3MR1A

Crystal structure of methionine aminopeptidase from rickettsia prowazekii
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
249
structure length
249
Chain Sequence
SMIKIHTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFITSHNAIPAPLNYKGFPKSICTSINHVVCHGIPNDKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKHNYSVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAGNYDTILSKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Rickettsia prowazekii methionine aminopeptidase as a promising target for the development of antibacterial agents.
pubmed doi rcsb
source organism Rickettsia prowazekii
molecule tags Hydrolase
total genus 79
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3mr1A00
2BHBA 1C27A 2BWYA 1QXZA 2P9AA 2BWVA 2OKNA 1XGMA 1YVMA 4U73A 4MATA 4PNCA 1QXWA 4U6WA 3PKEA 2HOWA 3PKCA 3MATA 4Z7MA 2BHAA 1XNZA 4IKRA 3CTZA 1M35A 1QZYA 4IPAA 5D6FA 2EVOA 3MX6A 3TAVA 4U6JA 2GG7A 3MR1A 1MATA 2Q95A 3FM3A 2B3KA 4FLLA 4IKSA 4FUKA 4A6WA 1R5HA 4RZYA 2IW2A 4IECA 2GU7A 3IU9A 4FLKA 1C22A 2BWXA 1WL9A 4IDYA 4U70A 5JI6A 4OOKA 4FLJA 4PV4A 1WN1A 4QR8A 4S2TP 4IU6A 2BWTA 2GU5A 2GG5A 3TB5A 1BN5A 1BOAA 1C21A 1YW9A 2Q96A 3BIQA 3PKAA 3RORA 1C23A 3PKBA 3CB5A 5E5BA 5FCHA 1Y1NA 4B28A 4FO7A 1XGSA 4U6EA 1WBQA 2GGBA 3RVAA 2B3HA 2EA4A 2B3LA 4FKCA 1WKMA 2ZSGA 2BHCA 2BH3A 5CE6A 2GA2A 1B6AA 2Q94A 1WL6A 2BB7A 1B59A 5CNXA 1WY2A 2P98A 4U71A 3IU7A 4R60A 4U69A 2GG0A 2Q8KA 3L24A 2MATA 1PV9A 4S2RP 5JHUA 1KQ9A 4IF7A 5CDLA 3IU8A 3L7GA 2GG3A 1A16A 3CB6A 4KM3A 2BN7A 2EA2A 1JAWA 2NQ7A 4RGZ1 3S6BA 2V3YA 1KQ0A 2EVMA 3FMRA 4U6CA 4ZWPA 2OAZA 5CDVA 2GGCA 4FO8A 1YW8A 5CIKA 3IG4A 2DFIA 4S00A 2G6PA 2GTXA 2GG8A 3BITA 1KP0A 1QXYA 5CDEA 2V3ZA 2GG9A 1YW7A 2EVCA 3BIPA 2NQ6A 1N51A 4S01A 3PKDA 1XGOA 4IKTA 1C24A 1WLRA 5D6EA 2BWUA 2BWWA 4RZZA 3Q6DA 2BHDA 2GU6A 4A6VA 4IKUA 4ZWUA 2ADUA 1W7VA 2V6CA 4U75A 4JUQA 1R58A 4U1BA 5FCFA 1W2MA 2GG2A 1XGNA 4ZWOA 1CHMA 4ZNGA 1YJ3A 3FMQA 2GU4A 1O0XA 2V3XA 1R5GA 2GZ5A 2Q93A 4FLIA 2Q92A 5CLSA 4EGEA 4U76A 3D27A 4HXXA 4U6ZA 2P99A 2BWSA 5JFRA
chains in the Genus database with same CATH superfamily
2BHBA 1C27A 2BWYA 1QXZA 2P9AA 2BWVA 2OKNA 1XGMA 1YVMA 4U73A 4MATA 4PNCA 1QXWA 4U6WA 3PKEA 2HOWA 3PKCA 3MATA 4Z7MA 2BHAA 1XNZA 4IKRA 3CTZA 1M35A 1QZYA 4IPAA 5D6FA 2EVOA 3MX6A 3TAVA 4U6JA 2GG7A 3MR1A 1MATA 2Q95A 3FM3A 2B3KA 4FLLA 4IKSA 4FUKA 4A6WA 1R5HA 4RZYA 2IW2A 4IECA 2GU7A 3IU9A 4FLKA 1C22A 2BWXA 1WL9A 4IDYA 4U70A 5JI6A 4OOKA 4FLJA 4PV4A 1WN1A 4QR8A 4S2TP 4IU6A 2BWTA 2GU5A 2GG5A 3TB5A 1BN5A 1BOAA 1C21A 1YW9A 2Q96A 3BIQA 3PKAA 3RORA 1C23A 3PKBA 3CB5A 5E5BA 5FCHA 1Y1NA 4B28A 4FO7A 1XGSA 4U6EA 1WBQA 2GGBA 3RVAA 2B3HA 2EA4A 2B3LA 4FKCA 1WKMA 2ZSGA 2BHCA 2BH3A 5CE6A 2GA2A 1B6AA 2Q94A 1WL6A 2BB7A 1B59A 5CNXA 1WY2A 2P98A 4U71A 3IU7A 4R60A 4U69A 2GG0A 2Q8KA 3L24A 2MATA 1PV9A 4S2RP 5JHUA 1KQ9A 4IF7A 5CDLA 3IU8A 3L7GA 2GG3A 1A16A 3CB6A 4KM3A 2BN7A 2EA2A 1JAWA 2NQ7A 4RGZ1 3S6BA 2V3YA 1KQ0A 2EVMA 3FMRA 4U6CA 4ZWPA 2OAZA 5CDVA 2GGCA 4FO8A 1YW8A 5CIKA 3IG4A 2DFIA 4S00A 2G6PA 2GTXA 2GG8A 3BITA 1KP0A 1QXYA 5CDEA 2V3ZA 2GG9A 1YW7A 2EVCA 3BIPA 2NQ6A 1N51A 4S01A 3PKDA 1XGOA 4IKTA 1C24A 1WLRA 5D6EA 2BWUA 2BWWA 4RZZA 3Q6DA 2BHDA 2GU6A 4A6VA 4IKUA 4ZWUA 2ADUA 1W7VA 2V6CA 4U75A 4JUQA 1R58A 4U1BA 5FCFA 1W2MA 2GG2A 1XGNA 4ZWOA 1CHMA 4ZNGA 1YJ3A 3FMQA 2GU4A 1O0XA 2V3XA 1R5GA 2GZ5A 2Q93A 4FLIA 2Q92A 5CLSA 4EGEA 4U76A 3D27A 4HXXA 4U6ZA 2P99A 2BWSA 5JFRA
chains in the Genus database with same CATH topology
2BHBA 1C27A 2BWYA 1QXZA 2P9AA 2BWVA 2OKNA 1XGMA 1YVMA 4U73A 4MATA 4PNCA 1QXWA 4U6WA 3PKEA 2HOWA 3PKCA 3MATA 4Z7MA 2BHAA 1XNZA 4IKRA 3CTZA 1M35A 1QZYA 4IPAA 5D6FA 2EVOA 3MX6A 3TAVA 4U6JA 2GG7A 3MR1A 1MATA 2Q95A 3FM3A 2B3KA 4FLLA 4IKSA 4FUKA 4A6WA 1R5HA 4RZYA 2IW2A 4IECA 2GU7A 3IU9A 4FLKA 1C22A 2BWXA 1WL9A 4IDYA 4U70A 5JI6A 4OOKA 4FLJA 4PV4A 1WN1A 4QR8A 4S2TP 4IU6A 2BWTA 2GU5A 2GG5A 3TB5A 1BN5A 1BOAA 1C21A 1YW9A 2Q96A 3BIQA 3PKAA 3RORA 1C23A 3PKBA 3CB5A 5E5BA 5FCHA 1Y1NA 4B28A 4FO7A 1XGSA 4U6EA 1WBQA 2GGBA 3RVAA 2B3HA 2EA4A 2B3LA 4FKCA 1WKMA 2ZSGA 2BHCA 2BH3A 5CE6A 2GA2A 1B6AA 2Q94A 1WL6A 2BB7A 1B59A 5CNXA 1WY2A 2P98A 4U71A 3IU7A 4R60A 4U69A 2GG0A 2Q8KA 3L24A 2MATA 1PV9A 4S2RP 5JHUA 1KQ9A 4IF7A 5CDLA 3IU8A 3L7GA 2GG3A 1A16A 3CB6A 4KM3A 2BN7A 2EA2A 1JAWA 2NQ7A 4RGZ1 3S6BA 2V3YA 1KQ0A 2EVMA 3FMRA 4U6CA 4ZWPA 2OAZA 5CDVA 2GGCA 4FO8A 1YW8A 5CIKA 3IG4A 2DFIA 4S00A 2G6PA 2GTXA 2GG8A 3BITA 1KP0A 1QXYA 5CDEA 2V3ZA 2GG9A 1YW7A 2EVCA 3BIPA 2NQ6A 1N51A 4S01A 3PKDA 1XGOA 4IKTA 1C24A 1WLRA 5D6EA 2BWUA 2BWWA 4RZZA 3Q6DA 2BHDA 2GU6A 4A6VA 4IKUA 4ZWUA 2ADUA 1W7VA 2V6CA 4U75A 4JUQA 1R58A 4U1BA 5FCFA 1W2MA 2GG2A 1XGNA 4ZWOA 1CHMA 4ZNGA 1YJ3A 3FMQA 2GU4A 1O0XA 2V3XA 1R5GA 2GZ5A 2Q93A 4FLIA 2Q92A 5CLSA 4EGEA 4U76A 3D27A 4HXXA 4U6ZA 2P99A 2BWSA 5JFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BHB A;  1C27 A;  2BWY A;  1QXZ A;  2P9A A;  2BWV A;  2OKN A;  1XGM A;  1YVM A;  4U73 A;  4MAT A;  4PNC A;  1QXW A;  4U6W A;  3PKE A;  2HOW A;  3PKC A;  3MAT A;  4Z7M A;  2BHA A;  1XNZ A;  4IKR A;  3CTZ A;  1M35 A;  1QZY A;  4IPA A;  5D6F A;  2EVO A;  3MX6 A;  3TAV A;  4U6J A;  2GG7 A;  3MR1 A;  1MAT A;  2Q95 A;  3FM3 A;  2B3K A;  4FLL A;  4IKS A;  4FUK A;  4A6W A;  1R5H A;  4RZY A;  2IW2 A;  4IEC A;  2GU7 A;  3IU9 A;  4FLK A;  1C22 A;  2BWX A;  1WL9 A;  4IDY A;  4U70 A;  5JI6 A;  4OOK A;  4FLJ A;  4PV4 A;  1WN1 A;  4QR8 A;  4S2T P;  4IU6 A;  2BWT A;  2GU5 A;  2GG5 A;  3TB5 A;  1BN5 A;  1BOA A;  1C21 A;  1YW9 A;  2Q96 A;  3BIQ A;  3PKA A;  3ROR A;  1C23 A;  3PKB A;  3CB5 A;  5E5B A;  5FCH A;  1Y1N A;  4B28 A;  4FO7 A;  1XGS A;  4U6E A;  1WBQ A;  2GGB A;  3RVA A;  2B3H A;  2EA4 A;  2B3L A;  4FKC A;  1WKM A;  2ZSG A;  2BHC A;  2BH3 A;  5CE6 A;  2GA2 A;  1B6A A;  2Q94 A;  1WL6 A;  2BB7 A;  1B59 A;  5CNX A;  1WY2 A;  2P98 A;  4U71 A;  3IU7 A;  4R60 A;  4U69 A;  2GG0 A;  2Q8K A;  3L24 A;  2MAT A;  1PV9 A;  4S2R P;  5JHU A;  1KQ9 A;  4IF7 A;  5CDL A;  3IU8 A;  3L7G A;  2GG3 A;  1A16 A;  3CB6 A;  4KM3 A;  2BN7 A;  2EA2 A;  1JAW A;  2NQ7 A;  4RGZ 1;  3S6B A;  2V3Y A;  1KQ0 A;  2EVM A;  3FMR A;  4U6C A;  4ZWP A;  2OAZ A;  5CDV A;  2GGC A;  4FO8 A;  1YW8 A;  5CIK A;  3IG4 A;  2DFI A;  4S00 A;  2G6P A;  2GTX A;  2GG8 A;  3BIT A;  1KP0 A;  1QXY A;  5CDE A;  2V3Z A;  2GG9 A;  1YW7 A;  2EVC A;  3BIP A;  2NQ6 A;  1N51 A;  4S01 A;  3PKD A;  1XGO A;  4IKT A;  1C24 A;  1WLR A;  5D6E A;  2BWU A;  2BWW A;  4RZZ A;  3Q6D A;  2BHD A;  2GU6 A;  4A6V A;  4IKU A;  4ZWU A;  2ADU A;  1W7V A;  2V6C A;  4U75 A;  4JUQ A;  1R58 A;  4U1B A;  5FCF A;  1W2M A;  2GG2 A;  1XGN A;  4ZWO A;  1CHM A;  4ZNG A;  1YJ3 A;  3FMQ A;  2GU4 A;  1O0X A;  2V3X A;  1R5G A;  2GZ5 A;  2Q93 A;  4FLI A;  2Q92 A;  5CLS A;  4EGE A;  4U76 A;  3D27 A;  4HXX A;  4U6Z A;  2P99 A;  2BWS A;  5JFR A; 
#chains in the Genus database with same CATH topology
 2BHB A;  1C27 A;  2BWY A;  1QXZ A;  2P9A A;  2BWV A;  2OKN A;  1XGM A;  1YVM A;  4U73 A;  4MAT A;  4PNC A;  1QXW A;  4U6W A;  3PKE A;  2HOW A;  3PKC A;  3MAT A;  4Z7M A;  2BHA A;  1XNZ A;  4IKR A;  3CTZ A;  1M35 A;  1QZY A;  4IPA A;  5D6F A;  2EVO A;  3MX6 A;  3TAV A;  4U6J A;  2GG7 A;  3MR1 A;  1MAT A;  2Q95 A;  3FM3 A;  2B3K A;  4FLL A;  4IKS A;  4FUK A;  4A6W A;  1R5H A;  4RZY A;  2IW2 A;  4IEC A;  2GU7 A;  3IU9 A;  4FLK A;  1C22 A;  2BWX A;  1WL9 A;  4IDY A;  4U70 A;  5JI6 A;  4OOK A;  4FLJ A;  4PV4 A;  1WN1 A;  4QR8 A;  4S2T P;  4IU6 A;  2BWT A;  2GU5 A;  2GG5 A;  3TB5 A;  1BN5 A;  1BOA A;  1C21 A;  1YW9 A;  2Q96 A;  3BIQ A;  3PKA A;  3ROR A;  1C23 A;  3PKB A;  3CB5 A;  5E5B A;  5FCH A;  1Y1N A;  4B28 A;  4FO7 A;  1XGS A;  4U6E A;  1WBQ A;  2GGB A;  3RVA A;  2B3H A;  2EA4 A;  2B3L A;  4FKC A;  1WKM A;  2ZSG A;  2BHC A;  2BH3 A;  5CE6 A;  2GA2 A;  1B6A A;  2Q94 A;  1WL6 A;  2BB7 A;  1B59 A;  5CNX A;  1WY2 A;  2P98 A;  4U71 A;  3IU7 A;  4R60 A;  4U69 A;  2GG0 A;  2Q8K A;  3L24 A;  2MAT A;  1PV9 A;  4S2R P;  5JHU A;  1KQ9 A;  4IF7 A;  5CDL A;  3IU8 A;  3L7G A;  2GG3 A;  1A16 A;  3CB6 A;  4KM3 A;  2BN7 A;  2EA2 A;  1JAW A;  2NQ7 A;  4RGZ 1;  3S6B A;  2V3Y A;  1KQ0 A;  2EVM A;  3FMR A;  4U6C A;  4ZWP A;  2OAZ A;  5CDV A;  2GGC A;  4FO8 A;  1YW8 A;  5CIK A;  3IG4 A;  2DFI A;  4S00 A;  2G6P A;  2GTX A;  2GG8 A;  3BIT A;  1KP0 A;  1QXY A;  5CDE A;  2V3Z A;  2GG9 A;  1YW7 A;  2EVC A;  3BIP A;  2NQ6 A;  1N51 A;  4S01 A;  3PKD A;  1XGO A;  4IKT A;  1C24 A;  1WLR A;  5D6E A;  2BWU A;  2BWW A;  4RZZ A;  3Q6D A;  2BHD A;  2GU6 A;  4A6V A;  4IKU A;  4ZWU A;  2ADU A;  1W7V A;  2V6C A;  4U75 A;  4JUQ A;  1R58 A;  4U1B A;  5FCF A;  1W2M A;  2GG2 A;  1XGN A;  4ZWO A;  1CHM A;  4ZNG A;  1YJ3 A;  3FMQ A;  2GU4 A;  1O0X A;  2V3X A;  1R5G A;  2GZ5 A;  2Q93 A;  4FLI A;  2Q92 A;  5CLS A;  4EGE A;  4U76 A;  3D27 A;  4HXX A;  4U6Z A;  2P99 A;  2BWS A;  5JFR A; 
#chains in the Genus database with same CATH homology
 2BHB A;  1C27 A;  2BWY A;  1QXZ A;  2P9A A;  2BWV A;  2OKN A;  1XGM A;  1YVM A;  4U73 A;  4MAT A;  4PNC A;  1QXW A;  4U6W A;  3PKE A;  2HOW A;  3PKC A;  3MAT A;  4Z7M A;  2BHA A;  1XNZ A;  4IKR A;  3CTZ A;  1M35 A;  1QZY A;  4IPA A;  5D6F A;  2EVO A;  3MX6 A;  3TAV A;  4U6J A;  2GG7 A;  3MR1 A;  1MAT A;  2Q95 A;  3FM3 A;  2B3K A;  4FLL A;  4IKS A;  4FUK A;  4A6W A;  1R5H A;  4RZY A;  2IW2 A;  4IEC A;  2GU7 A;  3IU9 A;  4FLK A;  1C22 A;  2BWX A;  1WL9 A;  4IDY A;  4U70 A;  5JI6 A;  4OOK A;  4FLJ A;  4PV4 A;  1WN1 A;  4QR8 A;  4S2T P;  4IU6 A;  2BWT A;  2GU5 A;  2GG5 A;  3TB5 A;  1BN5 A;  1BOA A;  1C21 A;  1YW9 A;  2Q96 A;  3BIQ A;  3PKA A;  3ROR A;  1C23 A;  3PKB A;  3CB5 A;  5E5B A;  5FCH A;  1Y1N A;  4B28 A;  4FO7 A;  1XGS A;  4U6E A;  1WBQ A;  2GGB A;  3RVA A;  2B3H A;  2EA4 A;  2B3L A;  4FKC A;  1WKM A;  2ZSG A;  2BHC A;  2BH3 A;  5CE6 A;  2GA2 A;  1B6A A;  2Q94 A;  1WL6 A;  2BB7 A;  1B59 A;  5CNX A;  1WY2 A;  2P98 A;  4U71 A;  3IU7 A;  4R60 A;  4U69 A;  2GG0 A;  2Q8K A;  3L24 A;  2MAT A;  1PV9 A;  4S2R P;  5JHU A;  1KQ9 A;  4IF7 A;  5CDL A;  3IU8 A;  3L7G A;  2GG3 A;  1A16 A;  3CB6 A;  4KM3 A;  2BN7 A;  2EA2 A;  1JAW A;  2NQ7 A;  4RGZ 1;  3S6B A;  2V3Y A;  1KQ0 A;  2EVM A;  3FMR A;  4U6C A;  4ZWP A;  2OAZ A;  5CDV A;  2GGC A;  4FO8 A;  1YW8 A;  5CIK A;  3IG4 A;  2DFI A;  4S00 A;  2G6P A;  2GTX A;  2GG8 A;  3BIT A;  1KP0 A;  1QXY A;  5CDE A;  2V3Z A;  2GG9 A;  1YW7 A;  2EVC A;  3BIP A;  2NQ6 A;  1N51 A;  4S01 A;  3PKD A;  1XGO A;  4IKT A;  1C24 A;  1WLR A;  5D6E A;  2BWU A;  2BWW A;  4RZZ A;  3Q6D A;  2BHD A;  2GU6 A;  4A6V A;  4IKU A;  4ZWU A;  2ADU A;  1W7V A;  2V6C A;  4U75 A;  4JUQ A;  1R58 A;  4U1B A;  5FCF A;  1W2M A;  2GG2 A;  1XGN A;  4ZWO A;  1CHM A;  4ZNG A;  1YJ3 A;  3FMQ A;  2GU4 A;  1O0X A;  2V3X A;  1R5G A;  2GZ5 A;  2Q93 A;  4FLI A;  2Q92 A;  5CLS A;  4EGE A;  4U76 A;  3D27 A;  4HXX A;  4U6Z A;  2P99 A;  2BWS A;  5JFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...