3MQZA

Crystal structure of conserved protein duf1054 from pink subaerial biofilm microbial leptospirillum sp. group ii uba.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
205
structure length
205
Chain Sequence
IERLQDYLLPEWVSIFDIADFSGRMLRIRGDIRPALLRLASRLAELLNESPGPRPWYPHVASHMRRRVNPPPETWLALGPEKRGYKSYAHSGVFIGGRGLSVRFILKDEAIEERKNLGRWMSRSGPAFEQWKKKVGDLRDFGPVHDDPMADPPKVEWDPRVFGERLGSLKSASLDIGFRVTFDTSLAGIVKTIRTFDLLYAEAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Conserved Protein DUF1054 from Pink Subaerial Biofilm Microbial Leptospirillum sp. Group II UBA.
rcsb
source organism Leptospirillum rubarum
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized Conserved Protein DUF1054
total genus 64
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2010-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.20 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 3mqzA00
3MQZA 2A8EA
chains in the Genus database with same CATH superfamily
4CH4A 2RHSA 3TEGA 2ZGWA 4ZTZB 4P72C 1GGMA 2DU7A 4P74C 2QHUA 1BBUA 4KR2A 4YRKA 4YRMA 5HGQA 1W66A 3VBBA 2DXTA 2J3LA 2ZT7A 2DJZA 3VQYA 3HXYA 4TVYA 3TEHA 3EFRA 3IKMB 2ZZFA 3IALA 1USYA 4CH3A 3WQZA 4YPFA 1YFTA 1NJ6A 3UGTA 4EX5A 4DQ2A 3VQXA 4H2TA 4YRNA 4YYEA 3RACA 2J3MA 2C7IA 4HWPA 2DU5A 1ASZA 3HY1A 4TWAA 4AH6A 3UH0A 1NYRA 4P74A 1WPYA 3A7AA 2ZZGA 1USYC 1X01A 1SRYA 3HXWA 4XU0A 2ZCEA 1BIAA 3HY0A 3CMQA 4P75A 4XTXA 1X55A 5E3IA 4H2SA 4XTVA 3M4PA 3RKWA 1E22A 4P73A 2DVEA 1ADJA 3A32A 3HTZA 2E1HA 4LNSA 2RHSB 1NJ2A 3V8JA 1H4SA 2RHQB 2FYKA 3A31A 3QNEA 4UP8A 3RGLA 1EQRA 3M4QA 1H4TA 2AKWB 3QO8A 2CJ9A 2P5IA 1SERA 3BFMA 2EJFA 2CJAA 3A74A 4RQEA 2DDZA 1EOVA 2DXUA 2E64A 2Q5IA 2Q5HA 1X56A 3LSSA 4P71C 3G1ZA 2AMCA 4YRCA 4YRLA 1JJCB 2P0LA 4YRGA 3REXA 3PZCA 4LVLA 2PMEA 3A7RA 4P73C 3L1AA 2G4CA 3HRIA 1LYLA 1E24A 4Q6GA 4XU3A 3PCOB 3V7SA 3HRKA 2CJBA 4H2VA 4YRFA 1NJ8A 1KOGA 1Z7NA 4BWAA 4YCVA 4P72A 4CS4A 4YRQA 1ATIA 1X2HA 4BW9A 3R07A 3REUA 4HWRA 5K1XA 4KQEA 2ZIMA 3MF1A 1B8AA 1HTTA 4P3NA 2ZZEA 4XU2A 4K88A 3KFUA 4CS2A 3E9HA 3RKXA 2EAYA 4L87A 1YGBA 4YDQA 2EJGA 4TVAA 3TEHB 1NJ1A 1NJ5A 3V7RA 2DTIA 5F5WA 4X5OA 3L4GA 3A5YA 4RDXA 2ZR3A 3NEMA 2ARSA 3V8KA 1B7YA 1G5IA 4HWTA 4H2UA 4XTYA 4YRIA 4YRRA 4ZTUB 4O2DA 2QHVA 2DTHA 3E9IA 4K87A 4H2YA 2EWNA 1EFWA 4HA8A 2C8MA 2IY5B 3FJPA 3TUPA 1J5WA 3L4GB 1FYFA 1JJCA 1WNLA 2ZT5A 1Z7MA 1ASYA 4WI1A 11ASA 2ARUA 2ZIOA 2I4NA 4HWSA 1QF6A 1EVLA 4OP0A 3MQZA 3MEYA 4G85A 4RMFA 4XTZA 3NELA 3W3SA 4WJ3M 1BIBA 3QO7A 1L0WA 3RIRA 1SESA 2Q7HA 1RIQA 1ADYA 2ZXFA 3OD1A 1NYQA 2Q7EA 2ZINA 1H4QA 3UFGA 2ZNIA 3MF2A 2DQ0A 4XEMA 3VQVA 1EIYA 4YRTA 3RL6A 4Q15A 12ASA 4TQFA 2RHQA 4PHCA 4LVKA 1X2GA 2CGHA 1C0AA 4LVJA 3QO5A 2ALYA 2PMFA 4CS3A 2ZNJA 4ZIBA 3A5ZA 2DZCA 4P71A 3P8VA 4XTUA 3BJUA 4YRJA 3HFZB 3IKLA 4YCWA 1YB3A 1WQ7A 1B70B 4NCXA 2ODRD 2EL9A 4CH5A 4OLFA 3RKYA 3P8YA 4EO4A 4H2WA 5ELOA 2ALYB 4TQDA 1N9WA 4E51A 5K1PA 1NNHA 3PCOA 4YP0A 2ZT8A 1YFSA 1KMMA 2EJ9A 2NS6A 2E65A 2ARTA 1WLEA 1YFRA 2DEQA 3IG2A 5C52B 5C53B 1X54A 3HXZA 4TVAB 5ELNA 4HT4A 1G5HA 2DZ9A 3DSQA 3EFSA 1EVKA 3A7UA 4XTWA 4UP7A 1E1OA 4TTVA 4LVIA 2A8EA 2CIMA 4DPGA 1KMNA 4YREA 4WJ4A 1PYSA 3HFZA 3ERRA 1E1TA 3LC0A 2ODRC 4P3PA 4YROA 3NETA 1PYSB 2IY5A 1WYDA 4H2XA 4PG3A 2E5AA 1H4VB 1G51A 4YRSA 1SETA 1QE0A 2I4OA 4P75C 4WF2A 5KNNA 2DQ3A 2I4LA 2DKGA 3V7CA 3UGQA 1WQWA 2E10A 3VQWA 4K86A 1B7YB 4XEOA 4HVCA 5C51B 2XGTA 4G84A 3V8LA 2E41A 2QHSA 2ZT6A 4TVWA 3I7FA 4HWOA 1EIYB 3RUXA 4XU1A 4RQFA 1HC7A 2I4MA 2AKWA 2AMCB 4H2XB 4H02A 4UPAA 4P3OA 3QTCA 4UP9A 2ZTGA 2HNIA 1HXDA 2QHTA 4CH6A 2DTOA 4YRPA 1B70A 3RF1A 4KR3A 1WU7A 1VQZA 3NENA 3HFVA 3HXVA 3LSQA 1IL2A 3P8TA 2E3CA 1BBWA 2Q7GA 3HXUA 2ZR2A 2XTIA 3ICAA 1B76A 3L2ZA 4J15A 4LVMA 3HXXA 4YCUA
chains in the Genus database with same CATH topology
4CH4A 2RHSA 3TEGA 2ZGWA 4ZTZB 4P72C 1GGMA 2DU7A 4P74C 2QHUA 1BBUA 4KR2A 4YRKA 4YRMA 5HGQA 1W66A 3VBBA 2DXTA 2J3LA 2ZT7A 2DJZA 3VQYA 3HXYA 4TVYA 3TEHA 3EFRA 3IKMB 2ZZFA 3IALA 1USYA 4CH3A 3WQZA 4YPFA 1YFTA 1NJ6A 3UGTA 4EX5A 4DQ2A 3VQXA 4H2TA 4YRNA 4YYEA 3RACA 2J3MA 2C7IA 4HWPA 2DU5A 1ASZA 3HY1A 4TWAA 4AH6A 3UH0A 1NYRA 4P74A 1WPYA 3A7AA 2ZZGA 1USYC 1X01A 1SRYA 3HXWA 4XU0A 2ZCEA 1BIAA 3HY0A 3CMQA 4P75A 4XTXA 1X55A 5E3IA 4H2SA 4XTVA 3M4PA 3RKWA 1E22A 4P73A 2DVEA 1ADJA 3A32A 3HTZA 2E1HA 4LNSA 2RHSB 1NJ2A 3V8JA 1H4SA 2RHQB 2FYKA 3A31A 3QNEA 4UP8A 3RGLA 1EQRA 3M4QA 1H4TA 2AKWB 3QO8A 2CJ9A 2P5IA 1SERA 3BFMA 2EJFA 2CJAA 3A74A 4RQEA 2DDZA 1EOVA 2DXUA 2E64A 2Q5IA 2Q5HA 1X56A 3LSSA 4P71C 3G1ZA 2AMCA 4YRCA 4YRLA 1JJCB 2P0LA 4YRGA 3REXA 3PZCA 4LVLA 2PMEA 3A7RA 4P73C 3L1AA 2G4CA 3HRIA 1LYLA 1E24A 4Q6GA 4XU3A 3PCOB 3V7SA 3HRKA 2CJBA 4H2VA 4YRFA 1NJ8A 1KOGA 1Z7NA 4BWAA 4YCVA 4P72A 4CS4A 4YRQA 1ATIA 1X2HA 4BW9A 3R07A 3REUA 4HWRA 5K1XA 4KQEA 2ZIMA 3MF1A 1B8AA 1HTTA 4P3NA 2ZZEA 4XU2A 4K88A 3KFUA 4CS2A 3E9HA 3RKXA 2EAYA 4L87A 1YGBA 4YDQA 2EJGA 4TVAA 3TEHB 1NJ1A 1NJ5A 3V7RA 2DTIA 5F5WA 4X5OA 3L4GA 3A5YA 4RDXA 2ZR3A 3NEMA 2ARSA 3V8KA 1B7YA 1G5IA 4HWTA 4H2UA 4XTYA 4YRIA 4YRRA 4ZTUB 4O2DA 2QHVA 2DTHA 3E9IA 4K87A 4H2YA 2EWNA 1EFWA 4HA8A 2C8MA 2IY5B 3FJPA 3TUPA 1J5WA 3L4GB 1FYFA 1JJCA 1WNLA 2ZT5A 1Z7MA 1ASYA 4WI1A 11ASA 2ARUA 2ZIOA 2I4NA 4HWSA 1QF6A 1EVLA 4OP0A 3MQZA 3MEYA 4G85A 4RMFA 4XTZA 3NELA 3W3SA 4WJ3M 1BIBA 3QO7A 1L0WA 3RIRA 1SESA 2Q7HA 1RIQA 1ADYA 2ZXFA 3OD1A 1NYQA 2Q7EA 2ZINA 1H4QA 3UFGA 2ZNIA 3MF2A 2DQ0A 4XEMA 3VQVA 1EIYA 4YRTA 3RL6A 4Q15A 12ASA 4TQFA 2RHQA 4PHCA 4LVKA 1X2GA 2CGHA 1C0AA 4LVJA 3QO5A 2ALYA 2PMFA 4CS3A 2ZNJA 4ZIBA 3A5ZA 2DZCA 4P71A 3P8VA 4XTUA 3BJUA 4YRJA 3HFZB 3IKLA 4YCWA 1YB3A 1WQ7A 1B70B 4NCXA 2ODRD 2EL9A 4CH5A 4OLFA 3RKYA 3P8YA 4EO4A 4H2WA 5ELOA 2ALYB 4TQDA 1N9WA 4E51A 5K1PA 1NNHA 3PCOA 4YP0A 2ZT8A 1YFSA 1KMMA 2EJ9A 2NS6A 2E65A 2ARTA 1WLEA 1YFRA 2DEQA 3IG2A 5C52B 5C53B 1X54A 3HXZA 4TVAB 5ELNA 4HT4A 1G5HA 2DZ9A 3DSQA 3EFSA 1EVKA 3A7UA 4XTWA 4UP7A 1E1OA 4TTVA 4LVIA 2A8EA 2CIMA 4DPGA 1KMNA 4YREA 4WJ4A 1PYSA 3HFZA 3ERRA 1E1TA 3LC0A 2ODRC 4P3PA 4YROA 3NETA 1PYSB 2IY5A 1WYDA 4H2XA 4PG3A 2E5AA 1H4VB 1G51A 4YRSA 1SETA 1QE0A 2I4OA 4P75C 4WF2A 5KNNA 2DQ3A 2I4LA 2DKGA 3V7CA 3UGQA 1WQWA 2E10A 3VQWA 4K86A 1B7YB 4XEOA 4HVCA 5C51B 2XGTA 4G84A 3V8LA 2E41A 2QHSA 2ZT6A 4TVWA 3I7FA 4HWOA 1EIYB 3RUXA 4XU1A 4RQFA 1HC7A 2I4MA 2AKWA 2AMCB 4H2XB 4H02A 4UPAA 4P3OA 3QTCA 4UP9A 2ZTGA 2HNIA 1HXDA 2QHTA 4CH6A 2DTOA 4YRPA 1B70A 3RF1A 4KR3A 1WU7A 1VQZA 3NENA 3HFVA 3HXVA 3LSQA 1IL2A 3P8TA 2E3CA 1BBWA 2Q7GA 3HXUA 2ZR2A 2XTIA 3ICAA 1B76A 3L2ZA 4J15A 4LVMA 3HXXA 4YCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQZ A;  2A8E A; 
#chains in the Genus database with same CATH topology
 4CH4 A;  2RHS A;  3TEG A;  2ZGW A;  4ZTZ B;  4P72 C;  1GGM A;  2DU7 A;  4P74 C;  2QHU A;  1BBU A;  4KR2 A;  4YRK A;  4YRM A;  5HGQ A;  1W66 A;  3VBB A;  2DXT A;  2J3L A;  2ZT7 A;  2DJZ A;  3VQY A;  3HXY A;  4TVY A;  3TEH A;  3EFR A;  3IKM B;  2ZZF A;  3IAL A;  1USY A;  4CH3 A;  3WQZ A;  4YPF A;  1YFT A;  1NJ6 A;  3UGT A;  4EX5 A;  4DQ2 A;  3VQX A;  4H2T A;  4YRN A;  4YYE A;  3RAC A;  2J3M A;  2C7I A;  4HWP A;  2DU5 A;  1ASZ A;  3HY1 A;  4TWA A;  4AH6 A;  3UH0 A;  1NYR A;  4P74 A;  1WPY A;  3A7A A;  2ZZG A;  1USY C;  1X01 A;  1SRY A;  3HXW A;  4XU0 A;  2ZCE A;  1BIA A;  3HY0 A;  3CMQ A;  4P75 A;  4XTX A;  1X55 A;  5E3I A;  4H2S A;  4XTV A;  3M4P A;  3RKW A;  1E22 A;  4P73 A;  2DVE A;  1ADJ A;  3A32 A;  3HTZ A;  2E1H A;  4LNS A;  2RHS B;  1NJ2 A;  3V8J A;  1H4S A;  2RHQ B;  2FYK A;  3A31 A;  3QNE A;  4UP8 A;  3RGL A;  1EQR A;  3M4Q A;  1H4T A;  2AKW B;  3QO8 A;  2CJ9 A;  2P5I A;  1SER A;  3BFM A;  2EJF A;  2CJA A;  3A74 A;  4RQE A;  2DDZ A;  1EOV A;  2DXU A;  2E64 A;  2Q5I A;  2Q5H A;  1X56 A;  3LSS A;  4P71 C;  3G1Z A;  2AMC A;  4YRC A;  4YRL A;  1JJC B;  2P0L A;  4YRG A;  3REX A;  3PZC A;  4LVL A;  2PME A;  3A7R A;  4P73 C;  3L1A A;  2G4C A;  3HRI A;  1LYL A;  1E24 A;  4Q6G A;  4XU3 A;  3PCO B;  3V7S A;  3HRK A;  2CJB A;  4H2V A;  4YRF A;  1NJ8 A;  1KOG A;  1Z7N A;  4BWA A;  4YCV A;  4P72 A;  4CS4 A;  4YRQ A;  1ATI A;  1X2H A;  4BW9 A;  3R07 A;  3REU A;  4HWR A;  5K1X A;  4KQE A;  2ZIM A;  3MF1 A;  1B8A A;  1HTT A;  4P3N A;  2ZZE A;  4XU2 A;  4K88 A;  3KFU A;  4CS2 A;  3E9H A;  3RKX A;  2EAY A;  4L87 A;  1YGB A;  4YDQ A;  2EJG A;  4TVA A;  3TEH B;  1NJ1 A;  1NJ5 A;  3V7R A;  2DTI A;  5F5W A;  4X5O A;  3L4G A;  3A5Y A;  4RDX A;  2ZR3 A;  3NEM A;  2ARS A;  3V8K A;  1B7Y A;  1G5I A;  4HWT A;  4H2U A;  4XTY A;  4YRI A;  4YRR A;  4ZTU B;  4O2D A;  2QHV A;  2DTH A;  3E9I A;  4K87 A;  4H2Y A;  2EWN A;  1EFW A;  4HA8 A;  2C8M A;  2IY5 B;  3FJP A;  3TUP A;  1J5W A;  3L4G B;  1FYF A;  1JJC A;  1WNL A;  2ZT5 A;  1Z7M A;  1ASY A;  4WI1 A;  11AS A;  2ARU A;  2ZIO A;  2I4N A;  4HWS A;  1QF6 A;  1EVL A;  4OP0 A;  3MQZ A;  3MEY A;  4G85 A;  4RMF A;  4XTZ A;  3NEL A;  3W3S A;  4WJ3 M;  1BIB A;  3QO7 A;  1L0W A;  3RIR A;  1SES A;  2Q7H A;  1RIQ A;  1ADY A;  2ZXF A;  3OD1 A;  1NYQ A;  2Q7E A;  2ZIN A;  1H4Q A;  3UFG A;  2ZNI A;  3MF2 A;  2DQ0 A;  4XEM A;  3VQV A;  1EIY A;  4YRT A;  3RL6 A;  4Q15 A;  12AS A;  4TQF A;  2RHQ A;  4PHC A;  4LVK A;  1X2G A;  2CGH A;  1C0A A;  4LVJ A;  3QO5 A;  2ALY A;  2PMF A;  4CS3 A;  2ZNJ A;  4ZIB A;  3A5Z A;  2DZC A;  4P71 A;  3P8V A;  4XTU A;  3BJU A;  4YRJ A;  3HFZ B;  3IKL A;  4YCW A;  1YB3 A;  1WQ7 A;  1B70 B;  4NCX A;  2ODR D;  2EL9 A;  4CH5 A;  4OLF A;  3RKY A;  3P8Y A;  4EO4 A;  4H2W A;  5ELO A;  2ALY B;  4TQD A;  1N9W A;  4E51 A;  5K1P A;  1NNH A;  3PCO A;  4YP0 A;  2ZT8 A;  1YFS A;  1KMM A;  2EJ9 A;  2NS6 A;  2E65 A;  2ART A;  1WLE A;  1YFR A;  2DEQ A;  3IG2 A;  5C52 B;  5C53 B;  1X54 A;  3HXZ A;  4TVA B;  5ELN A;  4HT4 A;  1G5H A;  2DZ9 A;  3DSQ A;  3EFS A;  1EVK A;  3A7U A;  4XTW A;  4UP7 A;  1E1O A;  4TTV A;  4LVI A;  2A8E A;  2CIM A;  4DPG A;  1KMN A;  4YRE A;  4WJ4 A;  1PYS A;  3HFZ A;  3ERR A;  1E1T A;  3LC0 A;  2ODR C;  4P3P A;  4YRO A;  3NET A;  1PYS B;  2IY5 A;  1WYD A;  4H2X A;  4PG3 A;  2E5A A;  1H4V B;  1G51 A;  4YRS A;  1SET A;  1QE0 A;  2I4O A;  4P75 C;  4WF2 A;  5KNN A;  2DQ3 A;  2I4L A;  2DKG A;  3V7C A;  3UGQ A;  1WQW A;  2E10 A;  3VQW A;  4K86 A;  1B7Y B;  4XEO A;  4HVC A;  5C51 B;  2XGT A;  4G84 A;  3V8L A;  2E41 A;  2QHS A;  2ZT6 A;  4TVW A;  3I7F A;  4HWO A;  1EIY B;  3RUX A;  4XU1 A;  4RQF A;  1HC7 A;  2I4M A;  2AKW A;  2AMC B;  4H2X B;  4H02 A;  4UPA A;  4P3O A;  3QTC A;  4UP9 A;  2ZTG A;  2HNI A;  1HXD A;  2QHT A;  4CH6 A;  2DTO A;  4YRP A;  1B70 A;  3RF1 A;  4KR3 A;  1WU7 A;  1VQZ A;  3NEN A;  3HFV A;  3HXV A;  3LSQ A;  1IL2 A;  3P8T A;  2E3C A;  1BBW A;  2Q7G A;  3HXU A;  2ZR2 A;  2XTI A;  3ICA A;  1B76 A;  3L2Z A;  4J15 A;  4LVM A;  3HXX A;  4YCU A; 
#chains in the Genus database with same CATH homology
 4CH4 A;  2RHS A;  3TEG A;  2ZGW A;  4ZTZ B;  4P72 C;  1GGM A;  2DU7 A;  4P74 C;  2QHU A;  1BBU A;  4KR2 A;  4YRK A;  4YRM A;  5HGQ A;  1W66 A;  3VBB A;  2DXT A;  2J3L A;  2ZT7 A;  2DJZ A;  3VQY A;  3HXY A;  4TVY A;  3TEH A;  3EFR A;  3IKM B;  2ZZF A;  3IAL A;  1USY A;  4CH3 A;  3WQZ A;  4YPF A;  1YFT A;  1NJ6 A;  3UGT A;  4EX5 A;  4DQ2 A;  3VQX A;  4H2T A;  4YRN A;  4YYE A;  3RAC A;  2J3M A;  2C7I A;  4HWP A;  2DU5 A;  1ASZ A;  3HY1 A;  4TWA A;  4AH6 A;  3UH0 A;  1NYR A;  4P74 A;  1WPY A;  3A7A A;  2ZZG A;  1USY C;  1X01 A;  1SRY A;  3HXW A;  4XU0 A;  2ZCE A;  1BIA A;  3HY0 A;  3CMQ A;  4P75 A;  4XTX A;  1X55 A;  5E3I A;  4H2S A;  4XTV A;  3M4P A;  3RKW A;  1E22 A;  4P73 A;  2DVE A;  1ADJ A;  3A32 A;  3HTZ A;  2E1H A;  4LNS A;  2RHS B;  1NJ2 A;  3V8J A;  1H4S A;  2RHQ B;  2FYK A;  3A31 A;  3QNE A;  4UP8 A;  3RGL A;  1EQR A;  3M4Q A;  1H4T A;  2AKW B;  3QO8 A;  2CJ9 A;  2P5I A;  1SER A;  3BFM A;  2EJF A;  2CJA A;  3A74 A;  4RQE A;  2DDZ A;  1EOV A;  2DXU A;  2E64 A;  2Q5I A;  2Q5H A;  1X56 A;  3LSS A;  4P71 C;  3G1Z A;  2AMC A;  4YRC A;  4YRL A;  1JJC B;  2P0L A;  4YRG A;  3REX A;  3PZC A;  4LVL A;  2PME A;  3A7R A;  4P73 C;  3L1A A;  2G4C A;  3HRI A;  1LYL A;  1E24 A;  4Q6G A;  4XU3 A;  3PCO B;  3V7S A;  3HRK A;  2CJB A;  4H2V A;  4YRF A;  1NJ8 A;  1KOG A;  1Z7N A;  4BWA A;  4YCV A;  4P72 A;  4CS4 A;  4YRQ A;  1ATI A;  1X2H A;  4BW9 A;  3R07 A;  3REU A;  4HWR A;  5K1X A;  4KQE A;  2ZIM A;  3MF1 A;  1B8A A;  1HTT A;  4P3N A;  2ZZE A;  4XU2 A;  4K88 A;  3KFU A;  4CS2 A;  3E9H A;  3RKX A;  2EAY A;  4L87 A;  1YGB A;  4YDQ A;  2EJG A;  4TVA A;  3TEH B;  1NJ1 A;  1NJ5 A;  3V7R A;  2DTI A;  5F5W A;  4X5O A;  3L4G A;  3A5Y A;  4RDX A;  2ZR3 A;  3NEM A;  2ARS A;  3V8K A;  1B7Y A;  1G5I A;  4HWT A;  4H2U A;  4XTY A;  4YRI A;  4YRR A;  4ZTU B;  4O2D A;  2QHV A;  2DTH A;  3E9I A;  4K87 A;  4H2Y A;  2EWN A;  1EFW A;  4HA8 A;  2C8M A;  2IY5 B;  3FJP A;  3TUP A;  1J5W A;  3L4G B;  1FYF A;  1JJC A;  1WNL A;  2ZT5 A;  1Z7M A;  1ASY A;  4WI1 A;  11AS A;  2ARU A;  2ZIO A;  2I4N A;  4HWS A;  1QF6 A;  1EVL A;  4OP0 A;  3MQZ A;  3MEY A;  4G85 A;  4RMF A;  4XTZ A;  3NEL A;  3W3S A;  4WJ3 M;  1BIB A;  3QO7 A;  1L0W A;  3RIR A;  1SES A;  2Q7H A;  1RIQ A;  1ADY A;  2ZXF A;  3OD1 A;  1NYQ A;  2Q7E A;  2ZIN A;  1H4Q A;  3UFG A;  2ZNI A;  3MF2 A;  2DQ0 A;  4XEM A;  3VQV A;  1EIY A;  4YRT A;  3RL6 A;  4Q15 A;  12AS A;  4TQF A;  2RHQ A;  4PHC A;  4LVK A;  1X2G A;  2CGH A;  1C0A A;  4LVJ A;  3QO5 A;  2ALY A;  2PMF A;  4CS3 A;  2ZNJ A;  4ZIB A;  3A5Z A;  2DZC A;  4P71 A;  3P8V A;  4XTU A;  3BJU A;  4YRJ A;  3HFZ B;  3IKL A;  4YCW A;  1YB3 A;  1WQ7 A;  1B70 B;  4NCX A;  2ODR D;  2EL9 A;  4CH5 A;  4OLF A;  3RKY A;  3P8Y A;  4EO4 A;  4H2W A;  5ELO A;  2ALY B;  4TQD A;  1N9W A;  4E51 A;  5K1P A;  1NNH A;  3PCO A;  4YP0 A;  2ZT8 A;  1YFS A;  1KMM A;  2EJ9 A;  2NS6 A;  2E65 A;  2ART A;  1WLE A;  1YFR A;  2DEQ A;  3IG2 A;  5C52 B;  5C53 B;  1X54 A;  3HXZ A;  4TVA B;  5ELN A;  4HT4 A;  1G5H A;  2DZ9 A;  3DSQ A;  3EFS A;  1EVK A;  3A7U A;  4XTW A;  4UP7 A;  1E1O A;  4TTV A;  4LVI A;  2A8E A;  2CIM A;  4DPG A;  1KMN A;  4YRE A;  4WJ4 A;  1PYS A;  3HFZ A;  3ERR A;  1E1T A;  3LC0 A;  2ODR C;  4P3P A;  4YRO A;  3NET A;  1PYS B;  2IY5 A;  1WYD A;  4H2X A;  4PG3 A;  2E5A A;  1H4V B;  1G51 A;  4YRS A;  1SET A;  1QE0 A;  2I4O A;  4P75 C;  4WF2 A;  5KNN A;  2DQ3 A;  2I4L A;  2DKG A;  3V7C A;  3UGQ A;  1WQW A;  2E10 A;  3VQW A;  4K86 A;  1B7Y B;  4XEO A;  4HVC A;  5C51 B;  2XGT A;  4G84 A;  3V8L A;  2E41 A;  2QHS A;  2ZT6 A;  4TVW A;  3I7F A;  4HWO A;  1EIY B;  3RUX A;  4XU1 A;  4RQF A;  1HC7 A;  2I4M A;  2AKW A;  2AMC B;  4H2X B;  4H02 A;  4UPA A;  4P3O A;  3QTC A;  4UP9 A;  2ZTG A;  2HNI A;  1HXD A;  2QHT A;  4CH6 A;  2DTO A;  4YRP A;  1B70 A;  3RF1 A;  4KR3 A;  1WU7 A;  1VQZ A;  3NEN A;  3HFV A;  3HXV A;  3LSQ A;  1IL2 A;  3P8T A;  2E3C A;  1BBW A;  2Q7G A;  3HXU A;  2ZR2 A;  2XTI A;  3ICA A;  1B76 A;  3L2Z A;  4J15 A;  4LVM A;  3HXX A;  4YCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...