3MRCA

Crystal structure of mhc class i hla-a2 molecule complexed with hcmv pp65-495-503 nonapeptide v6c variant
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Analysis of Relationships between Peptide/MHC Structural Features and Naive T Cell Frequency in Humans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 84
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mrcA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mrcA01
4LPXA 2VDLL 5GGRY 1FE8H 4UAOB 3R06B 1HNGA 1GGIL 4HJGA 4QHKJ 2H26A 2EDXA 5GS2D 2Y25A 1FH5L 2BMKB 3V5DA 5ELIA 4N0FA 2X4TA 4X6EB 1WAAF 4I48B 3UXFA 4X4YB 4UUJA 2F53E 5CP7B 1NCWH 3BWAA 2Y4SA 4P5TA 4Y5XB 1E6OL 3SE9L 4DUWA 4JKWA 4P2RB 1RZGB 1HXYA 2P5WE 1AQKL 4XXDB 2MCG1 1JWUB 5CJ8A 5KN5A 2ICCA 5J89A 3LEYL 2XQBL 3OL2A 4F8QA 4ZPVB 4NJAH 4DUVA 3GMMB 4H0HB 1VERA 1VADB 2Q7NA 4EI5C 1F00I 4GW4B 1YEFL 4JKLA 3ULUL 3VFVB 3HRZB 1U8LA 2OTUA 4UT9L 3H42L 1S8DB 1U3JA 3Q6FB 4XNZB 4UINL 1KELH 5IG7B 4ELKA 5IIEB 3MGOA 1INDL 1Y6MR 3O6FC 1Y18A 2DIJA 5DJXB 4GKNB 3DTXA 2ERJC 4UT7L 4UZGA 2NY2D 3NIDF 4GMSL 4A2LA 2JE8A 4TUOB 4QT5A 3PL6D 1OCWL 1R3HA 2KH2B 2QSCH 3FRUB 3IAQA 4V2CB 1KJ2B 5SWZD 4XNYH 2AS5M 4H0GA 1KB5H 3KS0H 4G5ZH 2APWA 5EA0L 1PY9A 1JPGB 3GSVA 1T03L 1F11A 3VD5A 3EO0B 5SWSD 2EDLA 1QYGH 5CIPA 4M5YH 4OIAA 1VENA 2XTJC 2VL5A 5DXWA 4YNYB 5I1AA 5HYJA 1Y0LA 3T77A 3VI4E 3DUHA 2QHRL 1BECA 3T1WA 5TE6L 1AC6A 4ODWA 4UT6H 2FSEB 1U8JA 3BN9C 1WEJH 1DBBL 1QRND 2CJUL 2H3NB 3O6FD 4NT6B 3TM6A 2NY1B 15C8H 2BVTA 3BFOA 3CH8A 1I1CA 3ILQD 2VDKH 4OSUH 1FL6A 4J3VA 1MJJA 5J9PB 3S3JA 3EAKA 5IP4A 4I18C 1ES0A 2VXVH 4R2GC 2I9LA 2OX5A 3QJHA 5I16B 4HUXA 4PJAE 4JFEB 4MLSA 4DUXA 3QPQD 1KFAL 2VDOH 3QXTA 1MPAH 2XTJD 5FGCB 1QKZL 5CINL 4BSVB 1IAOA 1BGXH 2EDQA 3HNSL 5ALCH 2BJML 2Q76B 2NW2A 4TPRL 4H5SB 3NCMA 4GAGH 4RFNC 5FK9B 4XP4H 2EXYC 3U46A 4HBQA 4ODVH 3VXSA 1EJ6A 1BVLA 1JGDA 4XCYA 3OMZA 3VFGL 2H1PL 4RA0C 3DX7B 1WCBA 1VA9A 4QNPE 1MI5A 3QRFM 4XVJH 5CEXB 2BC4A 3MRKB 1I8MA 5JW5B 1EAPB 4XI5D 2B0SH 4PRNB 5DD5L 4MLIA 5EO1B 1NGXA 2XZZA 2AXJA 4R2GD 4KKCC 3HZYB 3DI2B 5FKPB 4MJIA 3BQUA 3MV9D 2VDQL 2A1WH 4Y1AE 1I9JH 3O3EB 1G7QA 4XXCA 2Q20A 3HUJA 2OCFD 7FABH 5IGXH 4RGOL 4AEHH 4DQOL 1JGUH 3ALXA 3H3KA 2AI0H 5CEZE 1CWVA 1RJYA 2CR6A 1N6QL 4WHCA 3GSQA 1JL8A 1MIML 1QD0A 2GI7A 4ERSH 2ZKHL 4XCCL 1H15B 5IBLD 3LMJH 1S7VB 3GFUA 1AXSB 3HI5L 1FV1A 3EOYG 1KB9J 1L8JA 3GMOB 5GGQH 3MACH 1DVFC 3QDGB 3S36X 3I75B 5DEZA 4APQA 4UIMA 1YNTB 5JDJA 3K8LA 4HF5H 5C6TH 5C0BA 3DROA 4GMTL 1VFMA 1TNMA 4OKDA 4QOKB 2G5BA 2YC1B 2HLAA 5DD3H 5ACLA 4FQCH 4KKCD 1CF8H 3B3IB 4G9FA 2XFXB 3JV4B 2Y36L 1QSFE 3UROR 4WFEE 1NLBL 3P4NB 1ZGLA 4Y4FB 3RL2B 3P30L 1AXTH 4YZFE 5CJOH 2MFNA 4L9DA 3FT4A 4ELMB 2DRUA 5B3JF 4Z7UA 1MFCH 2WWKT 5EOQL 5KS9A 1ZHLB 3QUYA 3ARUA 2J7LA 4TNVF 2ZUTA 1FQ9C 2QADC 5DHXB 4C56B 3UJTH 4ZXBD 4HKBA 1MLBB 1CLCA 1X5FA 3VGEA 1P4IH 2ED7A 5C0IB 4X6DF 3IFOB 1CR9L 5BQ7B 5ISZE 4OCMC 2VLKE 5FHBL 1A7NH 4U0RB 2IBZY 3HMXL 5D7IE 2UZIL 5IM7B 2Q86A 3DOSA 4QXUL 4F7CA 2GY7B 1UXWB 5EC2B 1U6AH 3V0VA 4WHTA 5DRZB 3IF1B 1FBIL 4XPTL 3G5XB 2DLFL 2QQNL 3BPLB 3FO1B 3PGFL 4PRIE 3LEVL 1T2XA 1CGYA 3CNKA 2QQLH 2D31B 5A2LH 2COQA 4D0CA 2E9WA 1T2QL 2OJZH 1AGCB 1ZSDB 1DUZB 5LGJB 2IANB 3ZSSA 4PRAB 2QADD 3VGAC 3D48R 3R0MA 2B4CL 1ZANL 2VLRD 1H9VA 4NQSA 1W72L 5T3ZD 5IHUH 3HNVL 1I1AA 4YXLL 2GCYB 1CFTA 1TCRA 5KAQF 4OZGE 4Z8FL 3MV8B 1EMTH 5IB2B 1R0AL 3QZWG 1DQLL 3ARZA 5C09B 3V0WH 1YEDB 3BPCB 3D0LB 1ZA6A 3PABB 3ROOB 1DEEB 4FZ8H 1GC1L 3M17A 4ZFZA 4KJYB 5ANMB 3U4EB 4Y5XC 4PR5A 4CU7A 5D1QB 4MXQD 4GSDH 2FHFA 5I15H 4JFXA 1CXFA 4M62H 1DQDH 4LK4A 4PJ5D 3V6FB 4JM2A 4PRBA 4QGYA 3NFPB 3FQXB 1DANU 3QIWB 4BZ1H 2P8MB 1FFPB 1RZJL 2D9QB 4YDVA 1ZLVH 1FFNA 4OI8A 3ET9F 5FO9A 1MEXL 5DMIL 5E2UL 3JVGA 1IGJA 1NFDF 4PV8A 3BSZH 1F58H 1KLGB 4WWKC 1LO3H 1YQVH 4AQOA 4OFYD 1UACL 3FZUC 3ZKSD 4P2YA 1TJHL 4GRLB 3P4OB 5HHMB 1S7QB 4I0KA 3A6BL 2R0ZL 1Y6NR 5FDYA 4PJCA 3CJJA 3FRPG 3K4AA 1HINH 2XPGA 4NQVA 1PD6A 5AD0B 1MHEB 5DUPL 3DETD 4TTGA 1AC0A 3Q6GL 4XP5H 2RGSA 4M7LT 1B4RA 2Q8BL 5JLZA 1ED3A 4MX7A 3GBMH 2V2TA 3QT2A 3DVFA 3ULSB 1U8KA 3MLVH 5C07E 1Q72L 4X9BA 1ZLUH 4ODUB 3MRPB 1MFEL 4M93C 2GJ6A 4JG0H 1TZGL 4Z77B 1CDGA 4Z7WF 2CIKB 1JV5A 1HIMH 1CN4A 3SQOL 3UAJC 3MLUH 2BVPB 3TBVB 2FIRT 3CSYB 5I30L 2PN5A 4LEOA 2QKIB 4MA8H 3UCRA 4O4YH 4NGHL 3C60B 3C6SA 5HYSA 2WBJA 1PKQB 5CGYD 1EO5A 3S4SG 3PJSA 1JPTH 5FUCC 4YHMH 1UM6H 1H3XA 1B90A 2X2YA 3HAEG 5C3LD 3U83A 1LEIB 2Z31B 4L9LC 4RSVA 2VIRA 2W9EL 3KXFB 2GUOA 5KVDL 5FFLA 1U58B 1TVBB 1N6UA 4PG9A 4GAYA 5J13B 2WWMD 5LQBH 2CXGA 5DD0L 5BRZB 1PYWA 2XWBB 1ORSB 3OG4B 1R3IL 3DGGA 3V79C 4QXGH 4M03A 2E9IA 2IFFL 4TNWK 5ESAB 4C58B 1I9EA 1IGML 1G7HB 5FUOL 3CXHJ 1M7DB 4R3SB 2R4RL 5JIPA 5IV2B 1ZVYA 4J1UB 4P49A 4EN3C 4ONFL 4OD2B 1FGVL 2ICWI 1LNUB 5BXFB 3UPRB 4N0YH 3R8QA 2ESVA 2M8XA 1XF3B 1KCVH 5DHVB 5JORA 1JZ5A 4MYWB 4P4RA 4PFEA 4Q6IB 3MA7A 3W82A 4KUZL 2CK2A 4P4KC 4MZ2A 4K71B 2E7LE 4O51A 3CGTA 3U9UB 4ZODA 1FYTE 2P8LA 1XEDA 1I1FA 3W0WB 4G7YL 1K3IA 2FBOJ 1W0YT 3TO4C 1U8MA 4LVOC 2OZ4A 5I19H 3V6OC 5BVJB 5EPMA 3UYRH 4BZYA 3TT1L 3MJ9H 1IAKB 3MA9L 2W92A 1MFDL 3IU4H 4I1NB 4AT6B 1X7QB 4KK5C 2ITDA 3FOLB 4LRIC 4RAHA 3KS0J 5HJ3B 4OZFA 4PY8J 3FB6B 1X4YA 3VFNA 4QTHB 4YHLH 5F9OH 2JCCE 3KPQB 4S2SA 1XGTA 2FGWL 1LO0L 5IMOA 25C8L 1T1ZB 4OT1H 3EYSH 3FTGA 4CBPA 4ZPTB 5I17A 3D18B 4P3DA 3JV6B 4Z7OF 4QRSA 5D93C 1TTUA 3V4UH 4GG6B 1A7PL 4EDWL 3HG1E 4JREB 5HPOA 4K94H 4HKZB 4PJIE 5AG9A 4M6NL 5JDSB 1P2CB 4HIEB 4PJGB 4QHNA 5BV7L 2F74A 3E8UH 1DBJH 2XG5A 1BEYL 1N6VA 3IXTA 1HDMA 2BVOA 2E9JA 3QDGD 3BZ4B 4LLDA 5IK3B 1MNUL 1G6RL 5E8OA 4X5WB 4KK5D 1BFSA 1NEZA 3RZCC 4QOKD 2YD9A 3GO1H 3G5YB 1WZ1H 2R8SH 5HVWA 4U0RC 3LKSB 3RIAK 1XH3B 4POZD 1LK3H 1MRFH 1FLRH 5DGRA 3U1SL 3BWUC 4K9EL 1NEUA 3SKNA 2CD0A 3MRJB 1NQBA 4Y4HC 1MREH 3FB5A 3DRQB 1SBBA 2BK8A 4RISL 1A6ZA 1DBAH 3OKNB 4D9LH 3STZA 1ZT1B 2C3HA 3PP4H 1I9IH 5DR5H 5EORH 5FV1L 1BJMA 1SM3H 2F19H 4FFVC 2VR5A 1F4WL 1OAKH 2F9BT 5AEAA 4QRRE 4ZUUB 4C56D 4HDIA 3IDIA 5IW1A 1AGEA 2X4SB 3CFBA 1T4KA 1ACYH 1WAAA 4J3TA 3LHPH 4HWEH 5FGRA 2V9TA 4K7PH 4JVUA 1YMHB 4HUVB 1IBGL 5SX5K 2JB5H 3I6GB 4QHMA 2FJGB 2K1MA 4KMTL 5J6GB 3DSFH 3N9GL 4HG4K 5IMMB 3OKOB 3EJYD 2AXGB 5D1QC 4PLNC 1CYGA 1KACB 3ARBB 3INUH 2UUDH 4ACPA 1RMFL 1ZVSB 5J1SC 4M9OA 3WIFB 4WY7L 2AGJL 1JZ3A 3KYNB 1MAMH 2YPKA 4L3EE 2CDEA 4KZEH 1KCGC 1YC8A 4RMSA 4FFVD 2IAND 4Z0XA 1QFHA 4I2XE 3RBGA 3V0AC 2HRPL 4DKFL 1RJLB 1JNJA 4LEXL 5T3XE 3S5LG 2EH7H 1WFOA 3TYGH 3SCMB 1I3VA 5B38G 4DVBA 4OI9A 2H9GA 2WW8A 3MV8D 5D2LE 3WXWH 5C09D 3QXUA 5GGTH 3WLBB 5J06A 2W65A 1IC7H 3DVNB 4HIJB 2EO1A 3MRRB 5CJXC 5JW3H 1KCUL 4P2QA 4WV1B 5D1QD 5E99L 2G5RA 1JNLH 2VH5H 3HC0B 5E94A 4DOHB 4RAUB 3CC5A 2DB8A 2O5ZH 4C83A 3H2WA 1HZHH 3P0YH 3O2VH 1FNEB 3U0PB 4H8WH 3QIWD 1OARL 4BFIA 4X83A 2DYPA 3GGWA 1R24B 5ETUB 4NPYB 5HVHC 1CFSA 5J0BA 3K46A 4N9GA 5DEGB 3SDDC 4AL8L 1D5MA 4IOFC 4Y19D 3QEQA 5ERWB 2VRAA 2XZQL 1BLNB 3MRBA 5BCAA 2VDLH 1P4LA 1JMXA 3VRJB 5FOBA 4GRLD 1P7HL 1GGIH 5HHMD 1FH5H 3RVXD 5BOPA 4LGPB 3GKWL 2CO6B 3KPPB 3QI9B 4JQXA 4DGVH 5I73C 1UCBL 3B9EA 4HH9A 2JK5A 1OHQA 4FXKA 2ARJB 2A77H 1MH5A 1FCGA 3RFZC 3VGGA 5J11B 1A2YA 5CEZL 3GHBH 3HLAB 1OAXL 1KB5B 4F15B 5I0ZA 4N0UB 1D5XB 3RVWC 5EB9A 2AEQL 1OAQL 4CVWA 3LEYH 3MLSH 2XQBH 4QRPB 1KGCD 5IEKA 4ONHB 4OF0A 5GIRB 4IOFD 1Q9KA 1GAFH 1MQKH 3VXUE 1J12A 1YEFH 3ULUH 1QACA 1M1SA 1PJ9A 1FGNL 5EU7C 3KG5A 4UT9H 3GM0A 3H42H 5E2TH 3U82B 5GRJL 4UINH 2OJEB 1I3RB 5I0DA 3QNYA 1INQB 5E4IA 1INDH 4XH2A 3C60D 3C2AL 2OSLA 2EIBA 2V2XB 4RGMC 4DCQB 5EOCL 4UT7H 3PL6A 5GGVY 1FG2A 3TFKC 2BCKB 5SWZA 3O6LL 4AJ0A 3NA9L 5D1XB 2Z31D 1MUJB 1TJIL 2R23B 5HI3C 3PWNA 2HT4C 1AGDA 3KXFD 4Q6IC 2FL5A 5HD8C 4WVRA 3N1GC 1E4JA 2A9ML 3I84A 5EA0H 3ECBB 1JTOA 1T03H 4JY5L 5BRZD 4LLWA 3S6CA 4K8RL 4KXZH 7CGTA 2ATKA 5A43C 4EI5A 2VABB 1I1RA 1OM3H 2QHRH 2XZCL 3P11L 1IGYB 3QP3A 2A38A 1QRNA 4PJ7E 3RWIB 3O6FA 4MD5B 4LCWA 2CJUH 1OW0C 1PGRB 1RIVL 1KPUA 4A2MA 5T1MB 4R97B 4D0DA 4TUKL 5CD5C 2DIBA 3REWB 1D5IH 3FT3A 1MVFA 2FEEI 4RIRA 3QG6A 3UTQB 1HXMB 5HD8D 3ARQA 4OGAD 4PYHA 4LSQL 3PV6A 1NGZA 4MSWB 3IRZA 4GW1B 1I3UA 3E6FA 1KFAH 3D25A 3W0WD 5FYJE 2H2PD 1QKZH 5CINH 3KPLB 1G7MB 3HNSH 2BJMH 4TPRH 1WZLA 5DZLA 3EGSA 4TSAH 3NGBC 4FABL 2PTVA 3MV01 4KJQC 4M9PA 4GJTB 3HE6B 3MCKA 2H1PH 4F33B 5IMLB 5CD5D 3MRLA 5K9QG 2R2HA 4U1GC 5IR1A 4U1SA 5FAAA 2GTZB 4ZD3L 5MEOA 4ZS6C 3THML 5DD5H 5JO5A 4RDQG 3MV9A 1A7RL 2ZUWA 1YN7A 3PWVA 2VDQH 3RUGE 5EU5B 1NMAL 1JRHI 3TCLB 4RGOH 3GMQB 1J7VR 2EEDA 1A3RL 1N6QH 2DL2A 5C6WH 4NBZB 4YQXH 1BMGA 1RULL 1F3DJ 2ZKHH 4XCCH 3K80A 4BFGA 1BX2B 3HI5H 4JGJA 4W70A 2BZDA 4RA3A 1JPSL 1XZ0B 3DRTB 4GMTH 4GH7B 3DV4B 3TIEB 3LV3B 3G5ZB 1VFAA 1UADC 2UY6A 3ARXA 5BZWA 3JWDH 3ZE2E 3QWOA 3SE4A 2X4OB 1VFOA 2DDQL 2Y36H 1S9VA 3MYJA 4YC2B 3OAZK 3S8WA 2AJSL 2FIKB 3L6FB 4OQTA 4AIXA 3MUHL 5H8DA 4E41B 4NCC2 4MB4A 3BEWA 6FABL 5F71A 5C0CB 1MJUL 3BXNA 5EOQH 4ZXBA 3TO2A 4HX1B 4TRPL 1TDQA 3SCMC 1DVFA 5A16B 2R2BA 3WHXB 3MOQA 1CL7I 3FQUA 5I1LA 1ZWIB 1F4XL 4WJ5A 3MRNA 2DMKA 3ROLB 4PRDA 4Y5VB 2I26N 1YJDL 2HVJB 4OZFG 1W2KT 2NR6C 2P4AB 1CR9H 4QXTB 1BQHA 3HMXH 2UZIH 5CZXD 4DK3A 1T0MB 4M7ZB 3RX5A 4LHUG 4KJPD 4QEGA 4HIXL 3WJJC 2PW1B 5IVXB 3CH1A 3ARBD 4GBXB 2F5BL 1FBIH 1FFQA 4W68A 4XPTH 5F9WC 2DLFH 2QQNH 3BVNB 2CUHA 1OGAB 2J8OA 2AKRB 4UOW1 4GG6F 3LEVH 3MJ8B 2BSSA 3IVKB 5E5MB 2QR0A 1KJVB 1INEL 5DJ2B 2CIIB 5KVEL 3REVB 1RK0B 2V5YA 3JWOC 3RVTD 4PJGF 1T2QH 4Z7WA 4I0CC 2VLRA 3SCMD 4ODSH 1HCFX 2QSQA 2B4CH 1ZANH 1K9TA 1FZJB 1W72H 2EE9A 3VW3L 1KIRA 4L4TB 4YXLH 1RZKC 2A6IA 3WKMH 4NHCH 4S0SD 2NR6D 4X7TA 5F89A 4Z8FH 4OAWA 1R0AH 1VKXB 2H45A 3LEXB 4I3RL 1T20B 3L5JA 1OPGH 1PSKL 2ICWJ 1GC1H 3B2UD 1F2QA 3O2DH 2CGRL 4JB9L 1JGEB 3EYVA 1MHHB 3P0GB 4MXQA 4HFWB 4HMDA 5C0AE 3CFKA 5E8NB 4F7EA 1IL1B 4PJ5A 4W6YB 2Y06L 5ESVB 4PJEE 5IT2L 3CVHL 4ZQKA 1N7ML 2BY1A 2WIIA 3NMEA 2CLZA 2KKQA 3IB4A 4NN5C 3GMPA 1RZJH 1E6JL 1L0XA 1MEXH 1HILA 5DMIH 2DQGH 2YOCA 5C0DA 1ZHBB 1T0NA 3E1F1 3IETB 4JFDE 4OFYA 2E8YA 3R06A 5EH1A 2DM7A 4L8BB 5C0GB 2BMKA 1RZ8B 1IC1A 4X6EA 2CPCA 4I48A 5GS0L 4X7CC 1A21A 4X4YA 1TJHH 3AU1B 3QI9D 1D6EA 1I75A 35C8L 5CP7A 4ZOAA 2WY3A 3U30B 1KIQB 4Y5XA 3H9SB 1RZGA 3MFGB 2R0ZH 1Z9LA 4W4OA 1T6WA 3P0VL 4XXDA 4X99B 4H1LG 5I1DB 1SEBB 3QIUB 1JWUA 5DUPH 1S7WB 2CMRL 3Q6GH 4NOBA 3AB0C 4M8VA 4NN6C 4U31A 2Q8BH 4ZPVA 3RDTC 1MWAL 2A0LD 4QRPD 1AO7D 4YLQT 3GMMA 1U3HC 2I5YL 3KYMA 1VADA 3OJVC 1OD7A 3O8XB 1JNHB 1Q72H 4GW4A 3C6LC 1BVZA 3VFVA 1VHPA 3DYOA 1MFEH 3G08B 1NCCL 2ZOLB 1S8DA 3Q6FA 5FYKD 1YDPA 1TZGH 5L0QC 5E24E 1BF8A 2DQHL 3HAEH 1B6UA 1NDGB 3SQOH 5DJXA 5EU6A 4GKNA 5B8CB 1J9CT 5DUBA 1X4ZA 4R97C 3QCVL 3T0AA 4TUOA 3HI6L 2A83B 4XPHL 4NGHH 3FRUA 1RFDL 3AS2A 1KJ2A 4MWFB 4R8WL 4EIGB 1OT2A 1X5HA 4NSKA 1U8QB 3GMRB 1OL0A 3P73B 2YPLE 3O0RL 2LV4A 4R4FL 5B39G 1XIWC 3EO0A 4RGNC 2W9EH 1FDLL 5KVDH 5D70L 1DQQB 3UJJL 2GQHA 4YNYA 1CFVL 4WEMB 3QXDB 4O02L 3TYFB 3T0XA 5JHDE 2MKLC 2J4WL 4QRQA 2HJFB 2P47B 4ZUSB 5HGAB 5J4MA 5ENWB 1R3IH 3QJFB 5KJRL 4LDEB 1MRDH 3EYUL 4NM4H 2ZJSL 2FNBA 2FSEA 2H3NA 4NT6A 2OXGA 4XNQB 2VTFA 2R4RH 2E6QA 2RQ8A 3RJQB 2NTSP 4ETYA 5LCVL 4FQ1L 1F4HA 5J9PA 3BUTA 3EUUA 3HE6C 1RJCA 3VG9C 4Q9RL 4JRYB 2O26U 4CADB 2MPAL 4LBEB 3DX9B 1OB1B 1BBDL 1FGVH 4PJFE 4OF3A 5F3BB 3SDYH 1AD0B 2D0HA 1MFNA 5BW7C 1JZ8A 1O0VA 4L9LA 1UZ6E 5I16A 4D9QE 1KSRA 3SGJC 1FORL 3D3VB 4GAJL 5TE4H 4KUZH 5T3XL 4BSVA 4B7LA 5I71B 1LE5A 1NCBL 4HWBL 4YBLC 2Q76A 1WSST 3QCTL 3PWUB 1YMMB 3MNVB 1CZ8L 4G7YH 4X98B 5FK9A 5F7WC 1ACZA 1J0ZA 4UB0L 2EC9U 5GHWH 3MLYL 5IQ7L 3PWLA 4HUKB 4YBQC 1ADQA 5FA4B 1HCVA 3TT1H 3DX7A 1JJUA 3MA9H 3HE6D 1MFDH 2PTTA 3QYCA 5CEXA 3BP5B 3MRKA 5I1HH 5JW5A 4OCSL 4PRNA 4ZYKB 4KMLB 1DLHB 3HZYA 4KI5E 4NC1C 2FGWH 3O3EA 3EOBA 25C8H 2L4OA 4KROB 1JUFA 5DD1L 3NCBB 4U6HB 1H5BB 3WNLA 4F8TA 3O4LE 2V5SA 4NUJA 4FFWC 4Q58C 3GB7B 1PLGH 2Z93B 1YEHL 4G80B 4M6NH 1S7VA 1PX3A 1AXSA 5BV7H 1OTTC 3AVEA 3V6OA 4QYOA 3GMOA 4R7DB 5JUEL 3B2VH 4ORZC 4YBQD 3QDGA 3I75A 1BEYH 1YNTA 2D7PA 4NO0B 4RAVB 5KSBE 2DQUH 3GBNH 3QWQB 3VI3E 1XF4B 1KEMH 1A3QA 4QOKA 1G6RH 3VFUB 3ZSTA 2RAMA 1JVKA 4DZ8B 1ZXQA 1YPZF 3SDCB 3B3IA 4M7ZC 1GH7A 2XFXA 3JV4A 1T5XA 4M7KL 1KCLA 2JJTC 2YN3A 1F2XK 3GSNB 4K9EH 3U1SH 2GJZB 3HMWL 2DL9A 1J1XL 1MRCH 4S0UC 3RL2A 1QLFB 3QFJB 5IESL 4RISH 3PWPE 3GHEH 5GZOD 3QXVA 5FF6A 2X09A 4ELMA 1FAKT 2VE6A 3ZT7A 1KIPB 4E41D 5HVFB 2XG4A 3ULVH 3BP7B 5C0CD 4JO2L 4C56A 2RB8A 2R0LL 3MCG1 1F4WH 1MLBA 5L2KE 3B9AA 4I0PC 5D7SL 5C0IA 3MREB 3RGVB 3T3PE 5DGQA 5BQ7A 1IRAY 3GK8L 1ZTXL 1S7TA 1HHJB 5IVOA 5IM7A 3RI5F 3EOAB 4PJXB 1JHTA 1D6VL 1UXWA 2OTWB 2FYYA 5EC2A 3WIHL 1IBGH 4HGMA 1A1NB 3IF1A 3IU3B 4KMTH 4OLYL 4BSWB 3N9GH 5I75B 4CAGA 2I9TA 2F8XC 3G5XA 4GBXD 2ZNXA 3FO1A 3LH2L 3LDBB 1AKJB 1P5VA 5HHQB 3T2NH 1U92B 4W6WB 4XPAL 2PTUA 2UVEA 1RMFH 5IHLB 3IJHB 4MNQB 2ADFL 1AGCA 3QG7L 1ZSDA 5LGJA 2IANA 4Q2ZB 4WY7H 2AGJH 4PRAA 5DJZA 3OWEA 4LSTL 1JWSB 2HH0L 3BH9B 1IGTA 3RVVC 2HRPH 5E6YA 4DKFH 1KENL 2GCYA 4LEXH 2IF7A 2C7UA 4OGZA 4L4TD 1QZ1A 3D69B 3RWFB 3MV8A 4XTRC 2I25N 2W07A 5C09A 1YEDA 4PJ8C 3D0LA 3PABA 3ROOA 4KDTA 5GS3A 2ZUQB 4KJYA 4WW2C 3LRSA 5ANMA 5LAXB 3U30C 3U4EA 2NZ9C 4M7LL 1UH3A 4UQ3B 2JIXB 5D1QA 4NKOB 5EZLB 5FYJL 1KCUH 5E99H 4JFZL 1P7QB 5IBUG 5I76B 3V6FA 3NFPA 5HTSA 3FQXA 2V5MA 3QIWA 2P8MA 2WK2A 3K3QA 5C7XH 4ODHL 1OARH 3SGKA 3MXWL 4WDIA 1QHPA 3O8XC 4JVPA 4Y19A 4AL8H 3EJZD 3TBSB 3RVVD 1KLGA 4YR6B 3AXLA 1Z9SA 4XTRD 4Y2DC 1T1YA 4KV5F 1SMOA 4GRLA 1UGNA 3P4OA 5SWQB 4V3EB 4JRXE 5HHMA 1S7QA 4QHUB 1G1CA 4KRPB 4NO2B 1VFUA 5DK0A 3H9SD 3GKWH 3C09B 5CJXA 5T1LB 5D72L 5AD0A 1MHEA 1UCBH 3HZVB 2D3VA 3C5SB 5EZIL 5IVXF 3MLRL 3QIUD 3FONA 5CEZH 4DZBB 5L8KB 1OAXH 4H88L 4ZUVB 5D71L 2WZPD 4IRJB 4YPGB 4KK6D 1KPVA 4BKLB 3ULSA 4YDIL 4ODUA 3MRPA 2X4QB 1OAQH 1HWHB 3O8XD 5F8RC 4U4BA 4CKVX 4PJBA 3NIFE 4Z77A 4NKIL 1KNOA 2CIKA 4N8VG 4LASH 5JQ6L 2GSIB 2BVPA 4Y2DD 3TBVA 1AXIB 2WNGA 3O2WH 4XBGB 3S35H 3QSKB 5HGBB 3GJEB 5GRJH 3OXSB 4KK9C 3C60A 3LQMA 4AQ1B 1PKQA 5MP6L 3LRHA 3C2AH 1OSZB 4POUB 1TQCB 5CHNB 5EOCH 1Q1JH 1T22B 1LEIA 4YXKL 2Z31A 3KXFA 2VDNL 3QHTC 1U58A 1N3NB 1TJIH 3KR3L 3BMWA 1R3KB 4PJDE 3NFNA 4TSCL 5GS1C 1IAIL 5E8PB 4FNLH 2A9MH 1P69B 5BRZA 1RU9L 4ZUWA 1B0WA 2H6PB 2XWBA 1ORSA 4JY5H 5SX5H 4K94C 4J3OC 5CLWA 4K8RH 3DURB 5ESAA 4MJ6A 1G7HA 1T7WA 3G6JE 1WC7A 1M7DA 4D9RD 4KKBC 1QBAA 4R3SA 5JZ7D 3ZDZF 4V1DB 2XZCH 3FQTA 3QO0A 5IV2A 1ZT4B 3P11H 4OD2A 1MCDA 4KK9D 1TQBB 3HKFA 3MODL 4JRYD 2DLTA 3U7YL 1LNUA 5BXFA 3P9WB 3ORJA 1CE6B 3V8OA 3UPRA 4PTTB 1XF3A 5DHVA 1ZS8B 4JO3H 1RUMH 4ODTH 1R5IB 3TA3C 2AJXL 2VOTA 4Q6IA 5IW3A 1H0DB 5K93A 2XA8H 3D3VD 4AZ8A 1KYOJ 3U9UA 1WBYB 4LSQH 4JKPL 4KRNA 1KIUA 5B4MD 1K8DB 1NUGA 4L8SB 3W0WA 1C5CL 5JW4N 5LKNA 1PW3A 3T0DA 2D4DA 1FYHB 3KPSB 5DFWH 1Q38A 3BYTA 2BNQB 4JR9L 2VWEE 2NXZC 3CU7A 5BVJA 4IJ3B 1IAKA 4LKCA 2QSTA 4AT6A 4FABH 3FOLA 3HTLX 5EBWB 4HZLA 3AMKA 1OTUD 5A40E 5HJ3A 2J1KA 1BD2D 3FB6A 5HHNB 4DVRL 3NIGE 3MCLL 3O41B 3SDCC 3MO1B 3MZTA 1T1ZA 4R0LB 4OFPA 5F7KC 4MVBC 1I7ZB 2R15A 4ZPTA 1UYWL 3MGTA 3D18A 1A7RH 3UBXG 5F72S 3VFSA 3MLPA 4X4MA 1ERNA 5E00B 2HFFB 3BT2L 3QUKB 4GG6A 1NMAH 3TJHC 1QFOA 1UH4A 4HKZA 3Q0HA 1EGJA 1P6AB 5CUSH 1P2CA 4HIEA 43CAB 5KOVC 4PJGA 4EBQL 2BERA 4ZSOB 4HULB 4GKZB 2AJVH 1A3RH 2Z92B 2LVCA 2Y23A 4YO0B 5GISL 3BZ4A 4FQHB 5IK3A 1RULH 3RWCB 4NO0D 4ONOA 4X5WA 4IMLB 3RGVC 1XCQB 2L7JA 4F2MB 3LKSA 1XH3A 2Q8AL 4QY8B 5D7LD 3OX8B 3ZKMD 1X5GA 1JPSH 4LSSL 4HLJA 5BZDB 3SDCD 3W9EB 3R1GL 3CVIL 4L4VB 1QSZA 2AVGA 1JNNL 4G7VL 5EFIB 5HBBA 1N8ZB 3MRJA 2R2CA 4HSQA 3DRQA 2HJKB 2LVEA 2ENSA 3VXOB 1V3KA 2ORBL 3OKNA 3QFJD 1ZT1A 5D9SB 2DDQH 3WIIL 3TJHD 4H8WC 4RMVA 3S3PA 4R90H 2JELL 1TMCA 1LO2L 2WP3O 1TJGL 3UDWA 1QR4A 4ZUUA 2F5AL 4OZFH 3QZWB 4M7JL 4KU1A 5KVFH 3B5TA 2EH8H 2G75B 2X4SA 1MJUH 3BDXA 1EXUB 4F7TB 1W72B 2IGFL 3RGVD 4GG8B 1F4XH 1YMHA 1Z2KA 1ETZB 4HUVA 3V95A 1JF1A 2NY3C 1YJDH 2I60L 2VQUA 2ZUQC 3I6GA 5E9DB 4MCZB 3BPNC 2FJGA 3EOTL 5J6GA 3OKOA 3CX5J 2AXGA 4XAKE 5ICYA 3MX0A 4NQEE 1T1WB 1UWGL 3TNMB 3ARBA 2R69L 2XNAB 3C8HA 3ZYJA 4OTXH 5AWNL 4UV7L 4KY1L 3F7RA 4Y5YC 2F5BH 1K3ZA 3WIFA 4MNQD 3DGCR 1CDUA 1EZVY 2F54E 4J4PD 4MDJB 2YSSB 1WVZA 2NY5L 4OZIE 1INEH 3CDFA 1UJ3B 5IJVB 1WISA 3SCMA 3EKCA 1C12B 2IBBA 4UV4H 4YHPA 5HGDB 4L1DA 3DUSB 5AZEL 4HAFA 1F3JB 4P57B 5IB1A 3VW3H 4YHYC 2YD8A 1J88A 3MJGX 5D7KE 4NP4L 3X3FL 4NKDB 3KPOB 3DVNA 4HIJA 4MD0B 3MRRA 2JIXD 4I3RH 4WV1A 3RWEB 4RAUA 1XT5A 2DICA 3GIVB 3VDAA 2CGRH 2VB5A 1P7QD 1C5BL 3N1QC 1X5ZA 3STLB 1FNEA 3U0PA 5JNYB 1BZ9B 1IE5A 1T5WA 5D1ZC 1R24A 2YUVA 4NPYA 5ETUA 5IT2H 3CVHH 2C1PB 1N7MH 1W0VB 4AEEA 4KTYA 1CLZL 3IDYC 3LZFL 2WBKA 4LU5L 1E6JH 1LO5B 3ULUD 1SQ2N 3JSSA 6CGTA 1BLNA 1YPZE 4CVXB 4F7MB 2PKDA 5MENB 4H1LH 4KRPD 4C59B 3KPPA 3QI9A 5B21A 2P7TB 2YK1L 5GS0H 1JK8B 4FFYH 4PJXF 5T1LD 5KOMC 5F7MC 1J0IA 3HLAA 4U6VL 5I9QC 1KB5A 3U9PL 4HUMB 3QEGL 4N0UA 1OTSD 1D5XA 4WFHD 1TLKA 3P0VH 4G8GE 1BOYA 1KPRA 3OTTA 2CMRH 3IKCB 4IRJD 5JXEC 5IFJA 4V3DB 4QRPA 4DEPB 3QULA 1AO7A 1HH9A 1N2RB 3WLWC 4ONHA 3VXMB 5H94B 2BP3A 2I5YH 4O58L 5C0ND 1BF2A 4M8QB 1Z5LB 2ID5A 1NCCH 5TDPB 2DAVA 1J1PL 1I3RA 2OJEA 3OAZH 3RKDD 1BIIB 3PIQB 2DQHH 1INQA 1IKNC 5D2NC 1IQDA 2YA1A 1RIUL 4LCWE 2V2XA 4DCQA 2WQRA 3SE8L 3C8KA 3QCVH 4XC1L 4HEME 4U7MA 1UKTA 4X6CB 4I3SL 2R23A 3W81A 3LN5B 4YHIB 1NCDL 4R8WH 5JXED 5MERB 3O0RH 4C55A 3TPUE 4R4FH 1G7PB 4IDJL 3WLWD 3IJYB 4L8SC 5GS2H 5D70H 2RFXB 3VH8G 3UJJH 2XTJE 4LMQI 1VEPA 3E3QC 1CFVH 2VABA 1M71B 4O02H 2W59A 3BPOB 1GVIA 4V1DD 4IJ3C 5KJRH 4MS8D 3CLEL 3EYUH 3RWIA 4LL9A 3E6HB 3CMOL 3J8F7 4MD5A 3ULUF 3MV7B 4F37F 3SJVB 3A0OA 5D7JC 5I1JL 4M6MH 2RBLA 4FQ2L 5HHOE 5T1MA 5JPMA 3O9WB 5LCVH 4FQ1H 4GKSB 1NCUA 2FATL 2IH1B 4ZNEE 4Q9RH 2MPAH 1XF5B 5DMYA 3CAFA 5CKAA 1BBDH 3JWDC 3UTQA 4R0LC 2AK1L 1KCRL 3P9MB 1QPPA 2NXYC 3VJ6B 4R26L 4GW1A 4HCRL 1FORH 3KHOA 3BH8B 4N90D 3S3SA 4GAJH 5IROC 3L3KB 1KN4H 5T3XH 3T0EB 1QFWL 5CJQH 2EZ0C 3BKYL 1HN1A 1G7MA 2AK4E 3KPSD 4GRMB 1NCBH 4KV5E 3QCTH 2BNQD 3C2SA 1CXKA 1CZ8H 3SDXB 3UTPE 5FXCH 2B20A 4UB0H 5LG1A 1H8OA 2ZOKB 3MLYH 4Y16B 2OXHA 1RZIA 4Y4KB 4ZFGL 2FJHA 2OMNA 3HE6A 1EEUA 3H0TB 1G6RB 2B39A 1M7IB 3UJIL 2VZ3A 4MAYB 1B0RA 2GTZA 2RIKA 5ITFB 4YHKH 1E4KC 5SX4I 1M4KA 5EU5A 3S36H 3TCLA 2Z8SA 1RV6X 3ZHDA 3FO0L 4HG4J 1T3FB 5DD1H 5HVGB 1Q9LB 5I6XC 2DLIA 3SE3A 4P59L 1DBKL 3GMQA 4RX4D 2EZ0D 2ZCLL 1M05A 4XP1L 4FFZL 1X6LA 5LBSL 5KW9L 2RJMA 3FN3A 1YEHH 4IRSB 1BX2A 3AFLA 1A8JH 4UNUA 3MMEA 3VD9A 4XPFL 1HQRB 4X9IA 5JUEH 3LKNB 3H7LA 1SEQL 4U0QB 4P2OB 3VFMB 1XZ0A 3ARFB 4ODXB 4X4XB 5FGBC 3TIEA 2BRQA 3LV3A 3CUPB 3TVMB 3G5ZA 4BK4A 4L4VD 1UWXK 3BYYA 4AYFA 5F1NA 5AZ2L 3GUTB 1IGCH 2DQIH 3EO1B 3FHQA 2NLJB 4M7KH 1J1OH 2X4OA 1HNFA 4WGWB 4XVUC 4CN1A 4S1SL 3N1FC 3PHSA 3MJ7B 2NYYD 3HMWH 2BNUB 2FIKA 3L6FA 3QEUB 4H0IA 3S5LB 5AUMB 1I7UA 5B38B 3O3DA 1G7JB 4L8DA 4C54A 3OAYK 4JQVC 4E41A 4KI1A 2HKFL 2W91A 4FQLH 2JJSA 5C0CA 1FZOB 4O2CB 4ZTPL 4TSBH 2EDKA 1RZJC 1A7QL 5DQ9B 4NHUA 5A16A 2EIZA 4JO2H 3ZDXF 1RSFA 2R0LH 1BVKB 1CVRA 4JPIB 4JFFE 1ZWIA 2ADJB 1LQVA 1MY5A 4FQPA 3ROLA 4Y5VA 5D7SH 1S7RA 2PW2B 4QXTA 4CDHA 3WE6A 3GK8H 5E9DD 4ZTOH 1ZTXH 3MRCA 5FYJU 1MIEH 3L9RB 4AIZB 1T0MA 5EBMB 2P1YA 2CRMA 4LLMB 4WFFD 2JJTA 4PJAB 3IDJB 5IVXA 2PW1A 1DE4B 2P8PB 5EO0B 3WIHH 1OAYH 1V7NL 3V5KB 4OLYH 1WTLA 1ZMYA 2R0WH 1EBPA 3BVNA 5JXAH 2AKRA 3QXAB 4HXBH 5DVOA 3MJ8A 2FJFB 4FZEH 4WI9A 3IVKA 5E5MA 2OZ4L 1KJVA 5DJ2A 2CIIA 1RK0A 1T21B 2IALB 4MQ7A 2ADFH 1DN0B 3QG7H 5JIHA 4LCCC 3QUML 5C1MB 2PXYB 1JYWA 2X4RB 4LSTH 2FR4A 4PBWD 1WWWX 4XX1G 4CW1B 4L4TA 1JHLL 1KENH 1S7XB 1YY8A 3ZKXB 2P5EB 1T89C 1VKXA 4HUWA 4S1DC 3LEXA 4JN1L 3PHQB 1T20A 4OQTH 4Y1AB 3RWDB 1IVLA 1DCLA 2IPKB 5HYEA 1AY1L 1JGEA 1MHHA 4NQTA 5E8NA 5FYJH 1IL1A 2XIDA 3EFDH 5DWUL 3E2HB 3UEZA 3FT2B 5ESVA 5ICZB 4OD3H 1UB6B 1CD0A 2C4FT 4DEPC 5EOTA 1HI6B 4FXGB 4ODHH 3QQNA 3MXWH 4JHAL 3B8YA 2DWEB 4YBHA 4KPHL 2X6MA 4U1KB 4JFHD 1ZHBA 2NY4C 1KUMA 3IETA 5ID1B 5LGHL 2ED8A 4P5TC 5ESQB 2J88L 4L8BA 3BKCL 5C0GA 3PGCB 4OFDA 1RZ8A 5MEND 3FQWB 5J57B 4BYHA 3MFFB 4LAQH 5EU6E 1KIQA 4OLWL 3H9SA 4NQDE 1T04B 4ISVB 1QSFB 5F6IC 2FH8A 3BISA 5F88A 5D72H 3PNWB 1SEBA 3QIUA 1RUAH 1S7WA 4QRTB 1BWMA 3QDME 5EZIH 3MLRH 5T3ZH 1YMME 5HPMB 3NCYP 4NKMB 5HY9B 4MQTB 1OP3H 4H88H 2IG2L 3QDHA 5D71H 4EDXB 1CGSL 3VXMD 3K2UH 1KCSL 4YDIH 3O8XA 1JNHA 3BIBX 3VA2C 2H2SD 4WU5B 2AJYH 2ZOLA 1X5XA 4NKIH 5ISZB 3BO8A 1SY6A 2VLKB 2A9NL 4Y2DA 1BFTA 2ZCHL 5JQ6H 1NDGA 5B8CA 5D7IB 4XBEH 4IM8A 2XKUA 2A83A 2YUZA 4OIBA 1GGBH 4IMKA 4RBPK 4WIQA 4ZOCA 5EBLB 1JN6A 3EDJA 1FPTL 3U4AA 5MP6H 2FX9H 4MWFA 3KYOB 2FX7H 2KQNA 4PRIB 1U8QA 5FUCE 3GMRA 3P73A 2GEEA 4X9HA 5FOJA 4YXKH 4RWYL 1YZZA 2VDNH 2V7NB 3BEVB 4WTZG 3KR3H 4TSCH 1LDSA 2YUXA 3G04B 1IAIH 1KLUB 3QXDA 2M1KA 3TYFA 3DHMA 4HIHB 1RU9H 5HGAA 5C0JB 1LGVA 5ENWA 3QJFA 5DO2C 4X7EC 2C9AA 5IVZB 4RFOL 3ARGB 2QV2A 2HMIC 5BV7C 4OZGB 3H9YA 1DEDA 3MPCA 3GRWL 3MJ9A 3MV7D 4XNQA 4BFEA 4MA1C 4KC3B 1Q94B 3K1DA 4G3YH 1LK2B 4JRYA 1U8HB 2P49B 4CADA 2O93L 2DBLL 3MODH 4LBEA 3DX9A 1OB1A 5F3BA 1QHOA 1AD0A 4DGYH 4PP1D 1T7XA 5DZOA 3MBXL 5CGMA 4AY0A 2AJXH 4K9EC 4C4KO 3D3VA 4M02A 4CMMB 3ESVF 5GGUB 4YAQB 5CSBA 5H2BB 4KKNA 2BVQB 3V6ZB 4JKPH 4LP5A 4JHZA 3PWUA 1NGWB 3WFZA 3MNVA 2PNDA 3DMMB 1C5DB 3ULVC 3D5OF 3FKUS 1GGTA 3VXNB 2ARWA 3BRDA 4JR9H 1H3PL 1IGIL 4Y16D 4D3CL 2DF3A 5FA4A 4Y4KD 3V6OE 2F53D 3TT3L 2CDFA 3BQUC 4MDIB 4LPYA 5I74B 3GMLB 4XXCC 2BRRL 1BD2A 2P5WD 3UTSE 1YY9C 1LP9E 1TIUA 4ZYKA 1QRKA 5CFHA 1DLHA 2W9DH 4DVRH 2OLDA 5DQDL 1A9EB 4WENB 3CCHA 4X6CF 4K2UL 3G6AB 4PDCE 4ZNCD 3CX2A 3ZYIA 2W38A 4U6HA 2G2RB 5C07B 1UYWH 4YGVA 4DTGH 2BY0A 3GB7A 3I02A 1RD6A 3BT2H 2DQJL 1MCRA 4APQC 5HGHB 3QUXC 5L88L 1ZK9A 3D1MC 2Z93A 4G80A 2N56A 1LMKA 4IRSD 4LLVB 5GPRA 4R7DA 2W60A 5ACZB 4P23B 4K7PY 4RAVA 4NO0A 5GISH 2J5LC 4LHUB 3QO1B 3NFSL 3VFUA 1OAZL 4PV9A 3ARFD 5GZND 4DZ8A 1U93B 1J5OL 3DV6B 2Z4QB 4OUUB 5D7LA 3SDCA 2Q8AH 1PX4A 3X3GL 5I1KL 3MRQB 1KULA 2BX5A 1G9NL 3GSNA 3R1GH 3CVIH 1JNNH 4G7VH 1CXLA 1QLFA 4JQIH 3OR6B 5FM5M 4NNYA 2ORBH 1N5AA 1BOGA 3TJHA 1ADQH 1RK1A 3NPZB 3KPTA 3RVUC 3WIIH 1YYMH 4TTDD 1KIPA 4PPTA 3BP7A 1LO2H 5DC0A 1TJGH 3SKUD 4P9HL 1DJSA 2PXYC 4HWZB 2F5AH 3SDXF 4M7JH 4RRPG 1R5WB 1K6QL 4NRXB 4DAGL 5E08H 3MREA 3RGVA 4CVZB 1VACA 2IGFH 1T1XB 3LPWA 1HHJA 4G6ML 1S78C 3GSOB 3EOAA 4PJXA 4ZG1A 5GGTA 4OUOA 1S5IL 2OTWA 3BDYL 1EHXA 4KJWD 1A1NA 3SDAB 2I60H 3IU3A 3DUUA 4BSWA 3Q3GB 5J7CC 1FYTB 3BGFB 1UWGH 5J6HB 3QQ4B 1U92A 2R69H 4X0KB 4IEFB 4LOUC 2JB6B 5AWNH 2BVYA 3UYOD 1I9RL 4KY1H 3IJHA 1IM9B 3BP4B 4MNQA 5ABDE 4J4PA 4Q2ZA 3CVHB 3WXVL 1RHHA 1MCHA 3EDKA 4XHJD 5BMFL 2R1XB 3MUGB 4OIIL 1JWSA 2PXYD 3IXAA 4ZAKC 5FDWB 5DA4A 2Z8WC 2DQTH 4F7PA 2NY5H 4MMZC 3TBTA 3EHBC 3ZL4L 1ZGLM 4Y19E 3SKOA 3D69A 1P53A 5E2WH 2WINB 4F58L 2JCCB 5AZEH 4WW1B 1A6VH 4N1CA 3FQNB 3D2UB 3WSQL 2YN5A 2IAMC 2FZ3B 4GLRH 4Y1AD 2R1WB 3X3FH 4UQ3A 2JIXA 5EZLA 5I2IB 1JZ2A 4TNWF 1C08B 3MV11 5FO8A 2NY6B 5F6HJ 5FUZL 4Z5RB 1LHZA 1P7QA 3UTTE 3HG1B 5I76A 5CEZD 4WI4A 4WFGE 5HI4C 4XVTL 5IHBA 1C5BH 4PJIB 2VXQH 5GSRB 4N5EC 1FZKB 3VI4F 3WN5B 4CDGC 4YX2L 2PO6B 3RL1B 4FQXB 5EZJA 1MWAB 1I7RB 4HLZG 4UDTB 4ZAKD 4K8RC 1F8TH 1CLZH 5I1IL 1O7SA 3EHBD 4X5XB 1HQ4B 4HT1L 2F8OA 3LZFH 3Q48A 3OKDA 3CFJB 3L3JB 4KKLC 1HE7A 3FMGL 2W9LA 4PRPE 2Z91B 5SWQA 3QUZB 4QHUA 3I6LE 4NO2A 3NPSC 1I8IB 5B39B 1JF6A 1O7VA 1QSFD 3BP6A 5T1LA 4WFED 2YK1H 3ARYA 2XY1A 1IC4L 4FQQB 3C5SA 4PJAF 2K7PA 1JZ7A 3I9GL 4U6VH 4DZBA 3FB8B 2B8OT 3U9PH 3QEGH 4L1HA 2HTLC 4ZUVA 1DQJB 2WANA 4HJ0D 4IRJA 4YPGA 2HFTA 4N5ED 3WO4B 4BKLA 1L7IL 5DD6B 3B5GA 1EHAA 4QRRB 2NX5E 2X4QA 5H35B 5DI8B 4MHHI 4Z6AT 4K8RD 1EJOL 4G8IA 1TZIB 1CGXA 4W81A 5ISZD 1F4AA 4LKXB 2VLKD 4KKLD 3CDYA 4QNPF 4XBGA 5EU7E 4NNPL 3GJEA 4XMPH 2P48B 3OXSA 4PB0H 5CZVL 5E7FA 3CK0L 1A3LH 3E0GA 1RIUH 1HWGB 1ZHNB 4HC1L 1OSZA 3H6JA 2JLLA 5CHNA 5C70A 2QQKL 3SE8H 3SKJL 2YD5A 1NDMB 1T22A 4PRID 2CLRB 2WSKA 1A7BA 4XC1H 3ARDC 3UPAA 4L3CA 1N3NA 4I3SH 2VDPL 1R3KA 2DKSA 1NCDH 1UEMA 5JXEA 1NC2B 2ARJQ 4L3EB 5E8PA 3AS1A 4YDLC 5C2BL 2ZG2A 1EHNA 2A6DB 4JPKL 5GRZA 4UQ2A 2H6PA 4I2XB 4MXWH 4LVHC 4POYA 4LAJH 4IDJH 4PJ9C 3X14A 3DMMC 2BFVL 3BAEL 1Z6JT 4LCUB 1A7OH 3ARGD 1J8HE 4ZFOL 4V1DA 5D2LB 4MS8A 3CFIC 1ZT4A 4JG1L 1KC5L 4YHNB 2Q7YB 3CLEH 3DO3A 1YUHB 2E27L 4CJ1A 3ZTJG 4XVSL 4PLKD 3KPRE 1CE6A 5I1JH 4PTTA 1ZS8A 2GIYA 5KSAB 3S37L 1R5IA 2YD6A 2FATH 5TDNB 3ARDD 4KQ3L 3LRGA 1H0DA 4NKQB 2VR4A 1UKSA 2GAZB 2AK1H 3L5IA 4YZFF 4P2CG 1V7ML 4HJJL 1WBYA 3ZDYE 1HHHB 3HC3L 1KCRH 3NABL 1M6OB 4L8SA 3KDMB 4RMRA 4R26H 1A6WL 4PJ9D 3L95B 3RTQB 4P5MB 1L4IA 3DMMD 3E3QA 3NACL 1T66C 4Y0GA 3UC0L 3BKYH 4P48A 2BNQA 4CMHB 4FTVB 5DJAB 5E4EB 2VLLB 4FN0A 4YHOL 3TIDB 2MHAA 5CZKA 5ADOH 1MCEA 5EBWA 4QWWC 5I8CB 4MQSB 5D7IF 2N7BA 1QEWB 3OKLB 4O9HL 1HK6A 1KJ3L 2IPUK 4JANB 1PEZA 2YRLA 4D0BB 3GSUB 3O41A 3UJIH 4OJFL 3BKJL 5E6IB 3MO1A 3S88L 4R0LA 2EIEA 3IS0X 3CIQA 1LVEA 5DLML 1U8IA 2B5IB 4FG6D 5C07D 1WV7T 3WHE1 4AH2A 5E00A 3U0WH 4LVNC 3OGCB 4ESKA 4RX4A 2KPNA 43CAA 2HT3C 1EDQA 1T66D 3VXUB 2BHYA 1G9ML 1OF2B 1SYSB 2JJVA 3QHFL 3QNXB 4P59H 5CJ5A 4ZSOA 1G9EA 2ZCLH 5C9JB 4OZHE 4GKZA 4YO0A 2Z92A 4XP1H 3BMVA 4FFZH 5ILTL 1QP1A 1DANT 4P23D 5LBSH 5J56B 5KW9H 2FEDD 4FQHA 4A6YB 5DK3A 4OZGF 4BK5A 2N1KA 4IMLA 4LHUD 4QWWD 1QSED 3CXDL 1T7VA 3RA7H 2EEAA 3LD8C 2R9HD 4XC3L 1WZKA 1QSVA 1DLFH 2HA1A 4QY8A 1SEQH 4NNXB 5E5UB 3HN3A 3W9EA 4L4VA 1OLZA 3EJJX 3HMXA 1N8ZA 5C86A 4E9LA 2OP4L 3B9VA 2BOBB 5AZ2H 3VXOA 3ZE1E 5AG8A 2FH6A 4S1SH 1QFUL 5D9SA 3A6OA 5D5ME 5KZCB 3F6LA 3F62A 4FQJL 1AH1A 4O2FB 2AXHA 2YPVL 1F90L 2FD6H 3QZWA 4PJ7B 2HKFH 5L9DL 2G75A 4ZTPH 1OP5K 2DLEA 3CSPA 1EXUA 1WUNT 1W72A 1ZT7B 4G42B 5EU3B 1WBXB 1NKRA 4HMEA 4J6RL 3MR9B 5FGBA 1ETZA 5E9DA 5IBUB 4MCZA 3CLFL 3SGDI 1XF2A 4K3DL 2IQ9L 3EZJB 5IB5B 3S96B 1XR9B 1T1WA 2X7LB 2XNAA 5DVMA 1IKFL 1V7NH 5BOZG 5F7YC 1RURL 3O11B 4I13B 3MLXL 5DJ6B 4JFPB 1GGUA 5C9KA 1OGTB 4N8PA 1Z9OA 4X7FC 3BGAA 1IM9D 2UWEA 4U2ZA 4MDJA 4JQVA 2YSSA 1F6AB 1J87A 1UVQA 4N1EA 1CGTA 1PZ5B 2GYSA 1UJ3A 3DBXB 2X70B 4EQ2A 5IJVA 3HI1B 1C12A 4K07A 4GAFB 3QUMH 3FRPA 3DUSA 1F3JA 1WT5A 4P57A 2NY0B 1JHLH 4H20L 4JJ5B 3D2UD 3KPOA 1ND0B 5GS0D 4MD0A 4XBPB 1AQDA 4JN1H 2ATPA 3RUGB 3RWEA 1JIBA 1A9BB 2NY6D 1AY1H 2XN9E 1C7TA 3HG1D 3STLA 5JNYA 1BZ9A 4GRWE 4M1GL 5DHYB 2UY7A 5DWUH 4QHLB 4JDVB 4N8VB 4XP6L 4EOWL 3F65A 3H9HB 4R4ND 1NAML 2C1PA 2PO6D 3WL9B 1GZQB 3B4NA 1LD9B 3MXVL 1QNZL 4FQXD 4AG4L 5ITBL 4U1HB 4F9PC 4LCCA 5MEQB 1EERB 2BSTB 4R4BB 2VISA 3U79A 1LO5A 4JQXC 4EVNB 4KPHH 1U91B 3S4SA 4B7IA 1PAMA 4U1LB 2IPUG 4CVXA 3MC0A 2UYLB 5LGHH 1CK0L 2BVEA 3HAEA 2J88H 3KJ4C 3BKCH 3QUZD 3ZLQC 3RNKB 2AXFB 2V17L 2YD1A 2P7TA 4WWID 5C71A 3T2OA 2BXYA 3ZYOA 1AHWB 4EJ1C 1MJ8L 1JFQL 4Y89A 3TJEL 3VWKB 1AJ7L 4JFYB 3PQYE 2NY7L 4HMCA 3W5MA 1W0WB 3TV3L 4XT1C 1LE9B 5IBTL 4AM0B 3M8OL 1N2RA 1VPOL 5E8EB 3SDXE 2NNAB 3VXMA 4D8PB 5JW4M 1UWXH 2IG2H 1ITCA 1CGSH 2VLJE 1MHCB 4HZAA 4YIQB 2NY2C 2D7OA 4FP8L 4IIQB 4Y8AA 3PL6C 1Z5LA 5TDPA 4CJ0A 3WNKA 4TN9A 4KVCL 1BIIA 5KSVB 3PIQA 2L7UA 3DHJA 5KANI 4CL7A 2A9NH 2ZCHH 1MLCB 4L5FH 2JCCF 3TH2T 4X7SL 3OAYH 2ITCB 1MVUA 3ZMRA 1ZHKB 1FFOB 5FYKU 4X6CA 1FPTH 4QTIL 3LN5A 3DYMA 4YHIA 3SO5A 4JZJB 3VWJB 3KLAB 4L3ED 5MERA 4BH7B 1G7LB 3VRIA 1G7PA 2NTFB 4RWYH 4PJIF 1U41A 4RGNE 3IJYA 2RFXA 1L6XA 3RTQC 5T3XD 3SKMA 4E0RB 1M71A 2APVA 1FNSL 5E03A 3ILQC 3W11C 4YEFA 3NZHL 5HYQB 3D87B 2C3XA 5E4EC 3GI9H 3E6HA 4HJGB 3RPKA 3MV7A 2E8ZA 3WEXB 1G1YA 3GRWH 4LPUA 4WEUD 2OM5A 3TN0B 1GRWA 5AYUH 5GGRB 5DJDB 1PG7X 3V7AE 4GKSA 1EEYB 3BWAB 2IH1A 3QPQC 5EC1B 2JJUA 3UBXB 2BOCB 3L5WB 2DBLH 4WUUD 5C0AB 2BNRE 3O4OB 3F5WA 1A1OA 2EDFA 2DD8L 3MBXH 3ISWA 1I85A 4PJEB 4G9DB 2X1QA 5DRWB 5FYKH 4P3CL 1A14L 3U48A 1FP5A 3BH8A 2ZNWA 3T4AB 3L3KA 3RTQD 1DSFL 4JFOB 2F58L 3W11D 4GRMA 4JFDB 3F6IA 1U8LB 3EDEA 5GGSB 1QBBA 3ZTNL 5DSCB 5DEFB 4XI5C 2ZOKA 4NRYB 4Y16A 4Y4KA 2DBJA 3ARVA 2F53A 3HRPA 4MA3B 1IGIH 4D3CH 2GK0B 1OD9A 2GSGB 3H0TA 1G6RA 3TT3H 1M7IA 2YMXL 2FO1A 2HFEB 2P5WA 1GSMA 2E7HA 4XZUB 3H7BA 2Y7QA 5E6ID 5ITFA 4BQ8A 1HEZA 4O00A 3GNML 4UIKH 4KQ4H 3T08A 5DQDH 3ARPA 4D94A 1ZV5A 4K2UH 4LGSB 4NC1E 1HYRC 5IBLC 4M61A 4I5BB 1F13A 1DL7L 2VL5B 3ZKND 1PDKA 4PRHE 3VXUD 5HYJB 3OJ2C 4U1JB 3T77B 2DQJH 4Z18A 4F57L 3V2AR 5L88H 4AEIH 4IRSA 3RWGB 5FKAB 4WGVB 5HDQL 2P5EE 1F5WA 1U8JB 1HQRA 5D2LF 4NHUE 3LKNA 3LKOB 2X44D 3VFMA 3ARFA 4ODXA 4X4XA 1FL6B 5EG6C 1MJJB 3NFSH 4MJ5B 3SE4C 3CUPA 1OAZH 2X1OA 4U3XA 1J5OH 5IFAL 2YPLB 3L3DB 1KTRL 2I9LB 3EO1A 2NLJA 5EO9B 3X3GH 5I1KH 3Q2CA 1XGPB 1G9NH 3MLTB 3TZVB 3G6DL 3MJ7A 1IC5H 4GS7C 2BNUA 1X5KA 3P4LA 4NFCA 4ZXBC 3UPCA 2FLBT 3QEUA 3S5LA 1CFQB 5B38A 5JHDB 3C5JA 1CQYA 3ETBF 1G7JA 1P6FA 3QUXA 1SMAA 4RBPH 3EFFB 4XWOD 5F1SA 5I18L 1NMBL 4O5LL 4WO4B 4O2CA 2WWKO 3U0TB 1R3LB 2B2XL 4P9HH 1BVKA 4JE4B 1KYOK 4JPIA 1BVLB 4MA7L 2ADJA 3QEHB 3VMOA 4N8CL 4DAGH 2PW2A 4PJFB 2BC4B 1I8MB 4AIZA 3L9RA 4G6MH 2FEEL 4LLMA 3QPXL 4PJAA 3IDJA 1DE4A 2P8PA 5EO0A 1REIA 2B1HL 3B8SA 1I1YB 5E2JA 4U6XB 5EN2A 3V5KA 1MCWW 5FYJD 1PG7W 4PJHA 3RHWK 3QXAA 4S1RH 1CTOA 3NTCL 1I9RH 3HR5B 2IC2A 2DOCA 3GSQB 1D9KB 1T21A 2IALA 1DN0A 5DYOA 3WXVH 4X80L 2PXYA 3DX8B 2OBGA 5BMFH 3PGDA 4LARL 4OIIH 1YEIL 3X13B 4CW1A 4UIMB 5HHVL 4OCRL 3ZL4H 1VGKA 4DW2L 1S7XA 4MXQC 2NY0D 4NO3B 3ME0A 4F58H 1A4KA 3PHQA 4YWGH 4LDOB 5EWIH 4Y1AA 2E5EA 3RWDA 1JBJA 1WWAX 1RUKL 2IPKA 3PUCA 3U4BL 3F12B 3WSQH 4I9WE 5MI0C 3QISA 4TULL 3O4LB 2PYFB 4HLZH 1JRHL 2OK0L 3FT2A 1L7TL 1MSPA 1Q9WA 2VKWA 2OI9B 5ICZA 5EU4B 4OGYL 4XNUL 2IQAB 4NC0B 4HXAL 1UB6A 4UAOC 3FT4B 3MOBH 1K2DB 3GSXA 4KWUA 4JFQA 2QQQA 1OOAA 1WK0A 4FXGA 5C8JB 5GSVB 4YX2H 4WTWA 2D7TH 2DWEA 4ZAKA 5E95B 4U1KA 4NWTL 5KSBB 3X17A 4PJ7F 5ID1A 4BQ9A 1A6UH 4G6AD 5ESQA 5I1IH 5K9JL 3I50L 4JY6A 4HT1H 3FQWA 4W4OC 2VLME 3DETC 3B9DA 3MFFA 3HB3D 5D8JL 4UMGA 4BH8B 2IAMA 3KNBB 2GK2A 1T04A 5C6PB 4ISVA 1R5VB 1QSFA 3MTRA 5F21B 1C16A 1N0XH 1LEGA 3VH8B 3AS0A 4QRTA 4JZJC 1IC4H 1X5LA 3RIFK 3PWPB 4XMLL 1HKLL 3I9GH 5HPMA 4NKMA 1IAII 2CKBL 4XNZC 5HY9A 4N5EA 3W39B 4HWUA 1ROWA 4EDXA 4OLZH 4MGXA 5T1KA 3TH4T 1MJ7H 1YQ2A 4EUPG 5L2KB 3CX5K 4WU5A 1YYLH 1NSNL 1CGVA 4NQSB 1EJOH 4P2RD 4S11A 5CGYC 5ISZA 1I1AB 2VLKA 5FCUH 3Q5TA 1O5DT 4JAMB 1OWWA 5D7IA 4OM0H 2IWGA 1T2JA 3LAFA 4NNPH 3TN0C 3VG0L 1UQSA 3GKZA 1GOFA 1ZA6B 1HYSD 3JTCA 3MRFB 3TWCL 5CZVH 4JKMA 3CK0H 3IDMB 2WWMC 3KYOA 4HC1H 2X40A 1U8PB 4HWNA 4PRIA 2ICEB 3O4OC 3RRQA 8FABB 3RUGF 3SKJH 1DQML 3VWJD 1IAIM 4ZFFB 5JTWA 3DXAE 4Z7VE 4WI5A 4YFLF 4JM2B 2HJLB 2V7NA 3BEVA 4PBVC 4DN4L 5C2BH 1RJZB 2WV3A 4DGIL 2NW3B 4HIHA 2NY1C 3IJSB 4YPJA 2DLHA 2P43B 5C0JA 5K59E 5FA3B 3ZTJH 5IVZA 1FE8L 2BFVH 3ARGA 4OZGA 4IRZL 1E0OB 3BAEH 3HCVA 1Q94A 1DN2A 3TN0D 1KC5H 5CEYB 1CIUA 1LK2A 3UBXI 1U8HA 2MKWA 3GSRA 2PETA 2E27H 5I8KL 1I3GL 4XVSH 4P3WA 2DQEL 5DTFA 5C0AD 3ZE2F 1BD2E 4IS6A 3S37H 3ARDA 3FO2B 2PYEE 4KQ3H 1L9MA 3FQRB 3LKQA 2ADIA 4CMMA 3V4VL 4DWHA 2SEBB 3JWOL 5GGUA 5H2BA 1MQ8A 1SY6H 3NVQA 1DUYB 4HJJH 4YAQA 3HC3H 5D96B 2GTWB 1U8KB 2NY1D 4PJ9A 3SGEI 3NABH 4OI7A 1NGWA 3DMMA 3VCLB 1A6WH 4UTBL 1D5ZB 4JFDD 1F3DH 3L3HB 1KELL 1NBZB 3OB8A 3UC0H 5DDHA 5L6YL 3VXNA 1RZKL 4KZDH 4JRXB 4YHOH 3O3AB 4JFED 3GMLA 2DJ4A 2R39A 3SN6N 2QSCL 3BI9X 4XNYL 3PJSB 1EHLL 1WWBX 1KJ3H 4N5UA 1K5NA 5D7LE 1A9EA 4JZNB 4OJFH 4X5LA 3BKJH 3G6AA 5CD3B 3S88H 4PD4K 4DKEL 2HVKB 3TNNB 1NANH 5T33L 2G2RA 4PG9B 5C07A 4GAYB 5DLMH 1FSKB 2VITB 5TF1L 3CSGA 1CGUA 5HGHA 2XI9A 3HC4H 1NUDA 3DX6A 1G9MH 4WO4C 4YFDB 1WEJL 4LLVA 5C2UB 2R4SH 5ACZA 3FFDB 4P23A 4POZC 4N9OB 5ILTH 4XRCB 4LHUA 1QSEA 3QO1A 5TGBB 4ONGL 3K7UA 1P4BL 3CXDH 3N1PC 1U93A 4HD9A 2A73B 4ETQA 3DV6A 2Z4QA 4XC3H 4Y4FC 2ESVB 2YPLD 3MRQA 3KLDA 4PJDB 1ODAA 4GW5B 3RU8H 3RPIB 2IMMA 3QCUL 3TZVD 4KH2A 4AENB 4MNHA 4QCIA 5A2KH 2OP4H 4NCC1 4PJEF 4GUPB 2HLFD 4O51B 5JHDD 4I3GA 1E27B 1QFUH 1I1FB 1NAKL 3G6JB 5L2JB 4WO4D 1U8MB 1D9KC 1AD9B 2W0KA 3AROA 1MCNA 4UBDD 4QHKI 3WYRA 4HWZA 1VEOA 5EPMB 1R5WA 3CDCA 4Q9QL 4GOSA 3ZE0E 5L9DH 3QUMB 5I1EL 2VYRE 1AFVL 4PREB 4CVZA 4OKVB 3ERYA 2ITDB 3EJYC 3IDGA 1T1XA 3BPLC 3D0VB 4Y4FD 5FM4A 4LHQB 3GSOA 1MCQA 4J6RH 3T04D 1II4E 4KI5C 5BO1L 1RZ7H 4S2SB 4D9QD 1U8OB 1QTYT 3CLFH 3M45A 4M1CC 5IMOB 1J11A 3Q3GA 4K3DH 2IQ9H 4Y8DC 3NAAH 1EX0A 3MYZA 4NZJA 5J6HA 3QQ4A 4PP8C 4X0KA 1IEHA 1IKFH 1FO0L 1QO3B 2JB6A 4MNGE 3C08H 2HN7B 2D03H 1IM9A 3BP4A 3MLXH 3V52L 2DM3A 3CVHA 4R96B 1YN6B 1D9KD 4KVNL 3MUGA 3BX7C 1GIGH 5GGQL 1ZA3B 5FDWA 1YC7A 4FXLA 1I4FB 2V5TA 2BVOB 4HF5L 4KDTC 5HDBE 2HG5B 4Z7QE 4LLDB 3GSNH 1NEZB 4XNXL 2JCCA 2UZXB 4H1LA 1C1EL 3MUZ1 3D2UA 4KI5D 1ZLUK 2WLZA 3C5ZB 4H20H 2FZ3A 1UB5B 3QDJA 3LIZL 1CGWA 3QIWC 4M1CD 1NMCB 3V7AG 4I8DA 1EFQA 2LTQB 1EO8H 1C08A 3SGKC 5IQ9B 3O4LD 4Z5RA 1I8KB 3NCJH 1AXTL 3HG1A 5CJOL 1QBMH 4PJIA 4NBYB 2AV1B 3VXRE 1ZOXA 1FVDB 4PGEA 5I66B 4M1GH 1MFCL 1FZKA 3WN5A 5E2VH 2PO6A 4NWUL 3IS1X 4FQXA 3B9KB 4EOWH 1MWAA 1I7RA 1PBYA 1NAMH 3A6CL 4GRLC 3F7YB 3MXVH 1QNZH 2G60L 5ITBH 1FVEA 3RVXC 2Y07L 1P4IL 5IW1B 4X5XA 4PP2B 1HQ4A 4J8RB 3FFCE 3CFJA 3T3ME 3L3JA 1A7NL 2DM4A 2Z91A 4L4JA 1LDPL 3QUZA 4JHWH 1NGQL 1I8IA 2EC9T 4PJFF 3IDUA 1N64L 5B39A 2H8PB 4TVPE 2V17H 4NDMA 4NN7B 5IHZB 1UC6A 1UZ6F 5CKGA 3GSWB 4UDUB 2E9BA 2VDRH 4FQQA 1MJ8H 1HSAA 1JFQH 2A74A 4JN2B 2FB4L 3TJEH 1B2WL 3O6ML 3F7VB 4UOJA 1AJ7H 5EUOE 4U05A 3PWPD 3QIBB 3FB8A 2NY7H 2QQLL 1DQJA 5FV2A 2X05A 2OJZL 3TV3H 1TXKA 5IBTH 3WD5L 5H35A 5KVMC 5DI8A 4FTVE 3M8OH 5MEPA 4F9PA 5L2KD 1VPOH 5JMRA 5IHUL 5DJ0B 3C60C 3EO9L 1CDYA 1IZJA 1JTTA 1I1AD 2DTSA 2OR7A 4IHOB 4LMQE 1QVOB 4DVBB 1EMTL 4N1HB 4CU8A 4FP8H 5HI5C 3SE9H 1E6OH 3V0WL 3PXJA 1UT9A 2Z31C 1XF1A 1MCIA 4FZ8L 5CBEA 2APXA 1AQKH 1CXHA 4M6OL 4WU7B 4H25B 3AREB 4MAUL 5HYIA 1TTFA 5D2NE 1DTUA 1ZHNA 5J13C 4KI5F 4GSDL 5GRYA 4NQEB 5I15L 4X7SH 1NDMA 1IEAB 2MQ3A 3VXTB 2CLRA 1DQDL 4Z7NF 1MCCA 1E4XL 2B7DT 1OP5H 4I4WA 2EDBA 3LSOA 4L3EA 2HAZA 2F54B 2A6DA 4X6FB 4ALAL 4JGUA 3GGWB 4I2XA 3MLZL 4OZIB 4OFIA 1FNLA 4WI8A 1LO3L 1D5BB 4LCUA 1ORQB 3E3QE 3QEQB 4U1MB 5KSBF 4GMSH 3VI3F 5DFVC 5HI5D 3NZHH 4CUCA 1OCWH 3FO9B 2Q7YA 4YHNA 1P4LB 5CSGA 1BZ7B 1YUHA 3OV6A 1CTNA 3ILPB 4OGAC 2DWDB 1MCSA 5SWSA 4K71C 4EEEA 2FWOA 2D7NA 3OAUL 3FJTA 4WUUA 4XP5L 4WI3A 2D0FA 5TDNA 1MH5B 5CCKL 2H2PC 1A2YB 1MAJA 3WO3B 1IZKA 3L1OL 2IBZX 3CZFB 3WNOA 4HKXB 2J8UE 1HHHA 1CIDA 1S3KL 5JOEA 5F9JB 1M6OA 5TE6H 3WFEL 3KDMA 3QR2A 3PP3K 2AW2A 4P3CH 3RTQA 1A14H 4ZUTB 4P5MA 5BS0E 3HR6A 5IEKB 4JG0L 1DBBH 5F97E 1DSFH 2Y6SD 4LF3A 2F58H 1YPZB 2EYRB 2VLLA 5DFVD 5DRNB 3TIDA 4X8JB 4JRXD 3T3PF 1WFUA 2Q3ZA 3ZTNH 4N0CD 1N0LA 5I8CA 4Z0BL 4JLRA 1QEWA 5MHSD 3OKLA 3PE9A 4XH2B 5C08E 2OSLB 1JYVA 1TZHA 4D0BA 4W6XB 1N59B 3OPZL 3MUJA 2QJDA 4JREC 1NBVL 1T80A 5JA8B 3RKPA 4G8GB 1V3LA 3PWNB 3AMLA 5FM8A 3MOAL 3GNMH 3OXRB 4XCFL 3KLHD 2HRLA 3U6RB 3JTSB 4O2EB 4JM2F 3MRMB 4X6DA 3RWHB 5KTEL 3VXUA 1DL7H 1OF2A 1SYSA 3QNXA 4TQEL 4EI5B 4YK4B 5ACMA 5GRXG 3VFGH 5C9JA 2FX8L 4F57H 4K3GA 3T65A 1K4DB 1QRNB 2UUDK 1AE6L 3O6FB 4L29A 4LCWB 2ERJB 3VRLF 4N0YL 1KEGL 4NNXA 1NGYB 1CBVL 1IARB 3LKRB 3WS6C 4DQOH 2C4FU 1OY3B 3WIHA 3TPUB 3UDWC 4CGTA 1K8IA 1MIMH 3WBDA 2XTJB 3HNTL 3G6DH 4FMFA 1RAMA 2EDWA 1UA6L 4O2FA 1XCTB 2X9YA 2UWEE 2VZUA 2OL3L 2IH3B 4PS4L 3ES6B 5I18H 1NMBH 3RY4A 2B2XH 1EO7A 1ZT7A 5CZXC 1TTGA 1A64A 4G42A 5EU3A 5HHOB 4KJPC 1WBXA 4MA7H 4N8CH 3MR9A 3X12B 4LNRB 3VE0B 5FYLE 3ARBC 4XHQA 4HFUL 3RJDA 1NLBH 4I18B 4PUBL 5IR1B 4NQCE 3PG2A 4OT1L 2IBGA 2Q87A 3P30H 5JO5B 5IB5A 3SY0B 1JPFA 3S96A 3QPXH 2AJUL 3W2DL 2X7LA 1NFDA 1SVCP 1YN7B 5CP3A 3RVTC 3O11A 5DJ6A 4JFPA 5D6DC 1OGTA 2AK4B 1F45A 3BIKB 3OKKB 2QLVB 1CDBA 3NIFF 1F6AA 3HPJB 4RFNB 2JJWA 3NTCH 2XWTA 1PZ5A 2VC2L 3DVGB 3VMNA 3DBXA 3HZKB 3HI1A 5FHBH 4X80H 1UKQA 3GO1L 4LARH 3OHXB 4QXUH 1AGBA 3B2UC 4LLUB 4WV1C 4YH6A 3BUYB 5HHVH 1CVSC 4OCRH 3BZEA 4JJ5A 1LK3L 3GJFK 4DW2H 3C5ZD 2YD7A 2W0FB 1ND0A 3CSBA 3PGFH 4XBPA 2VL4A 5BZWB 1CLYL 3RUGA 3BHBB 4FQIL 3D39E 2P42B 1RUKH 1A9BA 1CS6A 4D9LL 4PJDF 1KJMA 4OBRA 3PP4L 5EBGA 4TULH 5DHYA 2MNUA 1S7SB 2OK0H 1WICA 1L7TH 4JDVA 4N8VA 3FL7A 2F19L 1FL5B 3NCYS 4U6YA 4XNUH 1GZQA 2A6KB 1LD9A 1OAKL 3WL9A 4HXAH 3HNVH 3B9KD 4U1HA 3K8MA 3G6JF 3KVQA 5MEQA 2BSTA 4KHTL 4R4BA 3WFDL 3MSPA 3QI9C 1DQLH 2DKUA 2VSDA 4EVNA 1U91A 1DVFB 5DJ8B 4U1LA 1X44A 2UYLA 3I6KB 1CFBA 4WJ5B 4K7PL 3LQZB 5J11C 1PKOA 2EDJA 3I50H 4HK0A 3RNKA 2AXFA 4F15C 2ED9A 1EPFA 3GEWB 2RR3A 3AREC 1AHWA 3BE1L 1EK3A 4LSDA 2GT9B 5D8JH 3T1FA 2A0LC 4JFYA 1S9YB 1W0WA 3QIBD 4EUPH 1A6AB 2Z8VC 3QNZA 3W9DB 5E2UH 1LE9A 3EYQD 4XCNB 5JR1L 2F15A 4XMLH 1KXQE 1BJ1J 1J10A 5E8EA 4NOFA 2NNAA 2CKBH 2EE2A 3VGDA 1UACH 3D6GA 3TYGL 1JFMA 1MHCA 2QADB 4NO5B 4J3SA 4YIQA 5DVKA 4JFFB 2WUCL 1JE6A 1EEZB 3CPLB 4IIQA 2P46B 4P2RA 1NSNH 2DI8A 4U3HA 1WITA 3WXWL 2JF1A 3A6BH 4GQ9L 5F7EL 3ARWA 4ZFOB 5D1XC 4PY8I 1H8SA 1MLCA 5BJTB 3LQAL 1H3GA 3MJ6A 3ARED 5F89B 5DK2B 3NIGF 3MROB 4PGBB 4XAKD 3VG0H 4ZMAT 2ITCA 5DRXB 1JNLL 1ZHKA 4NQED 3C87A 2VMFA 5K9OB 3UP1A 1HZHL 2WM0A 4JZJA 4H8WL 2I07B 3CFKB 3VWJA 4HUNB 2EYSB 1IAMA 3HRZA 5B22A 3KLAA 5HYJE 1S9WB 1DQMH 4BH7A 1G7LA 2F54D 1GXEA 2R56L 1PG7L 2YXFA 5IG7A 3V4PL 5IIEA 4OCLC 3FHAA 1HHGB 4E0RA 2ZSWB 4DGIH 2C1OB 4RFEB 1QA9B 1HILB 5I30H 5HYQA 5C0DB 1T0NB 2MSPA 1X9QA 3U36B 4IRZH 3MRGB 5D1XD 5L8LB 5D7KD 3QHZL 3WEXA 3KLSA 5IEHB 1RQ5A 4IOIB 4JZOB 4DGVL 1BPVA 1JPGA 3TN0A 5I8OL 2AJ3B 2AV7B 1AI1L 1HHKB 5DJDA 5GGRA 1D6EB 4KUCF 5GRWA 1EEYA 1U0QA 2A77L 5EC1A 3UBXA 2BOCA 3L5WA 2GITB 3OB0K 3GHBL 5C0AA 1IILE 5I8KH 1I3GH 2G9HB 4OLEA 2DQEH 5DD0H 4BUGA 4PJEA 3O81A 4G9DA 5DRWA 1G9NC 1BJ8A 3MLSL 2IFFH 1GGYA 5JA9A 1IGMH 5FUOH 3BJ91 3T4AA 5GGSY 3V4VH 3JWOH 5IWLA 3KYMB 4JFOA 1GAFL 1MQKL 3VXSE 4YK4C 4JFDA 5GGSA 4ONFH 3GBLA 3I85A 4UTBH 1FG9C 4WWKB 5E2TL 5DSCA 1MI5E 1YDPB 3ULVE 5DEFA 1OQXA 2ZCKL 4NRYA 2BHZA 5HYFA 5L6YH 1RZKH 4P9HC 4X9FA 4MA3A 2GK0A 5EU6B 5DUBB 2GSGA 4JFEA 4NQDB 4MJIE 3QBTB 2HFEA 4HV8B 5FB8B 4XZUA 5AAWA 3VD3A 3KJ6L 3HUJE 3SE3C 1EHLH 4G8GD 3QDMB 4GRWH 4NSKB 1EFXB 3SOBL 4H5SA 4QKXB 3TLRA 5GJTL 4U2YA 4PG2A 1NPUA 2HFGL 4DKEH 5IJKA 4I5BA 5T33H 3TH3T 4U1JA 1KN2L 3SBWC 4M93B 4EI5D 1J0HA 1OM3L 5M95B 4OZIF 5TF1H 4QRQB 1TVHB 5C0BE 3RWGA 3TP4A 5FKAA 1EAPA 4ZS7L 5EO1A 3L5XL 5F7LB 4TVPL 4PGCB 5FKPA 4LCWD 3LKOA 1MCOL 3OGOE 1DR9A 3ARRA 2AP2A 1LO0H 4G9FE 1RUQL 4MJ5A 4Z7NE 1D5IL 4ONGH 1JCKA 2FDBP 4YC2C 1P4BH 3OZ9L 3SO3B 2ICWB 2YPLA 3KHQA 3L3DA 5GZOC 5EO9A 1NC4B 1A7PH 1QG3A 4L9LB 4PGZA 4EDWH 1XGPA 3MLTA 3TZVA 1H15A 3VGHA 1GYAA 2JJSC 3QCUH 4Z7UE 5KS9E 2XXCB 5JHDA 1CFQA 1VDGA 2A6JB 1LE5B 4PJHE 3EFFA 5IFHL 1MNUH 1NAKH 4Y5VC 4WO4A 4TSAL 3U0TA 1R3LA 2YC1A 4M00A 4DJMA 3BN9D 1VFBB 3QEHA 3PWLB 5HHOD 2DQDL 4EN3B 4Q9QH 2D7QA 5I1EH 1AFVH 2PTTB 4PJFA 4ZOBA 3P4NA 1S5HB 2PCPB 2HKHL 4GBXC 4Y4FA 4F3FB 1K4CB 2VN4A 3CZJA 1FVCB 4OZ4B 5BO1H 4EIZC 1I1YA 1OP9A 1G84A 1ZHLA 4U6XA 3EOBB 4A6YL 4P4KB 1JUFB 1KTDB 4P46B 2AK4D 2E7CA 4NUJB 1FO0H 5F7DB 3HR5A 3IFOA 3TO4B 3UTPD 4CNIB 4YQXL 1D9KA 1QLEL 4LVOB 2HT2C 3V52H 1NAMB 1AGFB 3DX8A 2EXYD 4KVNH 4QYOB 2YKLL 1KT2B 3X13A 1LEKB 1WJ3A 5DRZA 2J6EL 1A4JB 3UTSB 1GHFL 1LP9B 4CN4A 4I77L 1KBGL 4NO3A 1PY4A 3JWDL 4XNXH 4ZO6A 1C1EH 1OGAD 3DIFB 5E0QA 2D31A 3F12A 4QGTA 1T5XB 2XKSA 3LIZH 1XGUB 4S0TD 1DUZA 3O4LA 4RQQB 2PYFA 4NC2B 4OF7A 2FECL 2GKIA 3HA0A 1NGPL 5D93B 2OI9A 5EU4A 3EJZC 2D0GA 2IQAA 1GL4B 4JCMA 1K2DA 5FF6B 1U36A 2Q1EA 5C8JA 2VE6B 5IB2A 2HT2D 5GSVA 5KVGL 5TF0A 4NWUH 3BPCA 2YD2A 3A6CH 3HFML 5KSBA 3VRLE 1DEEA 1DVFD 2G60H 2HWZL 2Y07H 5L7XL 3RZCB 2R2EB 5IUSA 9CGTA 5J1AB 4PJCE 2K7QA 3QIUC 3MNZB 4U1NB 1S7TB 4M43L 1LDPH 4BH8A 3KNBA 1NGQH 1CFNB 1JHTB 1R5VA 2FYYB 1N64H 4HK3N 1FFPA 4KK6C 4Y4HB 4NUGL 1E4WL 3O6KL 1JMZA 3VH8A 2X9WA 3VMPA 3ZT5A 2I9TB 3BW9B 1IGFL 3PWPA 1A22B 2FB4H 1B2WH 3O6MH 4KHXL 2MQ0A 3W39A 2GJ6E 2EDOA 2X5PA 1YNKL 2XZQH 1BBJB 3AUVA 5B8CC 3AGVA 3WD5H 5L2KA 5DJZB 4ODSL 4JFFD 1OQOA 1IGTB 1CD8A 4IMKC 2QBWA 3WKML 4NHCL 1S7UB 2C7UB 3EO9H 4JAMA 5INCB 4UILL 1BREA 2EE3A 4G8FB 4PIRF 1OPGL 3MRFA 3O2DL 3LRSB 4M6OH 3T8XB 3IAPA 4MAUH 3IDMA 1BWWA 4YGAB 1U8PA 4HIIB 4YDKL 2ICEA 8FABA 2AEQH 1EA9C 1LO4L 4YE4L 4ZFFA 5TDOB 2MTPA 4XB7A 3S97C 2FO4B 1E4XH 2HJLA 3EYOB 3DARA 4BQBA 2VZOA 5JZ7C 1RJZA 1FGNH 1L0QA 4Z9KB 3DI3B 2NW3A 3LS5L 2OQJB 3IJSA 4HCRA 4WDIB 5F96L 4ALAH 3CSYA 2DQGL 3MLZH 2QKIA 2FBJL 5FA3A 3MQIA 4Y19B 2V9QA 5FYLL 1G9MC 1OSPL 4HGWB 3AXLB 2VDML 1T1YB 4DK6A 2ESVE 1T6VN 5CEYA 3O6LH 3NA9H 1TVBA 3OF6D 2X1WL 4P5KB 5DK0B 1NUNB 1CG9B 5DC9B 2C3GA 2WQ8A 3N85L 4PLJC 5B4MC 5I71C 3UTTB 3AY4C 3OAUH 4U7KA 4BFBD 2XWJB 5D4QA 3PDOB 4YXHL 3FO2A 5CCKH 1NANI 3FONB 5LGKA 4LDLB 2KZWA 3FQRA 1KV3A 2BVUA 1N5YL 1IQWL 3L1OH 4LPCA 4CRPA 2SEBA 2B1AL 32C2B 1DUYA 2NMSA 1KPVB 1W8OA 2GTWA 5HVHB 1S3KH 3EYFB 4J1UA 3B43A 3WFEH 3SDDB 2M26A 3VCLA 4OD1L 1D5ZA 4OLUL 5HDOA 3L3HA 4PJBB 1OTUC 1NBZA 1RIVH 4WWKD 4YUEL 1KNOB 2CK0L 4CVUA 4PRPB 3BGMB 3FZUD 4JRXA 4TUKH 3FAXA 4N0CA 5EU6D 3O3AA 4NQDD 2ENYA 5I73B 1QSEE 1FL3B 1WFNA 4KROC 4Z0BH 1PVHA 1P9MC 1X4XA 1H5BC 2ZPKL 3SO3C 4V2BA 1ZKAA 4PLJD 4LLYB 3QDMD 4JZNA 3OPZH 1EFXD 1YMMD 5CD3A 1NBVH 1TFHA 2HVKA 3TNNA 3D85B 5DT1L 3S37X 3NFNB 1QOKA 4JO1L 5F1KC 2NX5B 3MOAH 2VQ1B 1KTLB 4J12A 2VITA