3MR1A

Crystal structure of methionine aminopeptidase from rickettsia prowazekii
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
249
structure length
249
Chain Sequence
SMIKIHTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFITSHNAIPAPLNYKGFPKSICTSINHVVCHGIPNDKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKHNYSVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAGNYDTILSKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Rickettsia prowazekii methionine aminopeptidase as a promising target for the development of antibacterial agents.
pubmed doi rcsb
source organism Rickettsia prowazekii
molecule tags Hydrolase
total genus 79
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3mr1A00
3PKEA 3FM3A 2DFIA 3BITA 4MATA 4RZYA 5D6EA 4IECA 4FLIA 2P9AA 1WY2A 3MR1A 2IW2A 2GGCA 1C21A 4U1BA 2GZ5A 1KQ9A 5CE6A 2EA2A 2MATA 2GGBA 2GG8A 2Q95A 2B3LA 2B3KA 4IDYA 3IU8A 3FMRA 1N51A 2P98A 5JFRA 1R5GA 3CB5A 4S01A 3FMQA 4S2RP 3S6BA 1C27A 1XGNA 4U75A 1YW8A 2GG7A 1YJ3A 2EVOA 5D6FA 2V3XA 3PKAA 4U6EA 1R5HA 3IU9A 1XGMA 3PKDA 2OKNA 1M35A 1YW7A 2ZSGA 4FLJA 2GG2A 2G6PA 2NQ6A 2OAZA 2Q93A 4PV4A 1C23A 1Y1NA 1O0XA 2GG3A 1XNZA 3MATA 1WBQA 4U6ZA 3TAVA 1BOAA 4U76A 4Z7MA 1QXYA 4KM3A 1C24A 2Q94A 4FUKA 1QXZA 2ADUA 2HOWA 4ZWUA 3IG4A 3L24A 2BWWA 3MX6A 2Q92A 4IKRA 4FKCA 1XGOA 1C22A 1WKMA 3IU7A 5CIKA 4RGZ1 3BIQA 4IKUA 2NQ7A 1R58A 2BHCA 2BHBA 4S00A 4QR8A 1WN1A 4FO8A 4S2TP 5CLSA 1MATA 2EA4A 2Q96A 2BWTA 1JAWA 2GA2A 2GG9A 2V3YA 4IF7A 4PNCA 4R60A 2V6CA 5E5BA 2BWSA 4U71A 5CNXA 1YVMA 2B3HA 5CDEA 2GG5A 4FO7A 2BH3A 4U70A 5CDVA 5FCFA 5JHUA 3PKBA 4U6WA 4U69A 2P99A 1XGSA 4HXXA 1WLRA 2GG0A 4OOKA 4ZWPA 4U6JA 4B28A 3CB6A 2GU6A 4ZNGA 2BWYA 2GU4A 4IKTA 4FLKA 4IPAA 2GTXA 1WL6A 3RORA 4A6WA 2BHAA 1BN5A 1QZYA 4JUQA 2GU5A 3PKCA 1KP0A 1W2MA 4ZWOA 4U73A 2V3ZA 4IU6A 1B59A 2BWUA 2BWVA 2BHDA 2BB7A 1WL9A 4A6VA 4IKSA 1PV9A 3Q6DA 2Q8KA 4U6CA 2GU7A 4FLLA 3L7GA 5JI6A 1CHMA 1A16A 2BN7A 1YW9A 4RZZA 2EVMA 3D27A 5FCHA 2BWXA 1W7VA 3CTZA 3RVAA 3TB5A 5CDLA 1QXWA 3BIPA 4EGEA 2EVCA 1KQ0A 1B6AA
chains in the Genus database with same CATH superfamily
3PKEA 3FM3A 2DFIA 3BITA 4MATA 4RZYA 5D6EA 4IECA 4FLIA 2P9AA 1WY2A 3MR1A 2IW2A 2GGCA 1C21A 4U1BA 2GZ5A 1KQ9A 5CE6A 2EA2A 2MATA 2GGBA 2GG8A 2Q95A 2B3LA 2B3KA 4IDYA 3IU8A 3FMRA 1N51A 2P98A 5JFRA 1R5GA 3CB5A 4S01A 3FMQA 4S2RP 3S6BA 1C27A 1XGNA 4U75A 1YW8A 2GG7A 1YJ3A 2EVOA 5D6FA 2V3XA 3PKAA 4U6EA 1R5HA 3IU9A 1XGMA 3PKDA 2OKNA 1M35A 1YW7A 2ZSGA 4FLJA 2GG2A 2G6PA 2NQ6A 2OAZA 2Q93A 4PV4A 1C23A 1Y1NA 1O0XA 2GG3A 1XNZA 3MATA 1WBQA 4U6ZA 3TAVA 1BOAA 4U76A 4Z7MA 1QXYA 4KM3A 1C24A 2Q94A 4FUKA 1QXZA 2ADUA 2HOWA 4ZWUA 3IG4A 3L24A 2BWWA 3MX6A 2Q92A 4IKRA 4FKCA 1XGOA 1C22A 1WKMA 3IU7A 5CIKA 4RGZ1 3BIQA 4IKUA 2NQ7A 1R58A 2BHCA 2BHBA 4S00A 4QR8A 1WN1A 4FO8A 4S2TP 5CLSA 1MATA 2EA4A 2Q96A 2BWTA 1JAWA 2GA2A 2GG9A 2V3YA 4IF7A 4PNCA 4R60A 2V6CA 5E5BA 2BWSA 4U71A 5CNXA 1YVMA 2B3HA 5CDEA 2GG5A 4FO7A 2BH3A 4U70A 5CDVA 5FCFA 5JHUA 3PKBA 4U6WA 4U69A 2P99A 1XGSA 4HXXA 1WLRA 2GG0A 4OOKA 4ZWPA 4U6JA 4B28A 3CB6A 2GU6A 4ZNGA 2BWYA 2GU4A 4IKTA 4FLKA 4IPAA 2GTXA 1WL6A 3RORA 4A6WA 2BHAA 1BN5A 1QZYA 4JUQA 2GU5A 3PKCA 1KP0A 1W2MA 4ZWOA 4U73A 2V3ZA 4IU6A 1B59A 2BWUA 2BWVA 2BHDA 2BB7A 1WL9A 4A6VA 4IKSA 1PV9A 3Q6DA 2Q8KA 4U6CA 2GU7A 4FLLA 3L7GA 5JI6A 1CHMA 1A16A 2BN7A 1YW9A 4RZZA 2EVMA 3D27A 5FCHA 2BWXA 1W7VA 3CTZA 3RVAA 3TB5A 5CDLA 1QXWA 3BIPA 4EGEA 2EVCA 1KQ0A 1B6AA
chains in the Genus database with same CATH topology
3PKEA 3FM3A 2DFIA 3BITA 4MATA 4RZYA 5D6EA 4IECA 4FLIA 2P9AA 1WY2A 3MR1A 2IW2A 2GGCA 1C21A 4U1BA 2GZ5A 1KQ9A 5CE6A 2EA2A 2MATA 2GGBA 2GG8A 2Q95A 2B3LA 2B3KA 4IDYA 3IU8A 3FMRA 1N51A 2P98A 5JFRA 1R5GA 3CB5A 4S01A 3FMQA 4S2RP 3S6BA 1C27A 1XGNA 4U75A 1YW8A 2GG7A 1YJ3A 2EVOA 5D6FA 2V3XA 3PKAA 4U6EA 1R5HA 3IU9A 1XGMA 3PKDA 2OKNA 1M35A 1YW7A 2ZSGA 4FLJA 2GG2A 2G6PA 2NQ6A 2OAZA 2Q93A 4PV4A 1C23A 1Y1NA 1O0XA 2GG3A 1XNZA 3MATA 1WBQA 4U6ZA 3TAVA 1BOAA 4U76A 4Z7MA 1QXYA 4KM3A 1C24A 2Q94A 4FUKA 1QXZA 2ADUA 2HOWA 4ZWUA 3IG4A 3L24A 2BWWA 3MX6A 2Q92A 4IKRA 4FKCA 1XGOA 1C22A 1WKMA 3IU7A 5CIKA 4RGZ1 3BIQA 4IKUA 2NQ7A 1R58A 2BHCA 2BHBA 4S00A 4QR8A 1WN1A 4FO8A 4S2TP 5CLSA 1MATA 2EA4A 2Q96A 2BWTA 1JAWA 2GA2A 2GG9A 2V3YA 4IF7A 4PNCA 4R60A 2V6CA 5E5BA 2BWSA 4U71A 5CNXA 1YVMA 2B3HA 5CDEA 2GG5A 4FO7A 2BH3A 4U70A 5CDVA 5FCFA 5JHUA 3PKBA 4U6WA 4U69A 2P99A 1XGSA 4HXXA 1WLRA 2GG0A 4OOKA 4ZWPA 4U6JA 4B28A 3CB6A 2GU6A 4ZNGA 2BWYA 2GU4A 4IKTA 4FLKA 4IPAA 2GTXA 1WL6A 3RORA 4A6WA 2BHAA 1BN5A 1QZYA 4JUQA 2GU5A 3PKCA 1KP0A 1W2MA 4ZWOA 4U73A 2V3ZA 4IU6A 1B59A 2BWUA 2BWVA 2BHDA 2BB7A 1WL9A 4A6VA 4IKSA 1PV9A 3Q6DA 2Q8KA 4U6CA 2GU7A 4FLLA 3L7GA 5JI6A 1CHMA 1A16A 2BN7A 1YW9A 4RZZA 2EVMA 3D27A 5FCHA 2BWXA 1W7VA 3CTZA 3RVAA 3TB5A 5CDLA 1QXWA 3BIPA 4EGEA 2EVCA 1KQ0A 1B6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PKE A;  3FM3 A;  2DFI A;  3BIT A;  4MAT A;  4RZY A;  5D6E A;  4IEC A;  4FLI A;  2P9A A;  1WY2 A;  3MR1 A;  2IW2 A;  2GGC A;  1C21 A;  4U1B A;  2GZ5 A;  1KQ9 A;  5CE6 A;  2EA2 A;  2MAT A;  2GGB A;  2GG8 A;  2Q95 A;  2B3L A;  2B3K A;  4IDY A;  3IU8 A;  3FMR A;  1N51 A;  2P98 A;  5JFR A;  1R5G A;  3CB5 A;  4S01 A;  3FMQ A;  4S2R P;  3S6B A;  1C27 A;  1XGN A;  4U75 A;  1YW8 A;  2GG7 A;  1YJ3 A;  2EVO A;  5D6F A;  2V3X A;  3PKA A;  4U6E A;  1R5H A;  3IU9 A;  1XGM A;  3PKD A;  2OKN A;  1M35 A;  1YW7 A;  2ZSG A;  4FLJ A;  2GG2 A;  2G6P A;  2NQ6 A;  2OAZ A;  2Q93 A;  4PV4 A;  1C23 A;  1Y1N A;  1O0X A;  2GG3 A;  1XNZ A;  3MAT A;  1WBQ A;  4U6Z A;  3TAV A;  1BOA A;  4U76 A;  4Z7M A;  1QXY A;  4KM3 A;  1C24 A;  2Q94 A;  4FUK A;  1QXZ A;  2ADU A;  2HOW A;  4ZWU A;  3IG4 A;  3L24 A;  2BWW A;  3MX6 A;  2Q92 A;  4IKR A;  4FKC A;  1XGO A;  1C22 A;  1WKM A;  3IU7 A;  5CIK A;  4RGZ 1;  3BIQ A;  4IKU A;  2NQ7 A;  1R58 A;  2BHC A;  2BHB A;  4S00 A;  4QR8 A;  1WN1 A;  4FO8 A;  4S2T P;  5CLS A;  1MAT A;  2EA4 A;  2Q96 A;  2BWT A;  1JAW A;  2GA2 A;  2GG9 A;  2V3Y A;  4IF7 A;  4PNC A;  4R60 A;  2V6C A;  5E5B A;  2BWS A;  4U71 A;  5CNX A;  1YVM A;  2B3H A;  5CDE A;  2GG5 A;  4FO7 A;  2BH3 A;  4U70 A;  5CDV A;  5FCF A;  5JHU A;  3PKB A;  4U6W A;  4U69 A;  2P99 A;  1XGS A;  4HXX A;  1WLR A;  2GG0 A;  4OOK A;  4ZWP A;  4U6J A;  4B28 A;  3CB6 A;  2GU6 A;  4ZNG A;  2BWY A;  2GU4 A;  4IKT A;  4FLK A;  4IPA A;  2GTX A;  1WL6 A;  3ROR A;  4A6W A;  2BHA A;  1BN5 A;  1QZY A;  4JUQ A;  2GU5 A;  3PKC A;  1KP0 A;  1W2M A;  4ZWO A;  4U73 A;  2V3Z A;  4IU6 A;  1B59 A;  2BWU A;  2BWV A;  2BHD A;  2BB7 A;  1WL9 A;  4A6V A;  4IKS A;  1PV9 A;  3Q6D A;  2Q8K A;  4U6C A;  2GU7 A;  4FLL A;  3L7G A;  5JI6 A;  1CHM A;  1A16 A;  2BN7 A;  1YW9 A;  4RZZ A;  2EVM A;  3D27 A;  5FCH A;  2BWX A;  1W7V A;  3CTZ A;  3RVA A;  3TB5 A;  5CDL A;  1QXW A;  3BIP A;  4EGE A;  2EVC A;  1KQ0 A;  1B6A A; 
#chains in the Genus database with same CATH topology
 3PKE A;  3FM3 A;  2DFI A;  3BIT A;  4MAT A;  4RZY A;  5D6E A;  4IEC A;  4FLI A;  2P9A A;  1WY2 A;  3MR1 A;  2IW2 A;  2GGC A;  1C21 A;  4U1B A;  2GZ5 A;  1KQ9 A;  5CE6 A;  2EA2 A;  2MAT A;  2GGB A;  2GG8 A;  2Q95 A;  2B3L A;  2B3K A;  4IDY A;  3IU8 A;  3FMR A;  1N51 A;  2P98 A;  5JFR A;  1R5G A;  3CB5 A;  4S01 A;  3FMQ A;  4S2R P;  3S6B A;  1C27 A;  1XGN A;  4U75 A;  1YW8 A;  2GG7 A;  1YJ3 A;  2EVO A;  5D6F A;  2V3X A;  3PKA A;  4U6E A;  1R5H A;  3IU9 A;  1XGM A;  3PKD A;  2OKN A;  1M35 A;  1YW7 A;  2ZSG A;  4FLJ A;  2GG2 A;  2G6P A;  2NQ6 A;  2OAZ A;  2Q93 A;  4PV4 A;  1C23 A;  1Y1N A;  1O0X A;  2GG3 A;  1XNZ A;  3MAT A;  1WBQ A;  4U6Z A;  3TAV A;  1BOA A;  4U76 A;  4Z7M A;  1QXY A;  4KM3 A;  1C24 A;  2Q94 A;  4FUK A;  1QXZ A;  2ADU A;  2HOW A;  4ZWU A;  3IG4 A;  3L24 A;  2BWW A;  3MX6 A;  2Q92 A;  4IKR A;  4FKC A;  1XGO A;  1C22 A;  1WKM A;  3IU7 A;  5CIK A;  4RGZ 1;  3BIQ A;  4IKU A;  2NQ7 A;  1R58 A;  2BHC A;  2BHB A;  4S00 A;  4QR8 A;  1WN1 A;  4FO8 A;  4S2T P;  5CLS A;  1MAT A;  2EA4 A;  2Q96 A;  2BWT A;  1JAW A;  2GA2 A;  2GG9 A;  2V3Y A;  4IF7 A;  4PNC A;  4R60 A;  2V6C A;  5E5B A;  2BWS A;  4U71 A;  5CNX A;  1YVM A;  2B3H A;  5CDE A;  2GG5 A;  4FO7 A;  2BH3 A;  4U70 A;  5CDV A;  5FCF A;  5JHU A;  3PKB A;  4U6W A;  4U69 A;  2P99 A;  1XGS A;  4HXX A;  1WLR A;  2GG0 A;  4OOK A;  4ZWP A;  4U6J A;  4B28 A;  3CB6 A;  2GU6 A;  4ZNG A;  2BWY A;  2GU4 A;  4IKT A;  4FLK A;  4IPA A;  2GTX A;  1WL6 A;  3ROR A;  4A6W A;  2BHA A;  1BN5 A;  1QZY A;  4JUQ A;  2GU5 A;  3PKC A;  1KP0 A;  1W2M A;  4ZWO A;  4U73 A;  2V3Z A;  4IU6 A;  1B59 A;  2BWU A;  2BWV A;  2BHD A;  2BB7 A;  1WL9 A;  4A6V A;  4IKS A;  1PV9 A;  3Q6D A;  2Q8K A;  4U6C A;  2GU7 A;  4FLL A;  3L7G A;  5JI6 A;  1CHM A;  1A16 A;  2BN7 A;  1YW9 A;  4RZZ A;  2EVM A;  3D27 A;  5FCH A;  2BWX A;  1W7V A;  3CTZ A;  3RVA A;  3TB5 A;  5CDL A;  1QXW A;  3BIP A;  4EGE A;  2EVC A;  1KQ0 A;  1B6A A; 
#chains in the Genus database with same CATH homology
 3PKE A;  3FM3 A;  2DFI A;  3BIT A;  4MAT A;  4RZY A;  5D6E A;  4IEC A;  4FLI A;  2P9A A;  1WY2 A;  3MR1 A;  2IW2 A;  2GGC A;  1C21 A;  4U1B A;  2GZ5 A;  1KQ9 A;  5CE6 A;  2EA2 A;  2MAT A;  2GGB A;  2GG8 A;  2Q95 A;  2B3L A;  2B3K A;  4IDY A;  3IU8 A;  3FMR A;  1N51 A;  2P98 A;  5JFR A;  1R5G A;  3CB5 A;  4S01 A;  3FMQ A;  4S2R P;  3S6B A;  1C27 A;  1XGN A;  4U75 A;  1YW8 A;  2GG7 A;  1YJ3 A;  2EVO A;  5D6F A;  2V3X A;  3PKA A;  4U6E A;  1R5H A;  3IU9 A;  1XGM A;  3PKD A;  2OKN A;  1M35 A;  1YW7 A;  2ZSG A;  4FLJ A;  2GG2 A;  2G6P A;  2NQ6 A;  2OAZ A;  2Q93 A;  4PV4 A;  1C23 A;  1Y1N A;  1O0X A;  2GG3 A;  1XNZ A;  3MAT A;  1WBQ A;  4U6Z A;  3TAV A;  1BOA A;  4U76 A;  4Z7M A;  1QXY A;  4KM3 A;  1C24 A;  2Q94 A;  4FUK A;  1QXZ A;  2ADU A;  2HOW A;  4ZWU A;  3IG4 A;  3L24 A;  2BWW A;  3MX6 A;  2Q92 A;  4IKR A;  4FKC A;  1XGO A;  1C22 A;  1WKM A;  3IU7 A;  5CIK A;  4RGZ 1;  3BIQ A;  4IKU A;  2NQ7 A;  1R58 A;  2BHC A;  2BHB A;  4S00 A;  4QR8 A;  1WN1 A;  4FO8 A;  4S2T P;  5CLS A;  1MAT A;  2EA4 A;  2Q96 A;  2BWT A;  1JAW A;  2GA2 A;  2GG9 A;  2V3Y A;  4IF7 A;  4PNC A;  4R60 A;  2V6C A;  5E5B A;  2BWS A;  4U71 A;  5CNX A;  1YVM A;  2B3H A;  5CDE A;  2GG5 A;  4FO7 A;  2BH3 A;  4U70 A;  5CDV A;  5FCF A;  5JHU A;  3PKB A;  4U6W A;  4U69 A;  2P99 A;  1XGS A;  4HXX A;  1WLR A;  2GG0 A;  4OOK A;  4ZWP A;  4U6J A;  4B28 A;  3CB6 A;  2GU6 A;  4ZNG A;  2BWY A;  2GU4 A;  4IKT A;  4FLK A;  4IPA A;  2GTX A;  1WL6 A;  3ROR A;  4A6W A;  2BHA A;  1BN5 A;  1QZY A;  4JUQ A;  2GU5 A;  3PKC A;  1KP0 A;  1W2M A;  4ZWO A;  4U73 A;  2V3Z A;  4IU6 A;  1B59 A;  2BWU A;  2BWV A;  2BHD A;  2BB7 A;  1WL9 A;  4A6V A;  4IKS A;  1PV9 A;  3Q6D A;  2Q8K A;  4U6C A;  2GU7 A;  4FLL A;  3L7G A;  5JI6 A;  1CHM A;  1A16 A;  2BN7 A;  1YW9 A;  4RZZ A;  2EVM A;  3D27 A;  5FCH A;  2BWX A;  1W7V A;  3CTZ A;  3RVA A;  3TB5 A;  5CDL A;  1QXW A;  3BIP A;  4EGE A;  2EVC A;  1KQ0 A;  1B6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...