3MR1A

Crystal structure of methionine aminopeptidase from rickettsia prowazekii
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
249
structure length
249
Chain Sequence
SMIKIHTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFITSHNAIPAPLNYKGFPKSICTSINHVVCHGIPNDKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKHNYSVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAGNYDTILSKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rickettsia prowazekii methionine aminopeptidase as a promising target for the development of antibacterial agents.
pubmed doi rcsb
source organism Rickettsia prowazekii
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 79
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3mr1A00
2GU5A 5JFRA 2BWWA 4IKUA 2HOWA 2BHDA 3PKEA 1CHMA 1KQ0A 4FLKA 4RZYA 2BWUA 1YW8A 2P99A 4FO8A 4OOKA 2B3HA 5D6FA 4B28A 5JHUA 1N51A 1XGNA 1QXZA 4IDYA 4ZWOA 2Q93A 2GZ5A 3MX6A 4U6CA 1YJ3A 3IU7A 4PNCA 3CTZA 1A16A 3FMQA 1B6AA 1B59A 2BWYA 4R60A 3Q6DA 4U69A 4IPAA 1XNZA 1WL9A 2NQ7A 1XGMA 3FM3A 3BIPA 4S00A 1WKMA 2GG9A 5FCFA 1QXWA 4ZWPA 2GGBA 4IKSA 2GG5A 4U70A 4QR8A 1WN1A 2EVMA 1WLRA 2Q96A 3CB6A 1R5GA 5CIKA 5CDVA 1R5HA 3S6BA 4S01A 1W2MA 3L24A 2P9AA 2GTXA 5CDEA 2DFIA 2B3KA 2V3XA 2BN7A 4U6WA 4KM3A 2BB7A 4U6EA 4FLJA 4A6VA 4HXXA 2OAZA 2V3ZA 2BWVA 4IKTA 2Q8KA 4Z7MA 1QZYA 1MATA 1Y1NA 2GG3A 1WL6A 2GG8A 2EA2A 2BHBA 5CNXA 2GU7A 4JUQA 2EVOA 4U1BA 2BWSA 3IU8A 3L7GA 3RVAA 1PV9A 4PV4A 3MATA 4U73A 3PKDA 4U75A 2G6PA 1KP0A 2BHAA 4S2RP 4U76A 4U71A 5CE6A 3TB5A 4ZNGA 2BWXA 5CDLA 4FLIA 1C21A 2BHCA 1BN5A 4MATA 4IU6A 1C24A 2P98A 2EA4A 1R58A 2Q95A 2V3YA 1XGSA 3PKCA 3PKBA 2GU6A 4RZZA 1WY2A 2IW2A 1KQ9A 1C23A 2ADUA 2BH3A 5E5BA 1YVMA 2GG7A 2V6CA 5FCHA 4IF7A 1WBQA 1JAWA 4FLLA 2GA2A 4IKRA 4S2TP 3TAVA 2GGCA 3BIQA 3D27A 4RGZ1 5D6EA 2B3LA 2MATA 3BITA 1C27A 2EVCA 2OKNA 4FO7A 3PKAA 5JI6A 3IG4A 1XGOA 3IU9A 2Q94A 2Q92A 2ZSGA 2BWTA 1W7VA 2GG2A 3CB5A 4ZWUA 1C22A 3FMRA 4IECA 2GG0A 1M35A 4FKCA 3MR1A 1O0XA 4FUKA 2GU4A 1QXYA 4A6WA 4EGEA 5CLSA 1BOAA 1YW9A 1YW7A 3RORA 4U6JA 4U6ZA 2NQ6A
chains in the Genus database with same CATH superfamily
2GU5A 5JFRA 2BWWA 4IKUA 2HOWA 2BHDA 3PKEA 1CHMA 1KQ0A 4FLKA 4RZYA 2BWUA 1YW8A 2P99A 4FO8A 4OOKA 2B3HA 5D6FA 4B28A 5JHUA 1N51A 1XGNA 1QXZA 4IDYA 4ZWOA 2Q93A 2GZ5A 3MX6A 4U6CA 1YJ3A 3IU7A 4PNCA 3CTZA 1A16A 3FMQA 1B6AA 1B59A 2BWYA 4R60A 3Q6DA 4U69A 4IPAA 1XNZA 1WL9A 2NQ7A 1XGMA 3FM3A 3BIPA 4S00A 1WKMA 2GG9A 5FCFA 1QXWA 4ZWPA 2GGBA 4IKSA 2GG5A 4U70A 4QR8A 1WN1A 2EVMA 1WLRA 2Q96A 3CB6A 1R5GA 5CIKA 5CDVA 1R5HA 3S6BA 4S01A 1W2MA 3L24A 2P9AA 2GTXA 5CDEA 2DFIA 2B3KA 2V3XA 2BN7A 4U6WA 4KM3A 2BB7A 4U6EA 4FLJA 4A6VA 4HXXA 2OAZA 2V3ZA 2BWVA 4IKTA 2Q8KA 4Z7MA 1QZYA 1MATA 1Y1NA 2GG3A 1WL6A 2GG8A 2EA2A 2BHBA 5CNXA 2GU7A 4JUQA 2EVOA 4U1BA 2BWSA 3IU8A 3L7GA 3RVAA 1PV9A 4PV4A 3MATA 4U73A 3PKDA 4U75A 2G6PA 1KP0A 2BHAA 4S2RP 4U76A 4U71A 5CE6A 3TB5A 4ZNGA 2BWXA 5CDLA 4FLIA 1C21A 2BHCA 1BN5A 4MATA 4IU6A 1C24A 2P98A 2EA4A 1R58A 2Q95A 2V3YA 1XGSA 3PKCA 3PKBA 2GU6A 4RZZA 1WY2A 2IW2A 1KQ9A 1C23A 2ADUA 2BH3A 5E5BA 1YVMA 2GG7A 2V6CA 5FCHA 4IF7A 1WBQA 1JAWA 4FLLA 2GA2A 4IKRA 4S2TP 3TAVA 2GGCA 3BIQA 3D27A 4RGZ1 5D6EA 2B3LA 2MATA 3BITA 1C27A 2EVCA 2OKNA 4FO7A 3PKAA 5JI6A 3IG4A 1XGOA 3IU9A 2Q94A 2Q92A 2ZSGA 2BWTA 1W7VA 2GG2A 3CB5A 4ZWUA 1C22A 3FMRA 4IECA 2GG0A 1M35A 4FKCA 3MR1A 1O0XA 4FUKA 2GU4A 1QXYA 4A6WA 4EGEA 5CLSA 1BOAA 1YW9A 1YW7A 3RORA 4U6JA 4U6ZA 2NQ6A
chains in the Genus database with same CATH topology
2GU5A 5JFRA 2BWWA 4IKUA 2HOWA 2BHDA 3PKEA 1CHMA 1KQ0A 4FLKA 4RZYA 2BWUA 1YW8A 2P99A 4FO8A 4OOKA 2B3HA 5D6FA 4B28A 5JHUA 1N51A 1XGNA 1QXZA 4IDYA 4ZWOA 2Q93A 2GZ5A 3MX6A 4U6CA 1YJ3A 3IU7A 4PNCA 3CTZA 1A16A 3FMQA 1B6AA 1B59A 2BWYA 4R60A 3Q6DA 4U69A 4IPAA 1XNZA 1WL9A 2NQ7A 1XGMA 3FM3A 3BIPA 4S00A 1WKMA 2GG9A 5FCFA 1QXWA 4ZWPA 2GGBA 4IKSA 2GG5A 4U70A 4QR8A 1WN1A 2EVMA 1WLRA 2Q96A 3CB6A 1R5GA 5CIKA 5CDVA 1R5HA 3S6BA 4S01A 1W2MA 3L24A 2P9AA 2GTXA 5CDEA 2DFIA 2B3KA 2V3XA 2BN7A 4U6WA 4KM3A 2BB7A 4U6EA 4FLJA 4A6VA 4HXXA 2OAZA 2V3ZA 2BWVA 4IKTA 2Q8KA 4Z7MA 1QZYA 1MATA 1Y1NA 2GG3A 1WL6A 2GG8A 2EA2A 2BHBA 5CNXA 2GU7A 4JUQA 2EVOA 4U1BA 2BWSA 3IU8A 3L7GA 3RVAA 1PV9A 4PV4A 3MATA 4U73A 3PKDA 4U75A 2G6PA 1KP0A 2BHAA 4S2RP 4U76A 4U71A 5CE6A 3TB5A 4ZNGA 2BWXA 5CDLA 4FLIA 1C21A 2BHCA 1BN5A 4MATA 4IU6A 1C24A 2P98A 2EA4A 1R58A 2Q95A 2V3YA 1XGSA 3PKCA 3PKBA 2GU6A 4RZZA 1WY2A 2IW2A 1KQ9A 1C23A 2ADUA 2BH3A 5E5BA 1YVMA 2GG7A 2V6CA 5FCHA 4IF7A 1WBQA 1JAWA 4FLLA 2GA2A 4IKRA 4S2TP 3TAVA 2GGCA 3BIQA 3D27A 4RGZ1 5D6EA 2B3LA 2MATA 3BITA 1C27A 2EVCA 2OKNA 4FO7A 3PKAA 5JI6A 3IG4A 1XGOA 3IU9A 2Q94A 2Q92A 2ZSGA 2BWTA 1W7VA 2GG2A 3CB5A 4ZWUA 1C22A 3FMRA 4IECA 2GG0A 1M35A 4FKCA 3MR1A 1O0XA 4FUKA 2GU4A 1QXYA 4A6WA 4EGEA 5CLSA 1BOAA 1YW9A 1YW7A 3RORA 4U6JA 4U6ZA 2NQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GU5 A;  5JFR A;  2BWW A;  4IKU A;  2HOW A;  2BHD A;  3PKE A;  1CHM A;  1KQ0 A;  4FLK A;  4RZY A;  2BWU A;  1YW8 A;  2P99 A;  4FO8 A;  4OOK A;  2B3H A;  5D6F A;  4B28 A;  5JHU A;  1N51 A;  1XGN A;  1QXZ A;  4IDY A;  4ZWO A;  2Q93 A;  2GZ5 A;  3MX6 A;  4U6C A;  1YJ3 A;  3IU7 A;  4PNC A;  3CTZ A;  1A16 A;  3FMQ A;  1B6A A;  1B59 A;  2BWY A;  4R60 A;  3Q6D A;  4U69 A;  4IPA A;  1XNZ A;  1WL9 A;  2NQ7 A;  1XGM A;  3FM3 A;  3BIP A;  4S00 A;  1WKM A;  2GG9 A;  5FCF A;  1QXW A;  4ZWP A;  2GGB A;  4IKS A;  2GG5 A;  4U70 A;  4QR8 A;  1WN1 A;  2EVM A;  1WLR A;  2Q96 A;  3CB6 A;  1R5G A;  5CIK A;  5CDV A;  1R5H A;  3S6B A;  4S01 A;  1W2M A;  3L24 A;  2P9A A;  2GTX A;  5CDE A;  2DFI A;  2B3K A;  2V3X A;  2BN7 A;  4U6W A;  4KM3 A;  2BB7 A;  4U6E A;  4FLJ A;  4A6V A;  4HXX A;  2OAZ A;  2V3Z A;  2BWV A;  4IKT A;  2Q8K A;  4Z7M A;  1QZY A;  1MAT A;  1Y1N A;  2GG3 A;  1WL6 A;  2GG8 A;  2EA2 A;  2BHB A;  5CNX A;  2GU7 A;  4JUQ A;  2EVO A;  4U1B A;  2BWS A;  3IU8 A;  3L7G A;  3RVA A;  1PV9 A;  4PV4 A;  3MAT A;  4U73 A;  3PKD A;  4U75 A;  2G6P A;  1KP0 A;  2BHA A;  4S2R P;  4U76 A;  4U71 A;  5CE6 A;  3TB5 A;  4ZNG A;  2BWX A;  5CDL A;  4FLI A;  1C21 A;  2BHC A;  1BN5 A;  4MAT A;  4IU6 A;  1C24 A;  2P98 A;  2EA4 A;  1R58 A;  2Q95 A;  2V3Y A;  1XGS A;  3PKC A;  3PKB A;  2GU6 A;  4RZZ A;  1WY2 A;  2IW2 A;  1KQ9 A;  1C23 A;  2ADU A;  2BH3 A;  5E5B A;  1YVM A;  2GG7 A;  2V6C A;  5FCH A;  4IF7 A;  1WBQ A;  1JAW A;  4FLL A;  2GA2 A;  4IKR A;  4S2T P;  3TAV A;  2GGC A;  3BIQ A;  3D27 A;  4RGZ 1;  5D6E A;  2B3L A;  2MAT A;  3BIT A;  1C27 A;  2EVC A;  2OKN A;  4FO7 A;  3PKA A;  5JI6 A;  3IG4 A;  1XGO A;  3IU9 A;  2Q94 A;  2Q92 A;  2ZSG A;  2BWT A;  1W7V A;  2GG2 A;  3CB5 A;  4ZWU A;  1C22 A;  3FMR A;  4IEC A;  2GG0 A;  1M35 A;  4FKC A;  3MR1 A;  1O0X A;  4FUK A;  2GU4 A;  1QXY A;  4A6W A;  4EGE A;  5CLS A;  1BOA A;  1YW9 A;  1YW7 A;  3ROR A;  4U6J A;  4U6Z A;  2NQ6 A; 
#chains in the Genus database with same CATH topology
 2GU5 A;  5JFR A;  2BWW A;  4IKU A;  2HOW A;  2BHD A;  3PKE A;  1CHM A;  1KQ0 A;  4FLK A;  4RZY A;  2BWU A;  1YW8 A;  2P99 A;  4FO8 A;  4OOK A;  2B3H A;  5D6F A;  4B28 A;  5JHU A;  1N51 A;  1XGN A;  1QXZ A;  4IDY A;  4ZWO A;  2Q93 A;  2GZ5 A;  3MX6 A;  4U6C A;  1YJ3 A;  3IU7 A;  4PNC A;  3CTZ A;  1A16 A;  3FMQ A;  1B6A A;  1B59 A;  2BWY A;  4R60 A;  3Q6D A;  4U69 A;  4IPA A;  1XNZ A;  1WL9 A;  2NQ7 A;  1XGM A;  3FM3 A;  3BIP A;  4S00 A;  1WKM A;  2GG9 A;  5FCF A;  1QXW A;  4ZWP A;  2GGB A;  4IKS A;  2GG5 A;  4U70 A;  4QR8 A;  1WN1 A;  2EVM A;  1WLR A;  2Q96 A;  3CB6 A;  1R5G A;  5CIK A;  5CDV A;  1R5H A;  3S6B A;  4S01 A;  1W2M A;  3L24 A;  2P9A A;  2GTX A;  5CDE A;  2DFI A;  2B3K A;  2V3X A;  2BN7 A;  4U6W A;  4KM3 A;  2BB7 A;  4U6E A;  4FLJ A;  4A6V A;  4HXX A;  2OAZ A;  2V3Z A;  2BWV A;  4IKT A;  2Q8K A;  4Z7M A;  1QZY A;  1MAT A;  1Y1N A;  2GG3 A;  1WL6 A;  2GG8 A;  2EA2 A;  2BHB A;  5CNX A;  2GU7 A;  4JUQ A;  2EVO A;  4U1B A;  2BWS A;  3IU8 A;  3L7G A;  3RVA A;  1PV9 A;  4PV4 A;  3MAT A;  4U73 A;  3PKD A;  4U75 A;  2G6P A;  1KP0 A;  2BHA A;  4S2R P;  4U76 A;  4U71 A;  5CE6 A;  3TB5 A;  4ZNG A;  2BWX A;  5CDL A;  4FLI A;  1C21 A;  2BHC A;  1BN5 A;  4MAT A;  4IU6 A;  1C24 A;  2P98 A;  2EA4 A;  1R58 A;  2Q95 A;  2V3Y A;  1XGS A;  3PKC A;  3PKB A;  2GU6 A;  4RZZ A;  1WY2 A;  2IW2 A;  1KQ9 A;  1C23 A;  2ADU A;  2BH3 A;  5E5B A;  1YVM A;  2GG7 A;  2V6C A;  5FCH A;  4IF7 A;  1WBQ A;  1JAW A;  4FLL A;  2GA2 A;  4IKR A;  4S2T P;  3TAV A;  2GGC A;  3BIQ A;  3D27 A;  4RGZ 1;  5D6E A;  2B3L A;  2MAT A;  3BIT A;  1C27 A;  2EVC A;  2OKN A;  4FO7 A;  3PKA A;  5JI6 A;  3IG4 A;  1XGO A;  3IU9 A;  2Q94 A;  2Q92 A;  2ZSG A;  2BWT A;  1W7V A;  2GG2 A;  3CB5 A;  4ZWU A;  1C22 A;  3FMR A;  4IEC A;  2GG0 A;  1M35 A;  4FKC A;  3MR1 A;  1O0X A;  4FUK A;  2GU4 A;  1QXY A;  4A6W A;  4EGE A;  5CLS A;  1BOA A;  1YW9 A;  1YW7 A;  3ROR A;  4U6J A;  4U6Z A;  2NQ6 A; 
#chains in the Genus database with same CATH homology
 2GU5 A;  5JFR A;  2BWW A;  4IKU A;  2HOW A;  2BHD A;  3PKE A;  1CHM A;  1KQ0 A;  4FLK A;  4RZY A;  2BWU A;  1YW8 A;  2P99 A;  4FO8 A;  4OOK A;  2B3H A;  5D6F A;  4B28 A;  5JHU A;  1N51 A;  1XGN A;  1QXZ A;  4IDY A;  4ZWO A;  2Q93 A;  2GZ5 A;  3MX6 A;  4U6C A;  1YJ3 A;  3IU7 A;  4PNC A;  3CTZ A;  1A16 A;  3FMQ A;  1B6A A;  1B59 A;  2BWY A;  4R60 A;  3Q6D A;  4U69 A;  4IPA A;  1XNZ A;  1WL9 A;  2NQ7 A;  1XGM A;  3FM3 A;  3BIP A;  4S00 A;  1WKM A;  2GG9 A;  5FCF A;  1QXW A;  4ZWP A;  2GGB A;  4IKS A;  2GG5 A;  4U70 A;  4QR8 A;  1WN1 A;  2EVM A;  1WLR A;  2Q96 A;  3CB6 A;  1R5G A;  5CIK A;  5CDV A;  1R5H A;  3S6B A;  4S01 A;  1W2M A;  3L24 A;  2P9A A;  2GTX A;  5CDE A;  2DFI A;  2B3K A;  2V3X A;  2BN7 A;  4U6W A;  4KM3 A;  2BB7 A;  4U6E A;  4FLJ A;  4A6V A;  4HXX A;  2OAZ A;  2V3Z A;  2BWV A;  4IKT A;  2Q8K A;  4Z7M A;  1QZY A;  1MAT A;  1Y1N A;  2GG3 A;  1WL6 A;  2GG8 A;  2EA2 A;  2BHB A;  5CNX A;  2GU7 A;  4JUQ A;  2EVO A;  4U1B A;  2BWS A;  3IU8 A;  3L7G A;  3RVA A;  1PV9 A;  4PV4 A;  3MAT A;  4U73 A;  3PKD A;  4U75 A;  2G6P A;  1KP0 A;  2BHA A;  4S2R P;  4U76 A;  4U71 A;  5CE6 A;  3TB5 A;  4ZNG A;  2BWX A;  5CDL A;  4FLI A;  1C21 A;  2BHC A;  1BN5 A;  4MAT A;  4IU6 A;  1C24 A;  2P98 A;  2EA4 A;  1R58 A;  2Q95 A;  2V3Y A;  1XGS A;  3PKC A;  3PKB A;  2GU6 A;  4RZZ A;  1WY2 A;  2IW2 A;  1KQ9 A;  1C23 A;  2ADU A;  2BH3 A;  5E5B A;  1YVM A;  2GG7 A;  2V6C A;  5FCH A;  4IF7 A;  1WBQ A;  1JAW A;  4FLL A;  2GA2 A;  4IKR A;  4S2T P;  3TAV A;  2GGC A;  3BIQ A;  3D27 A;  4RGZ 1;  5D6E A;  2B3L A;  2MAT A;  3BIT A;  1C27 A;  2EVC A;  2OKN A;  4FO7 A;  3PKA A;  5JI6 A;  3IG4 A;  1XGO A;  3IU9 A;  2Q94 A;  2Q92 A;  2ZSG A;  2BWT A;  1W7V A;  2GG2 A;  3CB5 A;  4ZWU A;  1C22 A;  3FMR A;  4IEC A;  2GG0 A;  1M35 A;  4FKC A;  3MR1 A;  1O0X A;  4FUK A;  2GU4 A;  1QXY A;  4A6W A;  4EGE A;  5CLS A;  1BOA A;  1YW9 A;  1YW7 A;  3ROR A;  4U6J A;  4U6Z A;  2NQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...