 A;  5F5W A;  1NJ6 A;  2QHU A;  3CMQ A;  1BIA A;  2CIM A;  4ZIB A;  2Q5I A;  4LVJ A;  2IY5 B;  2I4L A;  2ZNJ A;  4XU0 A;  4P75 C;  2PME A;  4PHC A;  4E51 A;  3L2Z A;  1HTT A;  2I4N A;  4BWA A;  2ARS A;  3IAL A;  4WI1 A;  1NJ2 A;  4HT4 A;  3PCO B;  3WQZ A;  3A7U A;  3TEH A;  4K88 A;  3TEH B;  4XTW A;  1X01 A;  3E9H A;  3QNE A;  4H02 A;  3MQZ A;  3A74 A;  2DQ3 A;  2ZZF A;  1WU7 A;  3QTC A;  4YRF A;  2DXU A;  2G4C A;  3HRI A;  1YFS A;  2DZC A;  4HWT A;  5C53 B;  2DDZ A;  4YYE A;  3G1Z A;  4P72 C;  1L0W A;  1Z7N A;  4LVL A;  12AS A;  4BW9 A;  5E3I A;  4H2T A;  2P0L A;  1NYQ A;  3MEY A;  2RHS A;  3RKX A;  3A5Y A;  3RKW A;  4YRT A;  4XU1 A;  2P5I A;  3A5Z A;  1JJC B;  3IKM B;  1PYS B;  2Q7G A;  1N9W A;  4OP0 A;  4P3N A;  2DTH A;  4WF2 A;  4HWR A;  1FYF A;  1KMN A;  3LSS A;  4KQE A;  2I4O A;  3A7A A;  1HXD A;  4XEM A;  1X56 A;  2CJA A;  4ZTU B;  4CS2 A;  3P8Y A;  4X5O A;  1Z7M A;  4TVW A;  4TWA A;  4YRS A;  4H2V A;  3RL6 A;  2XGT A;  1G5I A;  4DPG A;  1WNL A;  3HFZ A;  2ALY B;  2J3L A;  2ZGW A;  1LYL A;  2CGH A;  3R07 A;  1SRY A;  4RQE A;  3UFG A;  1NJ8 A;  3E9I A;  1B70 A;  4KR2 A;  3QO8 A;  1EQR A;  1YFT A;  3I7F A;  4XEO A;  4TQD A;  3V8J A;  4P73 C;  4P71 C;  3QO5 A;  3HXV A;  1B7Y A;  3HY0 A;  5ELO A;  1H4Q A;  1B7Y B;  4OLF A;  2ZZE A;  4HWP A;  4YRO A;  2QHV A;  1W66 A;  1ASZ A;  4H2S A;  4UP7 A;  3TUP A;  1EIY A;  1EIY B;  4UPA A;  2E3C A;  1PYS A;  4HWO A;  4YRK A;  4H2U A;  4YRR A;  1USY A;  2ZIO A;  2ZT5 A;  5HGQ A;  3ICA A;  4HWS A;  4YRQ A;  3DSQ A;  3V7S A;  2QHT A;  4YRM A;  1HC7 A;  2PMF A;  2ZZG A;  3A7R A;  1EOV A;  4H2Y A;  3L4G A;  3HXX A;  2ZIM A;  2E41 A;  4LVK A;  2DKG A;  4YCU A;  1KMM A;  3M4Q A;  3HFZ B;  1H4T A;  4XTY A;  4RDX A;  3TEG A;  2FYK A;  4P72 A;  1EFW A;  1QE0 A;  1C0A A;  4RQF A;  3NEL A;  4K87 A;  4YCW A;  4H2X A;  4AH6 A;  1GGM A;  2DXT A;  4YRP A;  3UH0 A;  2IY5 A;  2C7I A;  4CS4 A;  4WJ3 M;  1EVL A;  1NNH A;  3HXW A;  4YRI A;  3HY1 A;  2Q5H A;  2DTO A;  3RAC A;  2EJG A;  1E24 A;  3L4G B;  2NS6 A;  1WQW A;  2I4M A;  3UGQ A;  2A8E A;  3VQV A;  4YRE A;  5KNN A;  2ZXF A;  4CH4 A;  4WJ4 A;  3OD1 A;  1USY C;  1WQ7 A;  2DEQ A;  2EWN A;  3HRK A;  4KR3 A;  1SET A;  2AMC B;  3IG2 A;  2Q7E A;  2QHS A;  3REX A;  4XTX A;  3PZC A;  3V7R A;  4LNS A;  2XTI A;  4HVC A;  1YGB A;  4UP9 A;  2DU5 A;  2E5A A;  1X2H A;  4XU2 A;  1ADY A;  4YDQ A;  3FJP A;  4H2W A;  2DJZ A;  2EJF A;  4K86 A;  1BBU A;  11AS A;  1WYD A;  1BIB A;  4TTV A;  3RF1 A;  4P74 A;  3P8T A;  2E65 A;  4P74 C;  3VQW A;  3HXZ A;  1QF6 A;  5C51 B;  2AKW B;  4L87 A;  1B76 A;  1B70 B;  1IL2 A;  1G5H A;  1X2G A;  2DU7 A;  2ZT6 A;  3QO7 A;  2ZR2 A;  4YRN A;  1KOG A;  1H4V B;  4EX5 A;  4H2X B;  4CH6 A;  5ELN A;  5K1X A;  3V7C A;  4NCX A;  3RIR A;  4ZTZ B;  1NYR A;  3LC0 A;  4P3P A;  5C52 B;  3KFU A;  4LVM A;  4P3O A;  1YB3 A;  2DVE A;  3A32 A;  2AKW A;  3HXY A;  4TQF A;  4TVA B;  2ZNI A;  1RIQ A;  2ODR D;  4O2D A;  3VBB A;  2ZR3 A;  3NET A;  3MF2 A;  2CJB A;  2DTI A;  4J15 A;  4P73 A;  2J3M A;  2RHQ B;  4CS3 A;  3NEN A;  1ADJ A;  1X55 A;  2RHS B;  1SER A;  1SES A;  2E64 A;  2ARU A;  4RMF A;  3EFS A;  2HNI A;  4XTU A;  4UP8 A;  3RKY A;  2CJ9 A;  3V8L A;  1NJ5 A; 
#chains in the Genus database with same CATH homology
 1X54 A;  3BFM A;  1ASY A;  2EJ9 A;  4PG3 A;  4YRJ A;  4TVY A;  3ERR A;  4YRL A;  1E22 A;  4XU3 A;  2DZ9 A;  2ART A;  2Q7H A;  2EAY A;  3W3S A;  4CH3 A;  4YCV A;  3M4P A;  3IKL A;  3A31 A;  4CH5 A;  3VQX A;  4G84 A;  1H4S A;  2ZIN A;  4P75 A;  4LVI A;  2E10 A;  1BBW A;  4YPF A;  3HXU A;  2ALY A;  3HTZ A;  4Q6G A;  4DQ2 A;  2ODR C;  1VQZ A;  4TVA A;  5K1P A;  4P71 A;  4G85 A;  4YRG A;  1E1T A;  3UGT A;  1B8A A;  1NJ1 A;  2DQ0 A;  2RHQ A;  2ZT7 A;  3L1A A;  3REU A;  3RUX A;  4YP0 A;  1WPY A;  2AMC A;  3P8V A;  2ZCE A;  4Q15 A;  3V8K A;  2ZT8 A;  1J5W A;  4XTV A;  2C8M A;  3RGL A;  3NEM A;  4XTZ A;  3HFV A;  3LSQ A;  3BJU A;  2ZTG A;  2EL9 A;  1JJC A;  4YRC A;  1EVK A;  2E1H A;  3VQY A;  1G51 A;  1YFR A;  1WLE A;  1E1O A;  3PCO A;  4HA8 A;  4EO4 A;  1ATI A;  3EFR A;  3MF1 A;  5F5W A;  1NJ6 A;  2QHU A;  3CMQ A;  1BIA A;  2CIM A;  4ZIB A;  2Q5I A;  4LVJ A;  2IY5 B;  2I4L A;  2ZNJ A;  4XU0 A;  4P75 C;  2PME A;  4PHC A;  4E51 A;  3L2Z A;  1HTT A;  2I4N A;  4BWA A;  2ARS A;  3IAL A;  4WI1 A;  1NJ2 A;  4HT4 A;  3PCO B;  3WQZ A;  3A7U A;  3TEH A;  4K88 A;  3TEH B;  4XTW A;  1X01 A;  3E9H A;  3QNE A;  4H02 A;  3MQZ A;  3A74 A;  2DQ3 A;  2ZZF A;  1WU7 A;  3QTC A;  4YRF A;  2DXU A;  2G4C A;  3HRI A;  1YFS A;  2DZC A;  4HWT A;  5C53 B;  2DDZ A;  4YYE A;  3G1Z A;  4P72 C;  1L0W A;  1Z7N A;  4LVL A;  12AS A;  4BW9 A;  5E3I A;  4H2T A;  2P0L A;  1NYQ A;  3MEY A;  2RHS A;  3RKX A;  3A5Y A;  3RKW A;  4YRT A;  4XU1 A;  2P5I A;  3A5Z A;  1JJC B;  3IKM B;  1PYS B;  2Q7G A;  1N9W A;  4OP0 A;  4P3N A;  2DTH A;  4WF2 A;  4HWR A;  1FYF A;  1KMN A;  3LSS A;  4KQE A;  2I4O A;  3A7A A;  1HXD A;  4XEM A;  1X56 A;  2CJA A;  4ZTU B;  4CS2 A;  3P8Y A;  4X5O A;  1Z7M A;  4TVW A;  4TWA A;  4YRS A;  4H2V A;  3RL6 A;  2XGT A;  1G5I A;  4DPG A;  1WNL A;  3HFZ A;  2ALY B;  2J3L A;  2ZGW A;  1LYL A;  2CGH A;  3R07 A;  1SRY A;  4RQE A;  3UFG A;  1NJ8 A;  3E9I A;  1B70 A;  4KR2 A;  3QO8 A;  1EQR A;  1YFT A;  3I7F A;  4XEO A;  4TQD A;  3V8J A;  4P73 C;  4P71 C;  3QO5 A;  3HXV A;  1B7Y A;  3HY0 A;  5ELO A;  1H4Q A;  1B7Y B;  4OLF A;  2ZZE A;  4HWP A;  4YRO A;  2QHV A;  1W66 A;  1ASZ A;  4H2S A;  4UP7 A;  3TUP A;  1EIY A;  1EIY B;  4UPA A;  2E3C A;  1PYS A;  4HWO A;  4YRK A;  4H2U A;  4YRR A;  1USY A;  2ZIO A;  2ZT5 A;  5HGQ A;  3ICA A;  4HWS A;  4YRQ A;  3DSQ A;  3V7S A;  2QHT A;  4YRM A;  1HC7 A;  2PMF A;  2ZZG A;  3A7R A;  1EOV A;  4H2Y A;  3L4G A;  3HXX A;  2ZIM A;  2E41 A;  4LVK A;  2DKG A;  4YCU A;  1KMM A;  3M4Q A;  3HFZ B;  1H4T A;  4XTY A;  4RDX A;  3TEG A;  2FYK A;  4P72 A;  1EFW A;  1QE0 A;  1C0A A;  4RQF A;  3NEL A;  4K87 A;  4YCW A;  4H2X A;  4AH6 A;  1GGM A;  2DXT A;  4YRP A;  3UH0 A;  2IY5 A;  2C7I A;  4CS4 A;  4WJ3 M;  1EVL A;  1NNH A;  3HXW A;  4YRI A;  3HY1 A;  2Q5H A;  2DTO A;  3RAC A;  2EJG A;  1E24 A;  3L4G B;  2NS6 A;  1WQW A;  2I4M A;  3UGQ A;  2A8E A;  3VQV A;  4YRE A;  5KNN A;  2ZXF A;  4CH4 A;  4WJ4 A;  3OD1 A;  1USY C;  1WQ7 A;  2DEQ A;  2EWN A;  3HRK A;  4KR3 A;  1SET A;  2AMC B;  3IG2 A;  2Q7E A;  2QHS A;  3REX A;  4XTX A;  3PZC A;  3V7R A;  4LNS A;  2XTI A;  4HVC A;  1YGB A;  4UP9 A;  2DU5 A;  2E5A A;  1X2H A;  4XU2 A;  1ADY A;  4YDQ A;  3FJP A;  4H2W A;  2DJZ A;  2EJF A;  4K86 A;  1BBU A;  11AS A;  1WYD A;  1BIB A;  4TTV A;  3RF1 A;  4P74 A;  3P8T A;  2E65 A;  4P74 C;  3VQW A;  3HXZ A;  1QF6 A;  5C51 B;  2AKW B;  4L87 A;  1B76 A;  1B70 B;  1IL2 A;  1G5H A;  1X2G A;  2DU7 A;  2ZT6 A;  3QO7 A;  2ZR2 A;  4YRN A;  1KOG A;  1H4V B;  4EX5 A;  4H2X B;  4CH6 A;  5ELN A;  5K1X A;  3V7C A;  4NCX A;  3RIR A;  4ZTZ B;  1NYR A;  3LC0 A;  4P3P A;  5C52 B;  3KFU A;  4LVM A;  4P3O A;  1YB3 A;  2DVE A;  3A32 A;  2AKW A;  3HXY A;  4TQF A;  4TVA B;  2ZNI A;  1RIQ A;  2ODR D;  4O2D A;  3VBB A;  2ZR3 A;  3NET A;  3MF2 A;  2CJB A;  2DTI A;  4J15 A;  4P73 A;  2J3M A;  2RHQ B;  4CS3 A;  3NEN A;  1ADJ A;  1X55 A;  2RHS B;  1SER A;  1SES A;  2E64 A;  2ARU A;  4RMF A;  3EFS A;  2HNI A;  4XTU A;  4UP8 A;  3RKY A;  2CJ9 A;  3V8L A;  1NJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...