3MR1A

Crystal structure of methionine aminopeptidase from rickettsia prowazekii
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
249
structure length
249
Chain Sequence
SMIKIHTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFITSHNAIPAPLNYKGFPKSICTSINHVVCHGIPNDKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKHNYSVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAGNYDTILSKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rickettsia prowazekii methionine aminopeptidase as a promising target for the development of antibacterial agents.
pubmed doi rcsb
source organism Rickettsia prowazekii
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 79
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3mr1A00
2BWUA 4RZZA 2BWYA 2BHDA 2MATA 5JHUA 5D6FA 3PKDA 3MR1A 1O0XA 2GG0A 2GU4A 3IU8A 4OOKA 2EVCA 2HOWA 4FO7A 2V6CA 1WN1A 4IPAA 4Z7MA 3PKEA 3Q6DA 2Q93A 2IW2A 4U1BA 2Q96A 3PKAA 4S00A 2GG9A 1W2MA 1QXYA 2BHAA 2EA2A 3BIQA 4U6WA 4S2TP 1R58A 1N51A 4ZWOA 4U69A 3D27A 5CLSA 3CTZA 1KQ9A 4ZNGA 2P98A 5CIKA 4A6WA 5JFRA 1XGNA 1KQ0A 2GZ5A 1WLRA 4B28A 3L7GA 4IU6A 3TAVA 5CDVA 2GA2A 5E5BA 2Q94A 3IG4A 5CDLA 3PKCA 3IU9A 4JUQA 5CNXA 2GU7A 4PV4A 3RVAA 4U76A 5CE6A 4HXXA 4S2RP 2GG5A 1Y1NA 5CDEA 1R5HA 4FLKA 5D6EA 1XGMA 4U75A 1C27A 1BOAA 2BWVA 2DFIA 2GTXA 4FLJA 4MATA 4FO8A 2BWWA 1BN5A 1YW9A 4U6CA 2Q8KA 1W7VA 5JI6A 1B59A 4IDYA 4IKUA 4A6VA 3L24A 2B3LA 2P9AA 4FLIA 1XGSA 2GU5A 1JAWA 4IKTA 1WY2A 1WBQA 4U6ZA 4RZYA 3FMQA 4PNCA 4ZWPA 4FUKA 3BITA 3TB5A 3IU7A 4IKSA 2B3KA 2ZSGA 2BWXA 2V3ZA 4IKRA 1WKMA 1XGOA 3S6BA 4QR8A 1YVMA 1YJ3A 2GGBA 3CB5A 1WL6A 2EA4A 2GG7A 1WL9A 2GG3A 1B6AA 4IECA 2GU6A 3FMRA 2GGCA 2NQ7A 3CB6A 1C24A 1A16A 2BH3A 2Q95A 4FKCA 4KM3A 4U6JA 2ADUA 1C23A 4RGZ1 2BHCA 4U6EA 1QXWA 1QZYA 2BHBA 3FM3A 3MATA 1PV9A 1C22A 2OKNA 3RORA 2GG8A 2P99A 2OAZA 1YW8A 4U70A 1R5GA 4S01A 4EGEA 2EVMA 4U71A 5FCHA 1MATA 1KP0A 3PKBA 2V3XA 2B3HA 3MX6A 2BWSA 2NQ6A 3BIPA 1C21A 4IF7A 4U73A 1CHMA 1XNZA 2BN7A 2EVOA 2V3YA 1M35A 2GG2A 2BWTA 1QXZA 2G6PA 4ZWUA 2Q92A 4R60A 5FCFA 4FLLA 2BB7A 1YW7A
chains in the Genus database with same CATH superfamily
2BWUA 4RZZA 2BWYA 2BHDA 2MATA 5JHUA 5D6FA 3PKDA 3MR1A 1O0XA 2GG0A 2GU4A 3IU8A 4OOKA 2EVCA 2HOWA 4FO7A 2V6CA 1WN1A 4IPAA 4Z7MA 3PKEA 3Q6DA 2Q93A 2IW2A 4U1BA 2Q96A 3PKAA 4S00A 2GG9A 1W2MA 1QXYA 2BHAA 2EA2A 3BIQA 4U6WA 4S2TP 1R58A 1N51A 4ZWOA 4U69A 3D27A 5CLSA 3CTZA 1KQ9A 4ZNGA 2P98A 5CIKA 4A6WA 5JFRA 1XGNA 1KQ0A 2GZ5A 1WLRA 4B28A 3L7GA 4IU6A 3TAVA 5CDVA 2GA2A 5E5BA 2Q94A 3IG4A 5CDLA 3PKCA 3IU9A 4JUQA 5CNXA 2GU7A 4PV4A 3RVAA 4U76A 5CE6A 4HXXA 4S2RP 2GG5A 1Y1NA 5CDEA 1R5HA 4FLKA 5D6EA 1XGMA 4U75A 1C27A 1BOAA 2BWVA 2DFIA 2GTXA 4FLJA 4MATA 4FO8A 2BWWA 1BN5A 1YW9A 4U6CA 2Q8KA 1W7VA 5JI6A 1B59A 4IDYA 4IKUA 4A6VA 3L24A 2B3LA 2P9AA 4FLIA 1XGSA 2GU5A 1JAWA 4IKTA 1WY2A 1WBQA 4U6ZA 4RZYA 3FMQA 4PNCA 4ZWPA 4FUKA 3BITA 3TB5A 3IU7A 4IKSA 2B3KA 2ZSGA 2BWXA 2V3ZA 4IKRA 1WKMA 1XGOA 3S6BA 4QR8A 1YVMA 1YJ3A 2GGBA 3CB5A 1WL6A 2EA4A 2GG7A 1WL9A 2GG3A 1B6AA 4IECA 2GU6A 3FMRA 2GGCA 2NQ7A 3CB6A 1C24A 1A16A 2BH3A 2Q95A 4FKCA 4KM3A 4U6JA 2ADUA 1C23A 4RGZ1 2BHCA 4U6EA 1QXWA 1QZYA 2BHBA 3FM3A 3MATA 1PV9A 1C22A 2OKNA 3RORA 2GG8A 2P99A 2OAZA 1YW8A 4U70A 1R5GA 4S01A 4EGEA 2EVMA 4U71A 5FCHA 1MATA 1KP0A 3PKBA 2V3XA 2B3HA 3MX6A 2BWSA 2NQ6A 3BIPA 1C21A 4IF7A 4U73A 1CHMA 1XNZA 2BN7A 2EVOA 2V3YA 1M35A 2GG2A 2BWTA 1QXZA 2G6PA 4ZWUA 2Q92A 4R60A 5FCFA 4FLLA 2BB7A 1YW7A
chains in the Genus database with same CATH topology
2BWUA 4RZZA 2BWYA 2BHDA 2MATA 5JHUA 5D6FA 3PKDA 3MR1A 1O0XA 2GG0A 2GU4A 3IU8A 4OOKA 2EVCA 2HOWA 4FO7A 2V6CA 1WN1A 4IPAA 4Z7MA 3PKEA 3Q6DA 2Q93A 2IW2A 4U1BA 2Q96A 3PKAA 4S00A 2GG9A 1W2MA 1QXYA 2BHAA 2EA2A 3BIQA 4U6WA 4S2TP 1R58A 1N51A 4ZWOA 4U69A 3D27A 5CLSA 3CTZA 1KQ9A 4ZNGA 2P98A 5CIKA 4A6WA 5JFRA 1XGNA 1KQ0A 2GZ5A 1WLRA 4B28A 3L7GA 4IU6A 3TAVA 5CDVA 2GA2A 5E5BA 2Q94A 3IG4A 5CDLA 3PKCA 3IU9A 4JUQA 5CNXA 2GU7A 4PV4A 3RVAA 4U76A 5CE6A 4HXXA 4S2RP 2GG5A 1Y1NA 5CDEA 1R5HA 4FLKA 5D6EA 1XGMA 4U75A 1C27A 1BOAA 2BWVA 2DFIA 2GTXA 4FLJA 4MATA 4FO8A 2BWWA 1BN5A 1YW9A 4U6CA 2Q8KA 1W7VA 5JI6A 1B59A 4IDYA 4IKUA 4A6VA 3L24A 2B3LA 2P9AA 4FLIA 1XGSA 2GU5A 1JAWA 4IKTA 1WY2A 1WBQA 4U6ZA 4RZYA 3FMQA 4PNCA 4ZWPA 4FUKA 3BITA 3TB5A 3IU7A 4IKSA 2B3KA 2ZSGA 2BWXA 2V3ZA 4IKRA 1WKMA 1XGOA 3S6BA 4QR8A 1YVMA 1YJ3A 2GGBA 3CB5A 1WL6A 2EA4A 2GG7A 1WL9A 2GG3A 1B6AA 4IECA 2GU6A 3FMRA 2GGCA 2NQ7A 3CB6A 1C24A 1A16A 2BH3A 2Q95A 4FKCA 4KM3A 4U6JA 2ADUA 1C23A 4RGZ1 2BHCA 4U6EA 1QXWA 1QZYA 2BHBA 3FM3A 3MATA 1PV9A 1C22A 2OKNA 3RORA 2GG8A 2P99A 2OAZA 1YW8A 4U70A 1R5GA 4S01A 4EGEA 2EVMA 4U71A 5FCHA 1MATA 1KP0A 3PKBA 2V3XA 2B3HA 3MX6A 2BWSA 2NQ6A 3BIPA 1C21A 4IF7A 4U73A 1CHMA 1XNZA 2BN7A 2EVOA 2V3YA 1M35A 2GG2A 2BWTA 1QXZA 2G6PA 4ZWUA 2Q92A 4R60A 5FCFA 4FLLA 2BB7A 1YW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWU A;  4RZZ A;  2BWY A;  2BHD A;  2MAT A;  5JHU A;  5D6F A;  3PKD A;  3MR1 A;  1O0X A;  2GG0 A;  2GU4 A;  3IU8 A;  4OOK A;  2EVC A;  2HOW A;  4FO7 A;  2V6C A;  1WN1 A;  4IPA A;  4Z7M A;  3PKE A;  3Q6D A;  2Q93 A;  2IW2 A;  4U1B A;  2Q96 A;  3PKA A;  4S00 A;  2GG9 A;  1W2M A;  1QXY A;  2BHA A;  2EA2 A;  3BIQ A;  4U6W A;  4S2T P;  1R58 A;  1N51 A;  4ZWO A;  4U69 A;  3D27 A;  5CLS A;  3CTZ A;  1KQ9 A;  4ZNG A;  2P98 A;  5CIK A;  4A6W A;  5JFR A;  1XGN A;  1KQ0 A;  2GZ5 A;  1WLR A;  4B28 A;  3L7G A;  4IU6 A;  3TAV A;  5CDV A;  2GA2 A;  5E5B A;  2Q94 A;  3IG4 A;  5CDL A;  3PKC A;  3IU9 A;  4JUQ A;  5CNX A;  2GU7 A;  4PV4 A;  3RVA A;  4U76 A;  5CE6 A;  4HXX A;  4S2R P;  2GG5 A;  1Y1N A;  5CDE A;  1R5H A;  4FLK A;  5D6E A;  1XGM A;  4U75 A;  1C27 A;  1BOA A;  2BWV A;  2DFI A;  2GTX A;  4FLJ A;  4MAT A;  4FO8 A;  2BWW A;  1BN5 A;  1YW9 A;  4U6C A;  2Q8K A;  1W7V A;  5JI6 A;  1B59 A;  4IDY A;  4IKU A;  4A6V A;  3L24 A;  2B3L A;  2P9A A;  4FLI A;  1XGS A;  2GU5 A;  1JAW A;  4IKT A;  1WY2 A;  1WBQ A;  4U6Z A;  4RZY A;  3FMQ A;  4PNC A;  4ZWP A;  4FUK A;  3BIT A;  3TB5 A;  3IU7 A;  4IKS A;  2B3K A;  2ZSG A;  2BWX A;  2V3Z A;  4IKR A;  1WKM A;  1XGO A;  3S6B A;  4QR8 A;  1YVM A;  1YJ3 A;  2GGB A;  3CB5 A;  1WL6 A;  2EA4 A;  2GG7 A;  1WL9 A;  2GG3 A;  1B6A A;  4IEC A;  2GU6 A;  3FMR A;  2GGC A;  2NQ7 A;  3CB6 A;  1C24 A;  1A16 A;  2BH3 A;  2Q95 A;  4FKC A;  4KM3 A;  4U6J A;  2ADU A;  1C23 A;  4RGZ 1;  2BHC A;  4U6E A;  1QXW A;  1QZY A;  2BHB A;  3FM3 A;  3MAT A;  1PV9 A;  1C22 A;  2OKN A;  3ROR A;  2GG8 A;  2P99 A;  2OAZ A;  1YW8 A;  4U70 A;  1R5G A;  4S01 A;  4EGE A;  2EVM A;  4U71 A;  5FCH A;  1MAT A;  1KP0 A;  3PKB A;  2V3X A;  2B3H A;  3MX6 A;  2BWS A;  2NQ6 A;  3BIP A;  1C21 A;  4IF7 A;  4U73 A;  1CHM A;  1XNZ A;  2BN7 A;  2EVO A;  2V3Y A;  1M35 A;  2GG2 A;  2BWT A;  1QXZ A;  2G6P A;  4ZWU A;  2Q92 A;  4R60 A;  5FCF A;  4FLL A;  2BB7 A;  1YW7 A; 
#chains in the Genus database with same CATH topology
 2BWU A;  4RZZ A;  2BWY A;  2BHD A;  2MAT A;  5JHU A;  5D6F A;  3PKD A;  3MR1 A;  1O0X A;  2GG0 A;  2GU4 A;  3IU8 A;  4OOK A;  2EVC A;  2HOW A;  4FO7 A;  2V6C A;  1WN1 A;  4IPA A;  4Z7M A;  3PKE A;  3Q6D A;  2Q93 A;  2IW2 A;  4U1B A;  2Q96 A;  3PKA A;  4S00 A;  2GG9 A;  1W2M A;  1QXY A;  2BHA A;  2EA2 A;  3BIQ A;  4U6W A;  4S2T P;  1R58 A;  1N51 A;  4ZWO A;  4U69 A;  3D27 A;  5CLS A;  3CTZ A;  1KQ9 A;  4ZNG A;  2P98 A;  5CIK A;  4A6W A;  5JFR A;  1XGN A;  1KQ0 A;  2GZ5 A;  1WLR A;  4B28 A;  3L7G A;  4IU6 A;  3TAV A;  5CDV A;  2GA2 A;  5E5B A;  2Q94 A;  3IG4 A;  5CDL A;  3PKC A;  3IU9 A;  4JUQ A;  5CNX A;  2GU7 A;  4PV4 A;  3RVA A;  4U76 A;  5CE6 A;  4HXX A;  4S2R P;  2GG5 A;  1Y1N A;  5CDE A;  1R5H A;  4FLK A;  5D6E A;  1XGM A;  4U75 A;  1C27 A;  1BOA A;  2BWV A;  2DFI A;  2GTX A;  4FLJ A;  4MAT A;  4FO8 A;  2BWW A;  1BN5 A;  1YW9 A;  4U6C A;  2Q8K A;  1W7V A;  5JI6 A;  1B59 A;  4IDY A;  4IKU A;  4A6V A;  3L24 A;  2B3L A;  2P9A A;  4FLI A;  1XGS A;  2GU5 A;  1JAW A;  4IKT A;  1WY2 A;  1WBQ A;  4U6Z A;  4RZY A;  3FMQ A;  4PNC A;  4ZWP A;  4FUK A;  3BIT A;  3TB5 A;  3IU7 A;  4IKS A;  2B3K A;  2ZSG A;  2BWX A;  2V3Z A;  4IKR A;  1WKM A;  1XGO A;  3S6B A;  4QR8 A;  1YVM A;  1YJ3 A;  2GGB A;  3CB5 A;  1WL6 A;  2EA4 A;  2GG7 A;  1WL9 A;  2GG3 A;  1B6A A;  4IEC A;  2GU6 A;  3FMR A;  2GGC A;  2NQ7 A;  3CB6 A;  1C24 A;  1A16 A;  2BH3 A;  2Q95 A;  4FKC A;  4KM3 A;  4U6J A;  2ADU A;  1C23 A;  4RGZ 1;  2BHC A;  4U6E A;  1QXW A;  1QZY A;  2BHB A;  3FM3 A;  3MAT A;  1PV9 A;  1C22 A;  2OKN A;  3ROR A;  2GG8 A;  2P99 A;  2OAZ A;  1YW8 A;  4U70 A;  1R5G A;  4S01 A;  4EGE A;  2EVM A;  4U71 A;  5FCH A;  1MAT A;  1KP0 A;  3PKB A;  2V3X A;  2B3H A;  3MX6 A;  2BWS A;  2NQ6 A;  3BIP A;  1C21 A;  4IF7 A;  4U73 A;  1CHM A;  1XNZ A;  2BN7 A;  2EVO A;  2V3Y A;  1M35 A;  2GG2 A;  2BWT A;  1QXZ A;  2G6P A;  4ZWU A;  2Q92 A;  4R60 A;  5FCF A;  4FLL A;  2BB7 A;  1YW7 A; 
#chains in the Genus database with same CATH homology
 2BWU A;  4RZZ A;  2BWY A;  2BHD A;  2MAT A;  5JHU A;  5D6F A;  3PKD A;  3MR1 A;  1O0X A;  2GG0 A;  2GU4 A;  3IU8 A;  4OOK A;  2EVC A;  2HOW A;  4FO7 A;  2V6C A;  1WN1 A;  4IPA A;  4Z7M A;  3PKE A;  3Q6D A;  2Q93 A;  2IW2 A;  4U1B A;  2Q96 A;  3PKA A;  4S00 A;  2GG9 A;  1W2M A;  1QXY A;  2BHA A;  2EA2 A;  3BIQ A;  4U6W A;  4S2T P;  1R58 A;  1N51 A;  4ZWO A;  4U69 A;  3D27 A;  5CLS A;  3CTZ A;  1KQ9 A;  4ZNG A;  2P98 A;  5CIK A;  4A6W A;  5JFR A;  1XGN A;  1KQ0 A;  2GZ5 A;  1WLR A;  4B28 A;  3L7G A;  4IU6 A;  3TAV A;  5CDV A;  2GA2 A;  5E5B A;  2Q94 A;  3IG4 A;  5CDL A;  3PKC A;  3IU9 A;  4JUQ A;  5CNX A;  2GU7 A;  4PV4 A;  3RVA A;  4U76 A;  5CE6 A;  4HXX A;  4S2R P;  2GG5 A;  1Y1N A;  5CDE A;  1R5H A;  4FLK A;  5D6E A;  1XGM A;  4U75 A;  1C27 A;  1BOA A;  2BWV A;  2DFI A;  2GTX A;  4FLJ A;  4MAT A;  4FO8 A;  2BWW A;  1BN5 A;  1YW9 A;  4U6C A;  2Q8K A;  1W7V A;  5JI6 A;  1B59 A;  4IDY A;  4IKU A;  4A6V A;  3L24 A;  2B3L A;  2P9A A;  4FLI A;  1XGS A;  2GU5 A;  1JAW A;  4IKT A;  1WY2 A;  1WBQ A;  4U6Z A;  4RZY A;  3FMQ A;  4PNC A;  4ZWP A;  4FUK A;  3BIT A;  3TB5 A;  3IU7 A;  4IKS A;  2B3K A;  2ZSG A;  2BWX A;  2V3Z A;  4IKR A;  1WKM A;  1XGO A;  3S6B A;  4QR8 A;  1YVM A;  1YJ3 A;  2GGB A;  3CB5 A;  1WL6 A;  2EA4 A;  2GG7 A;  1WL9 A;  2GG3 A;  1B6A A;  4IEC A;  2GU6 A;  3FMR A;  2GGC A;  2NQ7 A;  3CB6 A;  1C24 A;  1A16 A;  2BH3 A;  2Q95 A;  4FKC A;  4KM3 A;  4U6J A;  2ADU A;  1C23 A;  4RGZ 1;  2BHC A;  4U6E A;  1QXW A;  1QZY A;  2BHB A;  3FM3 A;  3MAT A;  1PV9 A;  1C22 A;  2OKN A;  3ROR A;  2GG8 A;  2P99 A;  2OAZ A;  1YW8 A;  4U70 A;  1R5G A;  4S01 A;  4EGE A;  2EVM A;  4U71 A;  5FCH A;  1MAT A;  1KP0 A;  3PKB A;  2V3X A;  2B3H A;  3MX6 A;  2BWS A;  2NQ6 A;  3BIP A;  1C21 A;  4IF7 A;  4U73 A;  1CHM A;  1XNZ A;  2BN7 A;  2EVO A;  2V3Y A;  1M35 A;  2GG2 A;  2BWT A;  1QXZ A;  2G6P A;  4ZWU A;  2Q92 A;  4R60 A;  5FCF A;  4FLL A;  2BB7 A;  1YW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...