3MQZA

Crystal structure of conserved protein duf1054 from pink subaerial biofilm microbial leptospirillum sp. group ii uba.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
205
structure length
205
Chain Sequence
IERLQDYLLPEWVSIFDIADFSGRMLRIRGDIRPALLRLASRLAELLNESPGPRPWYPHVASHMRRRVNPPPETWLALGPEKRGYKSYAHSGVFIGGRGLSVRFILKDEAIEERKNLGRWMSRSGPAFEQWKKKVGDLRDFGPVHDDPMADPPKVEWDPRVFGERLGSLKSASLDIGFRVTFDTSLAGIVKTIRTFDLLYAEAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized Conserved Protein DUF1054
publication title Crystal Structure of Conserved Protein DUF1054 from Pink Subaerial Biofilm Microbial Leptospirillum sp. Group II UBA.
rcsb
source organism Leptospirillum rubarum
molecule tags Structural genomics, unknown function
total genus 64
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2010-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.20 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 3mqzA00
3MQZA 2A8EA
chains in the Genus database with same CATH superfamily
3RKXA 2IY5B 3NEMA 4P73A 2Q7HA 4ZIBA 1SRYA 3V7CA 2E65A 1G51A 4O2DA 2RHQA 4LVMA 3IKMB 4H2YA 4PHCA 2DTHA 4TVWA 3TEHB 4YRMA 4L87A 1B7YA 4HWTA 2XGTA 3OD1A 1X56A 4Q6GA 2EJGA 4K87A 4P75C 2CIMA 2CJAA 1EQRA 2EWNA 2RHSB 3IKLA 4P3NA 1W66A 4UPAA 3HXYA 3RUXA 1B70B 2ZINA 4H2TA 1NYQA 4XTYA 1HTTA 2E10A 4UP9A 3QO7A 2DDZA 3M4QA 3FJPA 2ALYB 1WQWA 2ZIMA 4RQFA 2P5IA 3P8YA 12ASA 3P8VA 2AMCA 3UH0A 5C51B 2AKWB 4YDQA 4CH3A 4OP0A 4H02A 4CS4A 3TEGA 3HXWA 3PCOB 2PMFA 4P72C 3G1ZA 4HA8A 3UFGA 4XTZA 2DQ0A 3EFRA 2DTOA 4KR2A 4P75A 2ZT5A 11ASA 2DKGA 2ZZGA 1C0AA 2ARSA 3RL6A 1Z7NA 1E22A 2QHSA 3ICAA 4H2XA 5K1PA 4EO4A 1G5HA 2DXTA 1NJ1A 4UP7A 4TTVA 4WF2A 2ZXFA 4BWAA 1KOGA 1BBWA 2Q5HA 3DSQA 4HWPA 4TWAA 4TQDA 4YRPA 3QO8A 4OLFA 3L4GB 1YB3A 1USYC 3HXXA 4P72A 5ELOA 4LVIA 1RIQA 4YRQA 4P74C 1NJ6A 3A7RA 3HFVA 1EVLA 1PYSB 4H2VA 2ZT7A 4K86A 1HXDA 3M4PA 1L0WA 3LSSA 4WI1A 4YRIA 3A5ZA 3HXUA 1Z7MA 1SERA 4DQ2A 2I4LA 1NJ2A 2ZZFA 1NJ5A 1ATIA 2EJFA 4ZTZB 3A31A 2RHQB 3NETA 1GGMA 3ERRA 4XTVA 4YRLA 1USYA 3HRIA 4XU1A 4YRSA 1B7YB 4P71C 4YRRA 3HXVA 4X5OA 1EOVA 4WJ4A 3BFMA 4HT4A 4P74A 4TVYA 3A32A 3HTZA 4H2WA 1H4SA 4J15A 3IALA 1X55A 3MEYA 3IG2A 1G5IA 4LVJA 4YPFA 4CH4A 3RGLA 2Q7EA 2E3CA 2ZCEA 3R07A 4TQFA 1X2GA 2E64A 1QF6A 2AMCB 1KMMA 3L2ZA 3MF2A 3RF1A 4CS3A 1ADYA 1B76A 4RDXA 4P71A 2CJ9A 3A7UA 4H2SA 3UGQA 3PZCA 5K1XA 4P3PA 4YROA 1ASYA 1EFWA 1WYDA 2E41A 5C52B 4XU3A 1SETA 1X01A 4CS2A 1E1OA 3WQZA 1KMNA 4H2XB 5F5WA 3HFZA 4XU0A 2I4MA 2NS6A 4HWOA 1N9WA 1EIYA 4CH5A 1X2HA 3V7RA 4TVAA 4H2UA 4YCUA 1SESA 3QO5A 2CGHA 4BW9A 4HWRA 2ZZEA 1YFRA 4YRTA 2A8EA 3EFSA 1H4TA 2ZR2A 4G85A 2P0LA 1JJCA 1ADJA 4K88A 3KFUA 2FYKA 1YFTA 3NELA 1HC7A 4YRKA 3A74A 2Q5IA 4PG3A 4YRCA 3HXZA 2I4OA 2G4CA 2J3MA 3HY0A 2C7IA 4LNSA 3REUA 1BBUA 2I4NA 1J5WA 2DU7A 3I7FA 1WNLA 2DXUA 3VQYA 3E9IA 4WJ3M 3VBBA 3V8LA 3RKWA 3RKYA 4EX5A 5E3IA 2E5AA 1NYRA 4RMFA 4UP8A 4LVLA 1FYFA 1YFSA 2DZ9A 1E1TA 2J3LA 2EAYA 2DQ3A 2ZTGA 4XTUA 4YRFA 2ZGWA 3V8KA 3NENA 4LVKA 1EVKA 1H4QA 3VQXA 2CJBA 4KQEA 3RIRA 2ZR3A 5HGQA 2DEQA 3VQVA 1BIAA 4KR3A 2C8MA 2IY5A 2ODRD 1BIBA 3E9HA 3P8TA 4P3OA 2E1HA 1E24A 4XEMA 2PMEA 3RACA 2QHUA 4ZTUB 1WLEA 3HFZB 4YRNA 3TEHA 4YCWA 4G84A 1YGBA 3CMQA 5KNNA 1EIYB 3V7SA 2DJZA 4TVAB 1LYLA 1IL2A 4DPGA 2RHSA 1NJ8A 3REXA 3HY1A 3VQWA 2ARTA 2DVEA 1B70A 3HRKA 1WPYA 2ZT6A 3A7AA 2ALYA 3MF1A 1H4VB 1VQZA 1JJCB 4XTWA 3QNEA 2AKWA 3W3SA 2ARUA 4HWSA 4AH6A 3PCOA 2HNIA 4HVCA 4RQEA 4YCVA 4XTXA 2DZCA 2EL9A 2Q7GA 4XEOA 4YREA 2DTIA 2ZNJA 3LSQA 4Q15A 4YYEA 4CH6A 3L1AA 2ZNIA 5C53B 4XU2A 3QTCA 2QHTA 5ELNA 4P73C 1X54A 4YRGA 1WQ7A 4YRJA 1NNHA 1ASZA 4NCXA 3UGTA 3L4GA 4E51A 2ZT8A 3BJUA 4YP0A 3MQZA 3TUPA 3A5YA 2DU5A 1PYSA 3LC0A 2ZIOA 3V8JA 2EJ9A 2QHVA 1B8AA 1WU7A 2ODRC 2XTIA 1QE0A
chains in the Genus database with same CATH topology
3RKXA 2IY5B 3NEMA 4P73A 2Q7HA 4ZIBA 1SRYA 3V7CA 2E65A 1G51A 4O2DA 2RHQA 4LVMA 3IKMB 4H2YA 4PHCA 2DTHA 4TVWA 3TEHB 4YRMA 4L87A 1B7YA 4HWTA 2XGTA 3OD1A 1X56A 4Q6GA 2EJGA 4K87A 4P75C 2CIMA 2CJAA 1EQRA 2EWNA 2RHSB 3IKLA 4P3NA 1W66A 4UPAA 3HXYA 3RUXA 1B70B 2ZINA 4H2TA 1NYQA 4XTYA 1HTTA 2E10A 4UP9A 3QO7A 2DDZA 3M4QA 3FJPA 2ALYB 1WQWA 2ZIMA 4RQFA 2P5IA 3P8YA 12ASA 3P8VA 2AMCA 3UH0A 5C51B 2AKWB 4YDQA 4CH3A 4OP0A 4H02A 4CS4A 3TEGA 3HXWA 3PCOB 2PMFA 4P72C 3G1ZA 4HA8A 3UFGA 4XTZA 2DQ0A 3EFRA 2DTOA 4KR2A 4P75A 2ZT5A 11ASA 2DKGA 2ZZGA 1C0AA 2ARSA 3RL6A 1Z7NA 1E22A 2QHSA 3ICAA 4H2XA 5K1PA 4EO4A 1G5HA 2DXTA 1NJ1A 4UP7A 4TTVA 4WF2A 2ZXFA 4BWAA 1KOGA 1BBWA 2Q5HA 3DSQA 4HWPA 4TWAA 4TQDA 4YRPA 3QO8A 4OLFA 3L4GB 1YB3A 1USYC 3HXXA 4P72A 5ELOA 4LVIA 1RIQA 4YRQA 4P74C 1NJ6A 3A7RA 3HFVA 1EVLA 1PYSB 4H2VA 2ZT7A 4K86A 1HXDA 3M4PA 1L0WA 3LSSA 4WI1A 4YRIA 3A5ZA 3HXUA 1Z7MA 1SERA 4DQ2A 2I4LA 1NJ2A 2ZZFA 1NJ5A 1ATIA 2EJFA 4ZTZB 3A31A 2RHQB 3NETA 1GGMA 3ERRA 4XTVA 4YRLA 1USYA 3HRIA 4XU1A 4YRSA 1B7YB 4P71C 4YRRA 3HXVA 4X5OA 1EOVA 4WJ4A 3BFMA 4HT4A 4P74A 4TVYA 3A32A 3HTZA 4H2WA 1H4SA 4J15A 3IALA 1X55A 3MEYA 3IG2A 1G5IA 4LVJA 4YPFA 4CH4A 3RGLA 2Q7EA 2E3CA 2ZCEA 3R07A 4TQFA 1X2GA 2E64A 1QF6A 2AMCB 1KMMA 3L2ZA 3MF2A 3RF1A 4CS3A 1ADYA 1B76A 4RDXA 4P71A 2CJ9A 3A7UA 4H2SA 3UGQA 3PZCA 5K1XA 4P3PA 4YROA 1ASYA 1EFWA 1WYDA 2E41A 5C52B 4XU3A 1SETA 1X01A 4CS2A 1E1OA 3WQZA 1KMNA 4H2XB 5F5WA 3HFZA 4XU0A 2I4MA 2NS6A 4HWOA 1N9WA 1EIYA 4CH5A 1X2HA 3V7RA 4TVAA 4H2UA 4YCUA 1SESA 3QO5A 2CGHA 4BW9A 4HWRA 2ZZEA 1YFRA 4YRTA 2A8EA 3EFSA 1H4TA 2ZR2A 4G85A 2P0LA 1JJCA 1ADJA 4K88A 3KFUA 2FYKA 1YFTA 3NELA 1HC7A 4YRKA 3A74A 2Q5IA 4PG3A 4YRCA 3HXZA 2I4OA 2G4CA 2J3MA 3HY0A 2C7IA 4LNSA 3REUA 1BBUA 2I4NA 1J5WA 2DU7A 3I7FA 1WNLA 2DXUA 3VQYA 3E9IA 4WJ3M 3VBBA 3V8LA 3RKWA 3RKYA 4EX5A 5E3IA 2E5AA 1NYRA 4RMFA 4UP8A 4LVLA 1FYFA 1YFSA 2DZ9A 1E1TA 2J3LA 2EAYA 2DQ3A 2ZTGA 4XTUA 4YRFA 2ZGWA 3V8KA 3NENA 4LVKA 1EVKA 1H4QA 3VQXA 2CJBA 4KQEA 3RIRA 2ZR3A 5HGQA 2DEQA 3VQVA 1BIAA 4KR3A 2C8MA 2IY5A 2ODRD 1BIBA 3E9HA 3P8TA 4P3OA 2E1HA 1E24A 4XEMA 2PMEA 3RACA 2QHUA 4ZTUB 1WLEA 3HFZB 4YRNA 3TEHA 4YCWA 4G84A 1YGBA 3CMQA 5KNNA 1EIYB 3V7SA 2DJZA 4TVAB 1LYLA 1IL2A 4DPGA 2RHSA 1NJ8A 3REXA 3HY1A 3VQWA 2ARTA 2DVEA 1B70A 3HRKA 1WPYA 2ZT6A 3A7AA 2ALYA 3MF1A 1H4VB 1VQZA 1JJCB 4XTWA 3QNEA 2AKWA 3W3SA 2ARUA 4HWSA 4AH6A 3PCOA 2HNIA 4HVCA 4RQEA 4YCVA 4XTXA 2DZCA 2EL9A 2Q7GA 4XEOA 4YREA 2DTIA 2ZNJA 3LSQA 4Q15A 4YYEA 4CH6A 3L1AA 2ZNIA 5C53B 4XU2A 3QTCA 2QHTA 5ELNA 4P73C 1X54A 4YRGA 1WQ7A 4YRJA 1NNHA 1ASZA 4NCXA 3UGTA 3L4GA 4E51A 2ZT8A 3BJUA 4YP0A 3MQZA 3TUPA 3A5YA 2DU5A 1PYSA 3LC0A 2ZIOA 3V8JA 2EJ9A 2QHVA 1B8AA 1WU7A 2ODRC 2XTIA 1QE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQZ A;  2A8E A; 
#chains in the Genus database with same CATH topology
 3RKX A;  2IY5 B;  3NEM A;  4P73 A;  2Q7H A;  4ZIB A;  1SRY A;  3V7C A;  2E65 A;  1G51 A;  4O2D A;  2RHQ A;  4LVM A;  3IKM B;  4H2Y A;  4PHC A;  2DTH A;  4TVW A;  3TEH B;  4YRM A;  4L87 A;  1B7Y A;  4HWT A;  2XGT A;  3OD1 A;  1X56 A;  4Q6G A;  2EJG A;  4K87 A;  4P75 C;  2CIM A;  2CJA A;  1EQR A;  2EWN A;  2RHS B;  3IKL A;  4P3N A;  1W66 A;  4UPA A;  3HXY A;  3RUX A;  1B70 B;  2ZIN A;  4H2T A;  1NYQ A;  4XTY A;  1HTT A;  2E10 A;  4UP9 A;  3QO7 A;  2DDZ A;  3M4Q A;  3FJP A;  2ALY B;  1WQW A;  2ZIM A;  4RQF A;  2P5I A;  3P8Y A;  12AS A;  3P8V A;  2AMC A;  3UH0 A;  5C51 B;  2AKW B;  4YDQ A;  4CH3 A;  4OP0 A;  4H02 A;  4CS4 A;  3TEG A;  3HXW A;  3PCO B;  2PMF A;  4P72 C;  3G1Z A;  4HA8 A;  3UFG A;  4XTZ A;  2DQ0 A;  3EFR A;  2DTO A;  4KR2 A;  4P75 A;  2ZT5 A;  11AS A;  2DKG A;  2ZZG A;  1C0A A;  2ARS A;  3RL6 A;  1Z7N A;  1E22 A;  2QHS A;  3ICA A;  4H2X A;  5K1P A;  4EO4 A;  1G5H A;  2DXT A;  1NJ1 A;  4UP7 A;  4TTV A;  4WF2 A;  2ZXF A;  4BWA A;  1KOG A;  1BBW A;  2Q5H A;  3DSQ A;  4HWP A;  4TWA A;  4TQD A;  4YRP A;  3QO8 A;  4OLF A;  3L4G B;  1YB3 A;  1USY C;  3HXX A;  4P72 A;  5ELO A;  4LVI A;  1RIQ A;  4YRQ A;  4P74 C;  1NJ6 A;  3A7R A;  3HFV A;  1EVL A;  1PYS B;  4H2V A;  2ZT7 A;  4K86 A;  1HXD A;  3M4P A;  1L0W A;  3LSS A;  4WI1 A;  4YRI A;  3A5Z A;  3HXU A;  1Z7M A;  1SER A;  4DQ2 A;  2I4L A;  1NJ2 A;  2ZZF A;  1NJ5 A;  1ATI A;  2EJF A;  4ZTZ B;  3A31 A;  2RHQ B;  3NET A;  1GGM A;  3ERR A;  4XTV A;  4YRL A;  1USY A;  3HRI A;  4XU1 A;  4YRS A;  1B7Y B;  4P71 C;  4YRR A;  3HXV A;  4X5O A;  1EOV A;  4WJ4 A;  3BFM A;  4HT4 A;  4P74 A;  4TVY A;  3A32 A;  3HTZ A;  4H2W A;  1H4S A;  4J15 A;  3IAL A;  1X55 A;  3MEY A;  3IG2 A;  1G5I A;  4LVJ A;  4YPF A;  4CH4 A;  3RGL A;  2Q7E A;  2E3C A;  2ZCE A;  3R07 A;  4TQF A;  1X2G A;  2E64 A;  1QF6 A;  2AMC B;  1KMM A;  3L2Z A;  3MF2 A;  3RF1 A;  4CS3 A;  1ADY A;  1B76 A;  4RDX A;  4P71 A;  2CJ9 A;  3A7U A;  4H2S A;  3UGQ A;  3PZC A;  5K1X A;  4P3P A;  4YRO A;  1ASY A;  1EFW A;  1WYD A;  2E41 A;  5C52 B;  4XU3 A;  1SET A;  1X01 A;  4CS2 A;  1E1O A;  3WQZ A;  1KMN A;  4H2X B;  5F5W A;  3HFZ A;  4XU0 A;  2I4M A;  2NS6 A;  4HWO A;  1N9W A;  1EIY A;  4CH5 A;  1X2H A;  3V7R A;  4TVA A;  4H2U A;  4YCU A;  1SES A;  3QO5 A;  2CGH A;  4BW9 A;  4HWR A;  2ZZE A;  1YFR A;  4YRT A;  2A8E A;  3EFS A;  1H4T A;  2ZR2 A;  4G85 A;  2P0L A;  1JJC A;  1ADJ A;  4K88 A;  3KFU A;  2FYK A;  1YFT A;  3NEL A;  1HC7 A;  4YRK A;  3A74 A;  2Q5I A;  4PG3 A;  4YRC A;  3HXZ A;  2I4O A;  2G4C A;  2J3M A;  3HY0 A;  2C7I A;  4LNS A;  3REU A;  1BBU A;  2I4N A;  1J5W A;  2DU7 A;  3I7F A;  1WNL A;  2DXU A;  3VQY A;  3E9I A;  4WJ3 M;  3VBB A;  3V8L A;  3RKW A;  3RKY A;  4EX5 A;  5E3I A;  2E5A A;  1NYR A;  4RMF A;  4UP8 A;  4LVL A;  1FYF A;  1YFS A;  2DZ9 A;  1E1T A;  2J3L A;  2EAY A;  2DQ3 A;  2ZTG A;  4XTU A;  4YRF A;  2ZGW A;  3V8K A;  3NEN A;  4LVK A;  1EVK A;  1H4Q A;  3VQX A;  2CJB A;  4KQE A;  3RIR A;  2ZR3 A;  5HGQ A;  2DEQ A;  3VQV A;  1BIA A;  4KR3 A;  2C8M A;  2IY5 A;  2ODR D;  1BIB A;  3E9H A;  3P8T A;  4P3O A;  2E1H A;  1E24 A;  4XEM A;  2PME A;  3RAC A;  2QHU A;  4ZTU B;  1WLE A;  3HFZ B;  4YRN A;  3TEH A;  4YCW A;  4G84 A;  1YGB A;  3CMQ A;  5KNN A;  1EIY B;  3V7S A;  2DJZ A;  4TVA B;  1LYL A;  1IL2 A;  4DPG A;  2RHS A;  1NJ8 A;  3REX A;  3HY1 A;  3VQW A;  2ART A;  2DVE A;  1B70 A;  3HRK A;  1WPY A;  2ZT6 A;  3A7A A;  2ALY A;  3MF1 A;  1H4V B;  1VQZ A;  1JJC B;  4XTW A;  3QNE A;  2AKW A;  3W3S A;  2ARU A;  4HWS A;  4AH6 A;  3PCO A;  2HNI A;  4HVC A;  4RQE A;  4YCV A;  4XTX A;  2DZC A;  2EL9 A;  2Q7G A;  4XEO A;  4YRE A;  2DTI A;  2ZNJ A;  3LSQ A;  4Q15 A;  4YYE A;  4CH6 A;  3L1A A;  2ZNI A;  5C53 B;  4XU2 A;  3QTC A;  2QHT A;  5ELN A;  4P73 C;  1X54 A;  4YRG A;  1WQ7 A;  4YRJ A;  1NNH A;  1ASZ A;  4NCX A;  3UGT A;  3L4G A;  4E51 A;  2ZT8 A;  3BJU A;  4YP0 A;  3MQZ A;  3TUP A;  3A5Y A;  2DU5 A;  1PYS A;  3LC0 A;  2ZIO A;  3V8J A;  2EJ9 A;  2QHV A;  1B8A A;  1WU7 A;  2ODR C;  2XTI A;  1QE0 A; 
#chains in the Genus database with same CATH homology
 3RKX A;  2IY5 B;  3NEM A;  4P73 A;  2Q7H A;  4ZIB A;  1SRY A;  3V7C A;  2E65 A;  1G51 A;  4O2D A;  2RHQ A;  4LVM A;  3IKM B;  4H2Y A;  4PHC A;  2DTH A;  4TVW A;  3TEH B;  4YRM A;  4L87 A;  1B7Y A;  4HWT A;  2XGT A;  3OD1 A;  1X56 A;  4Q6G A;  2EJG A;  4K87 A;  4P75 C;  2CIM A;  2CJA A;  1EQR A;  2EWN A;  2RHS B;  3IKL A;  4P3N A;  1W66 A;  4UPA A;  3HXY A;  3RUX A;  1B70 B;  2ZIN A;  4H2T A;  1NYQ A;  4XTY A;  1HTT A;  2E10 A;  4UP9 A;  3QO7 A;  2DDZ A;  3M4Q A;  3FJP A;  2ALY B;  1WQW A;  2ZIM A;  4RQF A;  2P5I A;  3P8Y A;  12AS A;  3P8V A;  2AMC A;  3UH0 A;  5C51 B;  2AKW B;  4YDQ A;  4CH3 A;  4OP0 A;  4H02 A;  4CS4 A;  3TEG A;  3HXW A;  3PCO B;  2PMF A;  4P72 C;  3G1Z A;  4HA8 A;  3UFG A;  4XTZ A;  2DQ0 A;  3EFR A;  2DTO A;  4KR2 A;  4P75 A;  2ZT5 A;  11AS A;  2DKG A;  2ZZG A;  1C0A A;  2ARS A;  3RL6 A;  1Z7N A;  1E22 A;  2QHS A;  3ICA A;  4H2X A;  5K1P A;  4EO4 A;  1G5H A;  2DXT A;  1NJ1 A;  4UP7 A;  4TTV A;  4WF2 A;  2ZXF A;  4BWA A;  1KOG A;  1BBW A;  2Q5H A;  3DSQ A;  4HWP A;  4TWA A;  4TQD A;  4YRP A;  3QO8 A;  4OLF A;  3L4G B;  1YB3 A;  1USY C;  3HXX A;  4P72 A;  5ELO A;  4LVI A;  1RIQ A;  4YRQ A;  4P74 C;  1NJ6 A;  3A7R A;  3HFV A;  1EVL A;  1PYS B;  4H2V A;  2ZT7 A;  4K86 A;  1HXD A;  3M4P A;  1L0W A;  3LSS A;  4WI1 A;  4YRI A;  3A5Z A;  3HXU A;  1Z7M A;  1SER A;  4DQ2 A;  2I4L A;  1NJ2 A;  2ZZF A;  1NJ5 A;  1ATI A;  2EJF A;  4ZTZ B;  3A31 A;  2RHQ B;  3NET A;  1GGM A;  3ERR A;  4XTV A;  4YRL A;  1USY A;  3HRI A;  4XU1 A;  4YRS A;  1B7Y B;  4P71 C;  4YRR A;  3HXV A;  4X5O A;  1EOV A;  4WJ4 A;  3BFM A;  4HT4 A;  4P74 A;  4TVY A;  3A32 A;  3HTZ A;  4H2W A;  1H4S A;  4J15 A;  3IAL A;  1X55 A;  3MEY A;  3IG2 A;  1G5I A;  4LVJ A;  4YPF A;  4CH4 A;  3RGL A;  2Q7E A;  2E3C A;  2ZCE A;  3R07 A;  4TQF A;  1X2G A;  2E64 A;  1QF6 A;  2AMC B;  1KMM A;  3L2Z A;  3MF2 A;  3RF1 A;  4CS3 A;  1ADY A;  1B76 A;  4RDX A;  4P71 A;  2CJ9 A;  3A7U A;  4H2S A;  3UGQ A;  3PZC A;  5K1X A;  4P3P A;  4YRO A;  1ASY A;  1EFW A;  1WYD A;  2E41 A;  5C52 B;  4XU3 A;  1SET A;  1X01 A;  4CS2 A;  1E1O A;  3WQZ A;  1KMN A;  4H2X B;  5F5W A;  3HFZ A;  4XU0 A;  2I4M A;  2NS6 A;  4HWO A;  1N9W A;  1EIY A;  4CH5 A;  1X2H A;  3V7R A;  4TVA A;  4H2U A;  4YCU A;  1SES A;  3QO5 A;  2CGH A;  4BW9 A;  4HWR A;  2ZZE A;  1YFR A;  4YRT A;  2A8E A;  3EFS A;  1H4T A;  2ZR2 A;  4G85 A;  2P0L A;  1JJC A;  1ADJ A;  4K88 A;  3KFU A;  2FYK A;  1YFT A;  3NEL A;  1HC7 A;  4YRK A;  3A74 A;  2Q5I A;  4PG3 A;  4YRC A;  3HXZ A;  2I4O A;  2G4C A;  2J3M A;  3HY0 A;  2C7I A;  4LNS A;  3REU A;  1BBU A;  2I4N A;  1J5W A;  2DU7 A;  3I7F A;  1WNL A;  2DXU A;  3VQY A;  3E9I A;  4WJ3 M;  3VBB A;  3V8L A;  3RKW A;  3RKY A;  4EX5 A;  5E3I A;  2E5A A;  1NYR A;  4RMF A;  4UP8 A;  4LVL A;  1FYF A;  1YFS A;  2DZ9 A;  1E1T A;  2J3L A;  2EAY A;  2DQ3 A;  2ZTG A;  4XTU A;  4YRF A;  2ZGW A;  3V8K A;  3NEN A;  4LVK A;  1EVK A;  1H4Q A;  3VQX A;  2CJB A;  4KQE A;  3RIR A;  2ZR3 A;  5HGQ A;  2DEQ A;  3VQV A;  1BIA A;  4KR3 A;  2C8M A;  2IY5 A;  2ODR D;  1BIB A;  3E9H A;  3P8T A;  4P3O A;  2E1H A;  1E24 A;  4XEM A;  2PME A;  3RAC A;  2QHU A;  4ZTU B;  1WLE A;  3HFZ B;  4YRN A;  3TEH A;  4YCW A;  4G84 A;  1YGB A;  3CMQ A;  5KNN A;  1EIY B;  3V7S A;  2DJZ A;  4TVA B;  1LYL A;  1IL2 A;  4DPG A;  2RHS A;  1NJ8 A;  3REX A;  3HY1 A;  3VQW A;  2ART A;  2DVE A;  1B70 A;  3HRK A;  1WPY A;  2ZT6 A;  3A7A A;  2ALY A;  3MF1 A;  1H4V B;  1VQZ A;  1JJC B;  4XTW A;  3QNE A;  2AKW A;  3W3S A;  2ARU A;  4HWS A;  4AH6 A;  3PCO A;  2HNI A;  4HVC A;  4RQE A;  4YCV A;  4XTX A;  2DZC A;  2EL9 A;  2Q7G A;  4XEO A;  4YRE A;  2DTI A;  2ZNJ A;  3LSQ A;  4Q15 A;  4YYE A;  4CH6 A;  3L1A A;  2ZNI A;  5C53 B;  4XU2 A;  3QTC A;  2QHT A;  5ELN A;  4P73 C;  1X54 A;  4YRG A;  1WQ7 A;  4YRJ A;  1NNH A;  1ASZ A;  4NCX A;  3UGT A;  3L4G A;  4E51 A;  2ZT8 A;  3BJU A;  4YP0 A;  3MQZ A;  3TUP A;  3A5Y A;  2DU5 A;  1PYS A;  3LC0 A;  2ZIO A;  3V8J A;  2EJ9 A;  2QHV A;  1B8A A;  1WU7 A;  2ODR C;  2XTI A;  1QE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...