3MQZA

Crystal structure of conserved protein duf1054 from pink subaerial biofilm microbial leptospirillum sp. group ii uba.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
205
structure length
205
Chain Sequence
b'IERLQDYLLPEWVSIFDIADFSGRMLRIRGDIRPALLRLASRLAELLNESPGPRPWYPHVASHMRRRVNPPPETWLALGPEKRGYKSYAHSGVFIGGRGLSVRFILKDEAIEERKNLGRWMSRSGPAFEQWKKKVGDLRDFGPVHDDPMADPPKVEWDPRVFGERLGSLKSASLDIGFRVTFDTSLAGIVKTIRTFDLLYAEAEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized Conserved Protein DUF1054
publication title Crystal Structure of Conserved Protein DUF1054 from Pink Subaerial Biofilm Microbial Leptospirillum sp. Group II UBA.
rcsb
source organism Leptospirillum rubarum
molecule tags Structural genomics, unknown function
total genus 64
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2010-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.20 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 3mqzA00
3MQZA 2A8EA
chains in the Genus database with same CATH superfamily
11ASA 2DU7A 4YRKA 4H2YA 1G5IA 2ZT7A 4CH3A 4O2DA 3A7UA 2P0LA 4TQFA 2RHSB 2A8EA 4YRLA 2ALYB 2XTIA 3HXWA 3RUXA 2ZINA 3RACA 1NJ1A 2E10A 2RHQB 3PCOB 1E1OA 3A5YA 3MF1A 4YCWA 1NYRA 4WI1A 12ASA 4XU3A 3BFMA 3BJUA 3REUA 3V8JA 2EJ9A 1YFSA 1EIYA 1NJ5A 1H4SA 2Q5IA 4TVWA 2DXUA 4UP9A 4P75A 4H2XB 2FYKA 4XU2A 4EX5A 2ZZEA 3HRIA 1ADJA 1EOVA 5F5WA 4CH5A 3IKMB 4CH6A 1SETA 3RKXA 2E64A 2CGHA 3P8TA 4TVAA 4YRQA 2I4LA 3OD1A 2ZIMA 4ZTUB 2ZCEA 2Q7GA 1SERA 4H2SA 4P74C 1BBWA 4H2TA 2ZNIA 1N9WA 3QTCA 1BBUA 4XTZA 4HWOA 1H4VB 1EQRA 5KNNA 1X2HA 5ELOA 4EO4A 2ARTA 1B70A 4LNSA 4H2UA 3E9IA 3P8YA 3EFSA 1ASZA 3HFVA 3DSQA 3RKYA 1X54A 2PMFA 2ZTGA 5C51B 3I7FA 5HGQA 2E65A 3LSSA 4LVJA 3FJPA 1SESA 3M4PA 1YFTA 5K1XA 1E24A 3HXXA 1X2GA 3UFGA 4Q6GA 4YP0A 1X56A 4YYEA 4H02A 4YRJA 3UGQA 2ZZGA 4XTVA 4LVKA 4P71C 4YRPA 1NJ2A 1BIBA 4TTVA 1W66A 2QHTA 2ZXFA 4XTYA 4G84A 4XU0A 4HWSA 1WQWA 2NS6A 2CJ9A 3TEHA 1WYDA 3PZCA 2AMCA 4UPAA 1JJCA 1PYSB 1B76A 2EJGA 4CS4A 4Q15A 2CIMA 3NELA 4RMFA 2DDZA 4TQDA 4P73C 2G4CA 1SRYA 2ZGWA 4YCVA 4HWRA 2PMEA 3VQXA 2J3LA 4YRIA 4YRRA 1GGMA 4UP8A 2EAYA 2EL9A 4TWAA 3RGLA 4XTXA 4RQFA 2ZIOA 3HRKA 3LSQA 1B7YB 1NNHA 2Q7HA 3L4GB 3QNEA 3IALA 3VQVA 4XTUA 4DQ2A 1NJ8A 3QO5A 3V7RA 4P3PA 3V7SA 2DXTA 3G1ZA 1IL2A 3HFZA 4DPGA 2I4NA 3HXZA 2I4OA 4WF2A 3VBBA 4P3NA 3V8LA 2ARUA 1LYLA 4P74A 2QHVA 4OP0A 3V7CA 4CH4A 1WLEA 1EVLA 1KMMA 3IG2A 3HY0A 4AH6A 2DQ3A 3VQYA 2RHSA 1BIAA 4KQEA 2RHQA 3TEHB 3PCOA 2AMCB 4RQEA 4CS3A 1YFRA 3RKWA 2ZR2A 3R07A 5E3IA 3HY1A 2C8MA 4UP7A 4P72C 3MEYA 1Z7NA 1HXDA 4PG3A 1G51A 3RL6A 2DJZA 1L0WA 2EJFA 3QO7A 4YRGA 4PHCA 1USYC 2IY5A 3A5ZA 4YRNA 1C0AA 4NCXA 3L2ZA 1YB3A 1EIYB 1WU7A 4P71A 1G5HA 4XU1A 3QO8A 4YRFA 4HWPA 2ODRC 2DU5A 4CS2A 4ZTZB 1KMNA 1HC7A 2QHSA 1FYFA 4YREA 3A74A 4YCUA 1VQZA 2DEQA 1WNLA 3L1AA 2EWNA 1ATIA 2HNIA 3TUPA 3MF2A 2E3CA 1E22A 3REXA 1J5WA 4P73A 2DVEA 2ARSA 2ODRD 2Q5HA 3P8VA 1EFWA 4TVAB 5K1PA 4P3OA 4HVCA 3TEGA 2CJBA 4XTWA 3LC0A 1HTTA 1X01A 4YRSA 3WQZA 3RF1A 4XEOA 3HXVA 4YRTA 2XGTA 2ZZFA 2ZT6A 2CJAA 2ZR3A 1KOGA 4BW9A 4YROA 2C7IA 1B70B 1RIQA 3CMQA 1NJ6A 1ADYA 3ERRA 1H4TA 3VQWA 2AKWA 4HT4A 4HWTA 4ZIBA 3RIRA 4YPFA 1EVKA 4X5OA 4P75C 2IY5B 2DKGA 3HXYA 3V8KA 1B8AA 3EFRA 4YRCA 3UGTA 1PYSA 2DZ9A 2Q7EA 4LVMA 3MQZA 3HXUA 3HTZA 2ALYA 2DTOA 3NETA 3KFUA 3A7RA 3IKLA 1WPYA 4J15A 2DQ0A 3E9HA 2E5AA 2QHUA 4K87A 3M4QA 4K88A 4LVLA 3A31A 1JJCB 4P72A 4KR2A 3W3SA 4XEMA 4L87A 3A7AA 1WQ7A 2DTHA 3NEMA 4YDQA 2DTIA 2P5IA 1QE0A 5C53B 5ELNA 4H2XA 1USYA 1B7YA 2J3MA 4RDXA 3L4GA 4HA8A 4K86A 4BWAA 3A32A 2DZCA 4OLFA 4KR3A 4H2VA 1QF6A 2I4MA 4G85A 4WJ4A 1E1TA 4TVYA 1X55A 3NENA 2E1HA 3ICAA 4H2WA 2E41A 1YGBA 4LVIA 2ZT5A 1ASYA 1Z7MA 3UH0A 2AKWB 2ZT8A 2ZNJA 1H4QA 4WJ3M 4YRMA 3HFZB 1NYQA 4E51A 5C52B
chains in the Genus database with same CATH topology
11ASA 2DU7A 4YRKA 4H2YA 1G5IA 2ZT7A 4CH3A 4O2DA 3A7UA 2P0LA 4TQFA 2RHSB 2A8EA 4YRLA 2ALYB 2XTIA 3HXWA 3RUXA 2ZINA 3RACA 1NJ1A 2E10A 2RHQB 3PCOB 1E1OA 3A5YA 3MF1A 4YCWA 1NYRA 4WI1A 12ASA 4XU3A 3BFMA 3BJUA 3REUA 3V8JA 2EJ9A 1YFSA 1EIYA 1NJ5A 1H4SA 2Q5IA 4TVWA 2DXUA 4UP9A 4P75A 4H2XB 2FYKA 4XU2A 4EX5A 2ZZEA 3HRIA 1ADJA 1EOVA 5F5WA 4CH5A 3IKMB 4CH6A 1SETA 3RKXA 2E64A 2CGHA 3P8TA 4TVAA 4YRQA 2I4LA 3OD1A 2ZIMA 4ZTUB 2ZCEA 2Q7GA 1SERA 4H2SA 4P74C 1BBWA 4H2TA 2ZNIA 1N9WA 3QTCA 1BBUA 4XTZA 4HWOA 1H4VB 1EQRA 5KNNA 1X2HA 5ELOA 4EO4A 2ARTA 1B70A 4LNSA 4H2UA 3E9IA 3P8YA 3EFSA 1ASZA 3HFVA 3DSQA 3RKYA 1X54A 2PMFA 2ZTGA 5C51B 3I7FA 5HGQA 2E65A 3LSSA 4LVJA 3FJPA 1SESA 3M4PA 1YFTA 5K1XA 1E24A 3HXXA 1X2GA 3UFGA 4Q6GA 4YP0A 1X56A 4YYEA 4H02A 4YRJA 3UGQA 2ZZGA 4XTVA 4LVKA 4P71C 4YRPA 1NJ2A 1BIBA 4TTVA 1W66A 2QHTA 2ZXFA 4XTYA 4G84A 4XU0A 4HWSA 1WQWA 2NS6A 2CJ9A 3TEHA 1WYDA 3PZCA 2AMCA 4UPAA 1JJCA 1PYSB 1B76A 2EJGA 4CS4A 4Q15A 2CIMA 3NELA 4RMFA 2DDZA 4TQDA 4P73C 2G4CA 1SRYA 2ZGWA 4YCVA 4HWRA 2PMEA 3VQXA 2J3LA 4YRIA 4YRRA 1GGMA 4UP8A 2EAYA 2EL9A 4TWAA 3RGLA 4XTXA 4RQFA 2ZIOA 3HRKA 3LSQA 1B7YB 1NNHA 2Q7HA 3L4GB 3QNEA 3IALA 3VQVA 4XTUA 4DQ2A 1NJ8A 3QO5A 3V7RA 4P3PA 3V7SA 2DXTA 3G1ZA 1IL2A 3HFZA 4DPGA 2I4NA 3HXZA 2I4OA 4WF2A 3VBBA 4P3NA 3V8LA 2ARUA 1LYLA 4P74A 2QHVA 4OP0A 3V7CA 4CH4A 1WLEA 1EVLA 1KMMA 3IG2A 3HY0A 4AH6A 2DQ3A 3VQYA 2RHSA 1BIAA 4KQEA 2RHQA 3TEHB 3PCOA 2AMCB 4RQEA 4CS3A 1YFRA 3RKWA 2ZR2A 3R07A 5E3IA 3HY1A 2C8MA 4UP7A 4P72C 3MEYA 1Z7NA 1HXDA 4PG3A 1G51A 3RL6A 2DJZA 1L0WA 2EJFA 3QO7A 4YRGA 4PHCA 1USYC 2IY5A 3A5ZA 4YRNA 1C0AA 4NCXA 3L2ZA 1YB3A 1EIYB 1WU7A 4P71A 1G5HA 4XU1A 3QO8A 4YRFA 4HWPA 2ODRC 2DU5A 4CS2A 4ZTZB 1KMNA 1HC7A 2QHSA 1FYFA 4YREA 3A74A 4YCUA 1VQZA 2DEQA 1WNLA 3L1AA 2EWNA 1ATIA 2HNIA 3TUPA 3MF2A 2E3CA 1E22A 3REXA 1J5WA 4P73A 2DVEA 2ARSA 2ODRD 2Q5HA 3P8VA 1EFWA 4TVAB 5K1PA 4P3OA 4HVCA 3TEGA 2CJBA 4XTWA 3LC0A 1HTTA 1X01A 4YRSA 3WQZA 3RF1A 4XEOA 3HXVA 4YRTA 2XGTA 2ZZFA 2ZT6A 2CJAA 2ZR3A 1KOGA 4BW9A 4YROA 2C7IA 1B70B 1RIQA 3CMQA 1NJ6A 1ADYA 3ERRA 1H4TA 3VQWA 2AKWA 4HT4A 4HWTA 4ZIBA 3RIRA 4YPFA 1EVKA 4X5OA 4P75C 2IY5B 2DKGA 3HXYA 3V8KA 1B8AA 3EFRA 4YRCA 3UGTA 1PYSA 2DZ9A 2Q7EA 4LVMA 3MQZA 3HXUA 3HTZA 2ALYA 2DTOA 3NETA 3KFUA 3A7RA 3IKLA 1WPYA 4J15A 2DQ0A 3E9HA 2E5AA 2QHUA 4K87A 3M4QA 4K88A 4LVLA 3A31A 1JJCB 4P72A 4KR2A 3W3SA 4XEMA 4L87A 3A7AA 1WQ7A 2DTHA 3NEMA 4YDQA 2DTIA 2P5IA 1QE0A 5C53B 5ELNA 4H2XA 1USYA 1B7YA 2J3MA 4RDXA 3L4GA 4HA8A 4K86A 4BWAA 3A32A 2DZCA 4OLFA 4KR3A 4H2VA 1QF6A 2I4MA 4G85A 4WJ4A 1E1TA 4TVYA 1X55A 3NENA 2E1HA 3ICAA 4H2WA 2E41A 1YGBA 4LVIA 2ZT5A 1ASYA 1Z7MA 3UH0A 2AKWB 2ZT8A 2ZNJA 1H4QA 4WJ3M 4YRMA 3HFZB 1NYQA 4E51A 5C52B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQZ A;  2A8E A; 
#chains in the Genus database with same CATH topology
 11AS A;  2DU7 A;  4YRK A;  4H2Y A;  1G5I A;  2ZT7 A;  4CH3 A;  4O2D A;  3A7U A;  2P0L A;  4TQF A;  2RHS B;  2A8E A;  4YRL A;  2ALY B;  2XTI A;  3HXW A;  3RUX A;  2ZIN A;  3RAC A;  1NJ1 A;  2E10 A;  2RHQ B;  3PCO B;  1E1O A;  3A5Y A;  3MF1 A;  4YCW A;  1NYR A;  4WI1 A;  12AS A;  4XU3 A;  3BFM A;  3BJU A;  3REU A;  3V8J A;  2EJ9 A;  1YFS A;  1EIY A;  1NJ5 A;  1H4S A;  2Q5I A;  4TVW A;  2DXU A;  4UP9 A;  4P75 A;  4H2X B;  2FYK A;  4XU2 A;  4EX5 A;  2ZZE A;  3HRI A;  1ADJ A;  1EOV A;  5F5W A;  4CH5 A;  3IKM B;  4CH6 A;  1SET A;  3RKX A;  2E64 A;  2CGH A;  3P8T A;  4TVA A;  4YRQ A;  2I4L A;  3OD1 A;  2ZIM A;  4ZTU B;  2ZCE A;  2Q7G A;  1SER A;  4H2S A;  4P74 C;  1BBW A;  4H2T A;  2ZNI A;  1N9W A;  3QTC A;  1BBU A;  4XTZ A;  4HWO A;  1H4V B;  1EQR A;  5KNN A;  1X2H A;  5ELO A;  4EO4 A;  2ART A;  1B70 A;  4LNS A;  4H2U A;  3E9I A;  3P8Y A;  3EFS A;  1ASZ A;  3HFV A;  3DSQ A;  3RKY A;  1X54 A;  2PMF A;  2ZTG A;  5C51 B;  3I7F A;  5HGQ A;  2E65 A;  3LSS A;  4LVJ A;  3FJP A;  1SES A;  3M4P A;  1YFT A;  5K1X A;  1E24 A;  3HXX A;  1X2G A;  3UFG A;  4Q6G A;  4YP0 A;  1X56 A;  4YYE A;  4H02 A;  4YRJ A;  3UGQ A;  2ZZG A;  4XTV A;  4LVK A;  4P71 C;  4YRP A;  1NJ2 A;  1BIB A;  4TTV A;  1W66 A;  2QHT A;  2ZXF A;  4XTY A;  4G84 A;  4XU0 A;  4HWS A;  1WQW A;  2NS6 A;  2CJ9 A;  3TEH A;  1WYD A;  3PZC A;  2AMC A;  4UPA A;  1JJC A;  1PYS B;  1B76 A;  2EJG A;  4CS4 A;  4Q15 A;  2CIM A;  3NEL A;  4RMF A;  2DDZ A;  4TQD A;  4P73 C;  2G4C A;  1SRY A;  2ZGW A;  4YCV A;  4HWR A;  2PME A;  3VQX A;  2J3L A;  4YRI A;  4YRR A;  1GGM A;  4UP8 A;  2EAY A;  2EL9 A;  4TWA A;  3RGL A;  4XTX A;  4RQF A;  2ZIO A;  3HRK A;  3LSQ A;  1B7Y B;  1NNH A;  2Q7H A;  3L4G B;  3QNE A;  3IAL A;  3VQV A;  4XTU A;  4DQ2 A;  1NJ8 A;  3QO5 A;  3V7R A;  4P3P A;  3V7S A;  2DXT A;  3G1Z A;  1IL2 A;  3HFZ A;  4DPG A;  2I4N A;  3HXZ A;  2I4O A;  4WF2 A;  3VBB A;  4P3N A;  3V8L A;  2ARU A;  1LYL A;  4P74 A;  2QHV A;  4OP0 A;  3V7C A;  4CH4 A;  1WLE A;  1EVL A;  1KMM A;  3IG2 A;  3HY0 A;  4AH6 A;  2DQ3 A;  3VQY A;  2RHS A;  1BIA A;  4KQE A;  2RHQ A;  3TEH B;  3PCO A;  2AMC B;  4RQE A;  4CS3 A;  1YFR A;  3RKW A;  2ZR2 A;  3R07 A;  5E3I A;  3HY1 A;  2C8M A;  4UP7 A;  4P72 C;  3MEY A;  1Z7N A;  1HXD A;  4PG3 A;  1G51 A;  3RL6 A;  2DJZ A;  1L0W A;  2EJF A;  3QO7 A;  4YRG A;  4PHC A;  1USY C;  2IY5 A;  3A5Z A;  4YRN A;  1C0A A;  4NCX A;  3L2Z A;  1YB3 A;  1EIY B;  1WU7 A;  4P71 A;  1G5H A;  4XU1 A;  3QO8 A;  4YRF A;  4HWP A;  2ODR C;  2DU5 A;  4CS2 A;  4ZTZ B;  1KMN A;  1HC7 A;  2QHS A;  1FYF A;  4YRE A;  3A74 A;  4YCU A;  1VQZ A;  2DEQ A;  1WNL A;  3L1A A;  2EWN A;  1ATI A;  2HNI A;  3TUP A;  3MF2 A;  2E3C A;  1E22 A;  3REX A;  1J5W A;  4P73 A;  2DVE A;  2ARS A;  2ODR D;  2Q5H A;  3P8V A;  1EFW A;  4TVA B;  5K1P A;  4P3O A;  4HVC A;  3TEG A;  2CJB A;  4XTW A;  3LC0 A;  1HTT A;  1X01 A;  4YRS A;  3WQZ A;  3RF1 A;  4XEO A;  3HXV A;  4YRT A;  2XGT A;  2ZZF A;  2ZT6 A;  2CJA A;  2ZR3 A;  1KOG A;  4BW9 A;  4YRO A;  2C7I A;  1B70 B;  1RIQ A;  3CMQ A;  1NJ6 A;  1ADY A;  3ERR A;  1H4T A;  3VQW A;  2AKW A;  4HT4 A;  4HWT A;  4ZIB A;  3RIR A;  4YPF A;  1EVK A;  4X5O A;  4P75 C;  2IY5 B;  2DKG A;  3HXY A;  3V8K A;  1B8A A;  3EFR A;  4YRC A;  3UGT A;  1PYS A;  2DZ9 A;  2Q7E A;  4LVM A;  3MQZ A;  3HXU A;  3HTZ A;  2ALY A;  2DTO A;  3NET A;  3KFU A;  3A7R A;  3IKL A;  1WPY A;  4J15 A;  2DQ0 A;  3E9H A;  2E5A A;  2QHU A;  4K87 A;  3M4Q A;  4K88 A;  4LVL A;  3A31 A;  1JJC B;  4P72 A;  4KR2 A;  3W3S A;  4XEM A;  4L87 A;  3A7A A;  1WQ7 A;  2DTH A;  3NEM A;  4YDQ A;  2DTI A;  2P5I A;  1QE0 A;  5C53 B;  5ELN A;  4H2X A;  1USY A;  1B7Y A;  2J3M A;  4RDX A;  3L4G A;  4HA8 A;  4K86 A;  4BWA A;  3A32 A;  2DZC A;  4OLF A;  4KR3 A;  4H2V A;  1QF6 A;  2I4M A;  4G85 A;  4WJ4 A;  1E1T A;  4TVY A;  1X55 A;  3NEN A;  2E1H A;  3ICA A;  4H2W A;  2E41 A;  1YGB A;  4LVI A;  2ZT5 A;  1ASY A;  1Z7M A;  3UH0 A;  2AKW B;  2ZT8 A;  2ZNJ A;  1H4Q A;  4WJ3 M;  4YRM A;  3HFZ B;  1NYQ A;  4E51 A;  5C52 B; 
#chains in the Genus database with same CATH homology
 11AS A;  2DU7 A;  4YRK A;  4H2Y A;  1G5I A;  2ZT7 A;  4CH3 A;  4O2D A;  3A7U A;  2P0L A;  4TQF A;  2RHS B;  2A8E A;  4YRL A;  2ALY B;  2XTI A;  3HXW A;  3RUX A;  2ZIN A;  3RAC A;  1NJ1 A;  2E10 A;  2RHQ B;  3PCO B;  1E1O A;  3A5Y A;  3MF1 A;  4YCW A;  1NYR A;  4WI1 A;  12AS A;  4XU3 A;  3BFM A;  3BJU A;  3REU A;  3V8J A;  2EJ9 A;  1YFS A;  1EIY A;  1NJ5 A;  1H4S A;  2Q5I A;  4TVW A;  2DXU A;  4UP9 A;  4P75 A;  4H2X B;  2FYK A;  4XU2 A;  4EX5 A;  2ZZE A;  3HRI A;  1ADJ A;  1EOV A;  5F5W A;  4CH5 A;  3IKM B;  4CH6 A;  1SET A;  3RKX A;  2E64 A;  2CGH A;  3P8T A;  4TVA A;  4YRQ A;  2I4L A;  3OD1 A;  2ZIM A;  4ZTU B;  2ZCE A;  2Q7G A;  1SER A;  4H2S A;  4P74 C;  1BBW A;  4H2T A;  2ZNI A;  1N9W A;  3QTC A;  1BBU A;  4XTZ A;  4HWO A;  1H4V B;  1EQR A;  5KNN A;  1X2H A;  5ELO A;  4EO4 A;  2ART A;  1B70 A;  4LNS A;  4H2U A;  3E9I A;  3P8Y A;  3EFS A;  1ASZ A;  3HFV A;  3DSQ A;  3RKY A;  1X54 A;  2PMF A;  2ZTG A;  5C51 B;  3I7F A;  5HGQ A;  2E65 A;  3LSS A;  4LVJ A;  3FJP A;  1SES A;  3M4P A;  1YFT A;  5K1X A;  1E24 A;  3HXX A;  1X2G A;  3UFG A;  4Q6G A;  4YP0 A;  1X56 A;  4YYE A;  4H02 A;  4YRJ A;  3UGQ A;  2ZZG A;  4XTV A;  4LVK A;  4P71 C;  4YRP A;  1NJ2 A;  1BIB A;  4TTV A;  1W66 A;  2QHT A;  2ZXF A;  4XTY A;  4G84 A;  4XU0 A;  4HWS A;  1WQW A;  2NS6 A;  2CJ9 A;  3TEH A;  1WYD A;  3PZC A;  2AMC A;  4UPA A;  1JJC A;  1PYS B;  1B76 A;  2EJG A;  4CS4 A;  4Q15 A;  2CIM A;  3NEL A;  4RMF A;  2DDZ A;  4TQD A;  4P73 C;  2G4C A;  1SRY A;  2ZGW A;  4YCV A;  4HWR A;  2PME A;  3VQX A;  2J3L A;  4YRI A;  4YRR A;  1GGM A;  4UP8 A;  2EAY A;  2EL9 A;  4TWA A;  3RGL A;  4XTX A;  4RQF A;  2ZIO A;  3HRK A;  3LSQ A;  1B7Y B;  1NNH A;  2Q7H A;  3L4G B;  3QNE A;  3IAL A;  3VQV A;  4XTU A;  4DQ2 A;  1NJ8 A;  3QO5 A;  3V7R A;  4P3P A;  3V7S A;  2DXT A;  3G1Z A;  1IL2 A;  3HFZ A;  4DPG A;  2I4N A;  3HXZ A;  2I4O A;  4WF2 A;  3VBB A;  4P3N A;  3V8L A;  2ARU A;  1LYL A;  4P74 A;  2QHV A;  4OP0 A;  3V7C A;  4CH4 A;  1WLE A;  1EVL A;  1KMM A;  3IG2 A;  3HY0 A;  4AH6 A;  2DQ3 A;  3VQY A;  2RHS A;  1BIA A;  4KQE A;  2RHQ A;  3TEH B;  3PCO A;  2AMC B;  4RQE A;  4CS3 A;  1YFR A;  3RKW A;  2ZR2 A;  3R07 A;  5E3I A;  3HY1 A;  2C8M A;  4UP7 A;  4P72 C;  3MEY A;  1Z7N A;  1HXD A;  4PG3 A;  1G51 A;  3RL6 A;  2DJZ A;  1L0W A;  2EJF A;  3QO7 A;  4YRG A;  4PHC A;  1USY C;  2IY5 A;  3A5Z A;  4YRN A;  1C0A A;  4NCX A;  3L2Z A;  1YB3 A;  1EIY B;  1WU7 A;  4P71 A;  1G5H A;  4XU1 A;  3QO8 A;  4YRF A;  4HWP A;  2ODR C;  2DU5 A;  4CS2 A;  4ZTZ B;  1KMN A;  1HC7 A;  2QHS A;  1FYF A;  4YRE A;  3A74 A;  4YCU A;  1VQZ A;  2DEQ A;  1WNL A;  3L1A A;  2EWN A;  1ATI A;  2HNI A;  3TUP A;  3MF2 A;  2E3C A;  1E22 A;  3REX A;  1J5W A;  4P73 A;  2DVE A;  2ARS A;  2ODR D;  2Q5H A;  3P8V A;  1EFW A;  4TVA B;  5K1P A;  4P3O A;  4HVC A;  3TEG A;  2CJB A;  4XTW A;  3LC0 A;  1HTT A;  1X01 A;  4YRS A;  3WQZ A;  3RF1 A;  4XEO A;  3HXV A;  4YRT A;  2XGT A;  2ZZF A;  2ZT6 A;  2CJA A;  2ZR3 A;  1KOG A;  4BW9 A;  4YRO A;  2C7I A;  1B70 B;  1RIQ A;  3CMQ A;  1NJ6 A;  1ADY A;  3ERR A;  1H4T A;  3VQW A;  2AKW A;  4HT4 A;  4HWT A;  4ZIB A;  3RIR A;  4YPF A;  1EVK A;  4X5O A;  4P75 C;  2IY5 B;  2DKG A;  3HXY A;  3V8K A;  1B8A A;  3EFR A;  4YRC A;  3UGT A;  1PYS A;  2DZ9 A;  2Q7E A;  4LVM A;  3MQZ A;  3HXU A;  3HTZ A;  2ALY A;  2DTO A;  3NET A;  3KFU A;  3A7R A;  3IKL A;  1WPY A;  4J15 A;  2DQ0 A;  3E9H A;  2E5A A;  2QHU A;  4K87 A;  3M4Q A;  4K88 A;  4LVL A;  3A31 A;  1JJC B;  4P72 A;  4KR2 A;  3W3S A;  4XEM A;  4L87 A;  3A7A A;  1WQ7 A;  2DTH A;  3NEM A;  4YDQ A;  2DTI A;  2P5I A;  1QE0 A;  5C53 B;  5ELN A;  4H2X A;  1USY A;  1B7Y A;  2J3M A;  4RDX A;  3L4G A;  4HA8 A;  4K86 A;  4BWA A;  3A32 A;  2DZC A;  4OLF A;  4KR3 A;  4H2V A;  1QF6 A;  2I4M A;  4G85 A;  4WJ4 A;  1E1T A;  4TVY A;  1X55 A;  3NEN A;  2E1H A;  3ICA A;  4H2W A;  2E41 A;  1YGB A;  4LVI A;  2ZT5 A;  1ASY A;  1Z7M A;  3UH0 A;  2AKW B;  2ZT8 A;  2ZNJ A;  1H4Q A;  4WJ3 M;  4YRM A;  3HFZ B;  1NYQ A;  4E51 A;  5C52 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...