3MRCA

Crystal structure of mhc class i hla-a2 molecule complexed with hcmv pp65-495-503 nonapeptide v6c variant
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Analysis of Relationships between Peptide/MHC Structural Features and Naive T Cell Frequency in Humans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 84
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mrcA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mrcA01
3V5DB 4ESKA 5LQBH 5T5FH 2R0ZH 1WT5A 3TWCL 1XGUB 1IQDB 3IJSA 3NTCH 4KJQC 5I1JH 1RAMA 4JDTH 1IM9D 2DM4A 1GGYA 4BQ9A 1U92B 4LSTL 4OJFL 2ZG1A 3VU2A 2HVJB 1N7MH 5K9JH 4PRDB 4AEHH 4ELME 4D9LH 1FC1A 1P4LA 3MTRA 5C0IB 2QHLA 2P44B 5IEHB 3U0TA 3IAPA 2C3VA 5A16A 3QNXA 4M7LH 1MFBH 4MX7B 3BEWA 1HCFX 2BSSB 1LHZA 1FNLA 1JRHI 3PWJA 4F7TA 3AB0C 3VGDA 1YMME 3HZMA 1C08B 3FL7A 2VLKB 2H1PL 3BAEL 4U6XB 5SV3A 1FFOB 5TGBA 5FECB 2VZ1A 3WO3B 3P2TA 4OCRL 1FJ1B 4D3CL 5IBUB 4P9ML 1ZGLB 1U0QA 1UZ6F 3BIBX 4KQ4L 2C1PB 4ODUB 1YN6A 1A6ZB 3QDJA 5HI4D 3TNNA 1DN0A 5BZDB 1F2QA 3OKNA 4R3SA 3TBTA 2DJUA 4CN1A 1ZWIB 4LVOB 1DN2A 2H1PH 4GG6F 3DETD 4GKSB 2AGJL 4XZUB 1AY1H 3PDOB 2PW1B 4Y8DC 4GG8B 2VDKL 3HNSH 2R69L 3DURB 4P9MH 1I7UA 3WJLC 1QQDA 1ADQA 1EO5A 3LKNA 5HDQH 5I8EB 4KK5C 4FTVD 3LVEA 5T1KB 1DQQB 3PIQB 1FP5A 3FHQA 2WP3O 3MBEC 1U42A 1B0GA 5IVNA 4EJ1C 1CQYA 2VABB 2YPVL 5E9DA 1WBXA 4XPFL 4L1HA 1KBGL 1IAMA 1PQZB 3PGDA 3RWCA 2AGJH 2R1YB 4KDTA 4Y8AA 4RMWA 3DV4A 3NGBB 1H15A 1S78C 2YD2A 3I9GL 4F37F 5D1XD 5DDHB 2VDKH 3OKKB 2R69H 5B3JE 1ES0A 4LL9A 1XH3A 4ZOCA 4PJIE 5IWLA 5EOTB 4HGKC 1KJ3H 1B0RA 2WINA 2HTKD 3MLXL 4JM4L 5FA4A 3MRQB 2N56A 1EEZB 3D0LB 2G75B 5EZIL 5DZOA 5K59F 4U6YA 2YPVH 4GBXB 4XPFH 4L8BB 4U2ZA 1KBGH 5I2IB 1EIBA 1PG7X 4IRZH 1M71A 5EC2A 1QOKA 2IALB 4IS6B 4FQ1L 4QOKD 5J1TC 1CL7I 3LIZH 4R0LA 5J12B 3L5JA 5CP3H 1AR1D 3ARDD 3IDXL 1Z3GH 5GGUA 1LE5B 1ZHLB 1OY3B 2EDNA 3QI9A 5ERWA 3T4YA 5GS0D 5DUBB 3MJ8A 4JM4H 4PY8J 1NLBL 1TTFA 3MFFB 1B2WL 5CSBA 1FBIH 3GJFA 3RTQC 5EZIH 1MFEL 4HH9A 5HGDA 2C1OB 2I25N 4ZO9A 4WI9A 3C5SA 3VFMA 2KPNA 1QSFD 5MEQB 4K3EL 2NLJB 1HZHL 2Q7YB 2FD6L 3W11C 4GG6B 1Y0LB 4KV5F 4CL7A 4PRHE 4M6MH 3IDXH 4RQQB 3W9EB 4JFXA 1H8OA 2C4XA 4JQIL 1H0DB 1KLUB 1V7NL 1NCUA 5F7YC 4UQ2B 2DM2A 1WZMA 5T5NG 1B2WH 3QFJA 4ELMA 1VFOA 1L0XA 1S9WB 1MFEH 4OV6F 5F6IC 1KT2A 1YC8A 2D9QB 3LAFA 4X99A 2ATPA 3MV8A 1CE1L 3X3GH 5D7LD 4LSSL 4JFDE 4YX2L 4PGCB 3QWOA 4XXDB 5C0BE 3GSOB 4AT6B 1YPZB 1HZHH 2GT9A 4HF5H 1QHPA 2YRPA 4DEPB 1A7PL 2JIXA 4EUPH 5KSAC 1BGXL 3I3DA 4HD9A 5ESVB 1YMMA 5D70H 1V3LA 4JQIH 1VEMA 3HC3H 1V7NH 2VERN 1WCBB 3ZT7A 3FCTB 1E6OL 3S96B 3WJLA 3VJ6B 4KROD 3QSKB 2F53D 2HFGL 1CE1H 1B6UA 3X3FL 4LSSH 4QRRE 2P45B 4YX2H 4LIQE 3HZKB 4ZDHA 4XGZB 4MCZA 3E3QE 1MY5A 3OAUH 2XZCH 3IDJA 3FT4A 3MGTB 1A7PH 1HXYB 1X5KA 1R24B 3HUJA 4M1DL 1BGXH 4Y5XB 2ZUYA 4NPYB 1T80A 3QHFL 4EDXB 1MHEA 5GJTH 2B5IC 4O02L 4XRCB 4JREC 1S7XB 4HLZH 1W0WB 1FYTE 3LD8B 3ARWA 5LAXB 3MRMB 4OZ4B 1CFSB 4X6DE 3X3FH 5A2KH 4QGTA 1GAFL 1QFPA 3FB6B 1I3VA 4OFYD 5FOBA 1KTRL 1KV3A 1MJJA 4X5XA 3ZDZF 1BZ9A 4GRWE 3QNZB 1U8OA 3VMOA 5AEAA 2MCG1 1KIRB 1MFDH 3E0GA 4GW1A 3RVTD 4DGVL 3PHQB 3M45A 3QHFH 4Z0BL 4BSWA 1Q0YL 3ZKXC 5D6DA 3BP5B 4O02H 2AK1L 3VXTA 3SDDB 1XT5A 3JWOL 4ZFOL 5ACLA 4BSVB 1LO5A 1HDMA 4E41E 4Z7QE 4PJIA 2P7TA 4NQCE 5EO1B 3NCCB 4RAVB 5GGRA 3PHOA 5C0FB 1XGTA 4DK6A 2FEEL 3PJSB 5DURD 3V5KA 5HYQA 4DFHA 3ULUE 4IRSB 4DKFL 1XIWB 4Q7DA 3U7YH 4I0PC 1F13A 1Q72H 4Z0BH 3EHBC 1J0HA 1PLGL 4RGND 4JM2A 2AK1H 2XZQL 1CGWA 1AXSA 3IJSB 4L4VE 3THMH 1IEHA 1YY8B 2P5EE 4K8RD 3T1WA 4UT6L 5TPWH 4TTDD 3VA2C 1IC1A 4OFVA 3KPLA 5HVHB 3ARED 5E4IA 3EGSA 1PLGH 3U0TB 2AJSL 2XZQH 5GIRA 2C3VB 3BH8A 3QNXB 5ESQA 3BEWB 3NZ8B 3D2UA 5IW3A 4MJIA 4N5EC 5I74B 4RAUA 3HZMB 2DQDL 3OR7A 3TA3A 5TGBB 1KCSL 4G6AD 4ZSOA 2M2DA 2V2WA 3B5GA 3G04A 3UXFA 1NEZA 2HFEA 3U4AA 1VFBB 3TZVC 2AJSH 2VITA 2P8LA 3QDJB 1DN0B 2X1OA 4S1DD 3D25A 3OKNB 4R3SB 3TBTB 3BN3B 1G1YA 1J5OL 2DQDH 4XWOC 2FL5A 1KCSH 3EO0A 1OAKL 5JW4M 2AEQL 4QRRA 4KFZC 1RULL 1I7UB 2CKBL 3MRBA 1QQDB 3E3QA 4NNXA 5F9JA 5E2UL 1GXEA 1X44A 5SWZD 3DIFB 3AMKA 4P9HL 2BOBA 4LAJH 3G5ZA 1TPXC 1T7ZA 1B0GB 5AAWA 3RNKA 3PXHA 1X5XA 3WN5A 3FOMB 3QEQD 5E9DB 1WBXB 1KCKA 2WK2A 2AQ3A 3L3DA 3PGDB 3RWCB 4PJBF 5I1CH 3DV4B 1T6WA 2AEQH 1H15B 2E6QA 4LGPB 4TYUA 4TTGA 4NQED 4RRPG 1RULH 1ES0B 1XH3B 2CKBH 2VDRH 3O2VH 2WINB 1B0RB 5E2UH 1JTTA 4MXVF 5F9AC 4OIBA 5KVFL 4P9HH 1KIQA 5FA4B 4Z0XA 1G84A 1AH1A 5DVMA 4Y19D 4J4PD 1FPTL 5IVXE 5KANI 4RX4A 4U6YB 5D2NE 5E7FA 4X9HA 3H7BA 1M71B 3V8OA 3FO1B 3BD4A 1OTUC 1RSFA 5C0RL 5I1HL 4R0LB 4I3RL 1IZJA 3TJHD 2W92A 5AWNL 4NQCA 5GGUB 5L9DL 1E6JL 3QI9B 3ARZA 5ERWB 1MRFL 3MJ8B 3MLYL 4Q6IC 5B8CA 1CF8H 5KVFH 3BQUA 3L5WA 2ZPKH 3GJFB 1JGDB 4HH9B 5HGDB 5I76A 3ULVF 3C5SB 4F8QA 3WBDA 1SYVA 4NCDA 4JN1L 4UIMA 2DN7A 5E2VL 4UAOB 4POUB 1INEH 4NNPL 4OCYL 5FM4A 4I3RH 5C9JB 5DR5H 4KKAD 5FYLE 4JFXB 1E6JH 2H26A 3ARGC 5D96C 5HYEA 4YWGL 4B7LA 3QDAA 1I1AC 3QFJB 1AP2A 4BH7B 4PS4L 4ELMB 5E6YA 1FL6A 4LRIA 1EEUA 1KT2B 1CICA 2ADJA 2E3VA 4HWEH 4X99B 2ATPB 3MV8B 3CH1B 2F58L 4R8WH 2AJ3A 2OTPA 3SE4C 3QA3A 5E2VH 3QWOB 1L6XA 2AK4D 1FZJA 1FCGA 4NNPH 2GT9B 2JIXB 3P9LB 3ILPA 2W1NA 8CGTA 1YMMB 1I85C 1A9EB 4R9HA 2VZSA 4YWGH 2BERA 1E28A 3CX5J 4AIOA 2PETA 2EE9A 1AR2A 4PS4H 3QDGE 3H3BC 5C0NC 2JJTC 3SKJL 1TVHA 3WEXA 4Z76A 1HWGB 2F58H 4S0TD 2FHCA 2YK1L 5EH1A 1EAPA 2HWZH 4ZDHB 3C2SA 4MCZB 3IDJB 4NQTA 3FT4B 3DTXA 3HUJB 2W9LA 3MUHL 3SDAD 1T03H 1MHEB 1JZ3A 3KYMA 2IQAA 2VJXA 3UZEA 3MJ7B 3KJ4B 1SY6L 1C1EL 3O9WA 3GK8L 4JRYA 1OGAE 3DUHA 1WAAE 1NGQL 2OJZL 4EN3C 1A7NL 5E1HB 5EBLA 3PGCA 2YK1H 3OB8A 1T22A 2MQ3A 1MJJB 4QXTA 3WS6A 4X5XB 1BZ9B 1U8OB 3GB7A 5IK3A 4GO6B 1XR9A 4GW1B 3MODH 1KCLA 5JW5A 3K8MA 3QISA 4BSWB 1N3NA 3VXPA 3VI4E 4NJAH 4V3DB 1JZ4A 1LO5B 1HDMB 1NGQH 2OJZH 1E4WH 3LN9A 3O8XA 4Z7UE 1VA9A 2KBGA 4PJIB 4JRXE 2P7TB 4TQEL 2WSKA 1CFVL 3E2HC 1GC1L 3VFVA 4OD3L 1H3TA 5GGRB 3EUUA 3PHOB 1U8MB 1XGTB 5E24E 2FSEA 5C2UB 5IVXA 5DWUL 3V5KB 4WFFE 5D2NA 3CSGA 2YOCA 3SDXE 5DFTA 5ECJE 4OZGF 1F8TH 2EE6A 5FYKU 2LAGB 3O4LD 3TN0A 3JWDC 4ZUVA 1MFAL 4JM2B 3UC0H 1ZT4A 4PJGE 5A2IH 1F4HA 2IAMD 4FQXC 1AXSB 4XC3H 5CEZL 2EYRA 1EUTA 4TQEH 1CFVH 1I1AA 2F8VA 4IEFB 3WIHA 4UB0L 1H5BC 1D5BA 2UZIL 5DWUH 2WBJA 1S9XB 3KPLB 3MOBL 1CU4H 5JLZA 3EGSB 1RJZA 1QYGL 2IMNA 1MFAH 4YE4L 4I18A 3I50H 3NH7L 1NBVL 3CFCL 5GIRB 5ESQB 4QYOA 2B1HL 3NCMA 4KRNA 3D2UB 3PWPE 1G7IA 2BDNH 3T1FA 1OB1A 1UM6H 4TUOA 1JMXA 1QACA 3RY5A 4MJIB 3KPQA 1BIIB 1LGVA 3RWEA 3TA3B 3OR7B 1RMFL 2UZIH 2BVTA 5F7KC 2ILLA 1KPRA 2HT3D 3WIIL 4ZSOB 3QRFM 3AMLA 2V2WB 2P49B 1BBJA 3G04B 3S6CA 3BN9C 4XVSL 1QYGH 2YPLE 4R26L 3LB6C 4G7YL 3NH7H 3QXAA 1QP1A 1WCQA 3CFCH 2P8LB 4MZ3A 3SBWC 1A3LL 4BQCA 1IARB 2GJ6E 1EERB 1EDQA 3D25B 3FFCA 1C5DA 3MRLA 4WUUE 2D0FA 4MD5A 1Y6KR 4NRYA 2OX5A 5C71A 3QDGA 1FVDA 3RUGF 4EBQL 3EO0B 2IWGA 2LU7A 2L7JA 5CEXA 3BZEA 4XVSH 4PJ9D 3RY4A 3MRBB 4R26H 2AP2A 4P3DA 2ICES 4NNXB 5F9JB 3MRIA 4G7YH 5IBLC 2XI9A 2BOBB 2FECI 4PJHA 3ZSTA 3G5ZB 3RNKB 1HN1A 3WN5B 4M4PA 2Z31D 3I3BA 1OGAA 1RZFL 1XCTA 1WAAA 4EBQH 3K81A 1OP5H 2B1AL 3RDTC 1K8IA 2PXYC 5MI0B 3UTTE 2MQCA 2V9TA 4M7ZB 1WTLA 1K5NA 1CDGA 2ZUUA 4GRWB 3DI2B 1A6VL 3IDYB 1RV6X 1KIQB 3QQ9C 5DT1H 4Z0XB 4GMSL 3IDUA 1EHNA 5I15L 4HDIA 4I3GA 2DBLH 4MAYD 4ORZC 5GGQL 4F8TA 4X7CC 2DI7A 2WQ8A 3H7BB 4L1DA 5IB4A 3LY6A 5B39G 1WVZA 3S35L 1CD1A 4HHAA 2RCSL 5BVJA 4KI5D 1NCBH 1Q0XL 1VDGA 2HN7B 1A6VH 5B8CB 3BQUB 2BXZA 3W2DH 5IJVA 4GMSH 2QADC 3L5WB 2NXYC 3SDXA 4Y16C 5JOPE 5SWSD 1P7QD 5T3XL 5I76B 3GSVA 1MWAA 5GGQH 2C4FU 1BOGB 1SYVB 3KXFE 4UIMB 4PJ8A 2DQFA 2NY6D 3GSWA 3S35H 1EFXA 4M61A 4MA3A 4RRPA 1I8LA 1CFQA 4HFWA 1EGJH 2ITDA 4OQTL 5JNYA 2P8PA 2VYRE 2H26B 5TF1L 1U8NA 3MCLL 2Q8AH 4GRLC 4URTB 1FC2D 4WWID 2Q3ZA 5H8DA 5DRNA 1AP2B 4CMHB 2QEJA 5L0QB 1IC4H 2ADJB 1CICB 4ZNEE 1G7LA 4X7EC 2NY1B 2C7UA 6FABH 2AJ3B 1IKFH 3QA3B 1Z0NA 1FZJB 2P43B 4EI6A 3PWPA 5M95B 3N06B 5HGGS 4B5EA 2DTMH 3ILPB 4PD4K 4HIHA 3O4OB 2D7QA 3ARSA 4KH2A 3MCLH 4UINL 4DFIA 1E28B 1G9MC 1PKQE 2MKLC 4HEME 3HG1D 4OLEA 3T0EE 4YC2C 3NA9L 3OL2A 4HW6A 3MUZ1 3WEXB 5KSVA 5IMMA 1SEQL 2FH8A 2EECA 4C59B 4WWKA 3MJ9H 1L7IL 2D0HA 4TUKL 4X9IA 5C09E 1QD0A 5KN5A 4ONHA 5HHMB 4J3XA 1A6TA 3IDMA 1TJHH 3DTXB 4JDVA 3LQZB 4JFQA 1G7MA 1NL0L 3MBXL 2PXYA 3KYMB 2IQAB 3OKEA 1HOCA 1K9TA 3O9WB 4JRYB 1U6AL 3NA9H 3UEZA 4X6CE 2Y36H 3T0EC 1SEQH 3M8OL 2HKHL 5I1LA 3IKCA 3QP3A 5EBLB 3PGCB 3FTGA 3D48R 4HUMB 1T22B 2EZ0C 4QXTB 1JFMA 3GB7B 5IK3B 1KN4H 4O4YL 4CU6A 1XR9B 5GHWL 4JGUA 1LP9E 3WMSA 3A6OA 1S7VA 5JW5B 1N3NB 4JPKL 3VXPB 4RMSA 4TUJA 4I9WE 3T2QA 3WLWC 3O8XB 5EDXA 4PFEA 2HKHH 2X42A 2DQJL 4JPIA 4ODXA 4U1LA 3VFVB 3VFTA 4HG4J 2JTDA 2APBA 5FYKL 1TJIL 5TQ2H 4K3DH 1F6AA 2FSEB 5IVXB 3X12A 4O4YH 4XNZC 5D2NB 3TVMD 1IGJB 5GHWH 4KTDL 3DX8B 4KV5E 3TN0B 1DQTA 2DQCH 4LVEA 2DIBA 4JPKH 4GAFB 4LLYA 4G8EA 4PLJC 4ZUVB 3LKSA 3SHSA 4KHTL 4WVRA 3UYRL 2EYRB 4OAWA 5CEZD 1D3CA 1A22B 3QXWA 1CGSH 3M1BA 1JPST 3QUYD 2HRPL 3GMNB 1KIPA 3ZDXF 2QLVB 1JNJA 3W5MA 1TJIH 1SVCP 1D5BB 2FYYA 5ADOL 2WBJB 1FAIL 4KTDH 3ESUF 4N8VB 4YO0B 4E5XA 5JLZB 3ALPA 1U8JB 1GCFA 1RJZB 1SYSB 5F71A 5CZXC 3SY0A 4Y5VC 1F42A 4I18B 3OXSA 4JE4B 4KHTH 1S7QB 3UYRH 4KAQL 5IB1A 3N1MC 1G7IB 3IDGA 1OB1B 4TUOB 2VMFA 2ZJSL 4JPVL 5BVPL 1YQ2A 2CDEB 3RWEB 2HH0L 1WWAX 3H6JA 3W0WE 2YD5A 1KPRB 5ADOH 4D94A 1FAIH 1OW0C 1BBJB 4Z7VF 4YEEA 4U33A 1FHGA 1QHOA 4L4TD 4XTRD 4PLKC 3VD7A 3QXAB 3KR3H 3KGRA 4KAQH 1BBDL 2WIMA 4KJPC 3RWFA 4G43A 3DJ9A 2B39A 3FFCB 1C5DB 3MRLB 2FX9L 3ALXA 1PKQA 2ZJSH 5JXED 4MD5B 5BVPH 3UZQA 2WLZA 5D1ZB 4NRYB 1IEAA 4TOYL 5I8OH 1VFAA 3T0EA 3QDGB 2FO4A 4WU5A 4PDCE 1FVDB 5F96L 1UM5L 3MMEB 5GGRY 3BZEB 2N1KA 5I1KL 4RMVA 3QPQD 2APXA 2G60L 5C09A 4S0SD 3U7AA 1ODAA 3MRIB 4YDIL 3EJJX 4PJHB 1EUUA 1GIGH 3FB8A 3K80A 3OHXA 2JKXA 1DVFD 3IYLW 3T0XA 2DKMA 3FHAA 4ZO6A 2FX9H 4NN7B 2K7PA 5HI3C 3GKWH 1OGAB 1U8PA 5HDOA 4X6CA 3FO2A 5F96H 1K8IB 1A5FH 1BVLA 1T2QH 4HULB 1Z5LA 1FV1A 5CUSL 1K5NB 4I13B 4QRTA 3WHE1 1G1CA 2G5BA 1U93A 5E4EB 4WHDA 4ZOAA 3ARFA 4U1SB 5IW6A 3TF7C 4K9EC 1LP9A 3GMLA 4M48H 3MV9D 4LFHG 3FOLA 4HDIB 5KS9F 1W0VA 1DQLL 4P2OB 2I60L 5IB4B 2OQJA 1ADQL 4K9EH 3WO4C 5EU4A 3CCHA 1MVFA 4LQFL 1G6RA 4NBZB 2K3TA 3LHPL 4XMPL 3BP6A 4HHAB 1A7BA 5BVJB 5CUSH 1ZTXL 4JFOA 4H1LG 2J5LB 3QWRD 1MI5E 1RVFL 2FEDC 5IJVB 4K07A 2Q87A 1HHKA 3SDXB 4R4FL 4CDHA 3GSVB 5T3XD 1MWAB 1DQLH 4YLQT 3M07A 4H8WL 4KMTL 4PJ8B 5C1MB 2DQFB 4LQFH 3GSWB 1EFXB 3LHPH 4M61B 2Y06H 4FABL 3D5OF 3QEHA 4HFWB 1KTKE 1LNUA 4P2QA 5IVZA 2ITDB 5JNYB 1ZTXH 2X1QA 2JELL 2P8PB 3TT3H 4EXPX 1U8NB 4MA1C 1QFWM 3MNZA 3WFHA 1JPGA 5DRNB 1NC2D 5GSVA 1DQMH 4OF7A 4R4FH 3PGFL 4MMZC 1VPOL 3TLRA 2A74B 2C7UB 1N8ZA 1S5HA 4P4KC 5SX5K 2QSCL 5B39A 4KMTH 5C0CA 4R97B 3MR9A 2YN3A 1WWWX 1DEDA 4GAYA 4P46D 1ZVSA 4R4NC 2W0LA 2D7MA 4FABH 3PWPB 5HHOA 2RGSA 3RA7L 2JELH 4HIHB 2Y6SC 1NSNL 4KK6C 4FQCL 1GGUA 4WW2A 4DW2L 3D9AL 5IG7A 3RVXD 5KSVB 1ZT7A 5IMMB 2VDOL 1K85A 4WWKB 2QSCH 4L9LA 5E08H 2V5SA 4XP6L 4XBEL 5GS1C 5KN5B 4HT1L 3QCVL 3SGDI 3GJFH 1A6TB 3IDMB 4HV8A 4PJ5D 2BHUA 4JDVB 4PJBE 4P5TD 1WFUA 5EOCL 1G7MB 1NSNH 4HJ0C 4LCYA 5FDWA 1JRHL 3OKEB 1PZUB 3AS2A 4LSPL 4W70A 1OGTA 1HOCB 4DW2H 5T3ZH 3OAZK 3D9AH 5JW4N 5DZLA 2VDOH 3P4MA 2FZ3A 1N64L 4H26A 2G2RA 3LPWA 1LDSA 1X9QA 3IKCB 2EEAA 5JHDE 3EYSL 3FTGB 4XP6H 4XBEH 3QO0A 32C2A 3V9FA 2FDBP 2BVQA 4HT1H 3CU7A 3QCVH 3VE0A 2XKUA 4JG1L 2YPKA 2CLZA 1UWXK 4GQPH 1JHTA 1NCCL 2X10A 3L3GA 4C56E 2BOCA 4HKXA 2ESVE 1S7VB 4HH8A 4KHXH 4LSPH 4JG0L 5IT2H 5HYJE 3OZ9H 4TUJB 4YR6A 1QZ1A 3L3OA 1P7KA 1W8NA 4E42A 2CO6B 1N64H 2YMXL 5IBTL 4JPIB 1AFVH 4ODXB 4C4KO 3ULVE 5MEND 4U1LB 3VFTB 4OKDA 2E9JA 4HMEA 1F6AB 5FYKD 2ARWA 1KOAA 4JG1H 4J7RA 4OFPA 5EC1A 3X12B 1KUMA 2AXHA 1B88A 4LK4A 2BY0A 3CXDH 4EIZC 3MCG1 3Q5OA 5HHVH 4XPBL 1P4BL 4LLYB 4G8EB 2XIDA 1I8KA 1T66C 2DQTL 3FAXA 4M1CC 1JI2A 3VG0H 4RFNB 1I4FB 2VDML 4OAWB 2BMKB 2X41A 3UJIL 5K9QG 3EYOA 4P23D 5IBTH 3LH2L 2WZPD 1KIPB 3ULVC 3HI6L 1D9KD 1FZOA 1UJ3C 3FRPG 3RZCB 2FYYB 1WF5A 5D7IF 3WE6A 4E5XB 3K2MC 4BZYA 1I1FA 3SY0B 3DBXA 1P4BH 2YD6A 3VWKB 2UZXB 2L4OA 4BK4A 3OXSB 3V4UL 2VDMH 5IB1B 1QLRA 3KPNA 4YBLB 2CQVA 3BX7C 3IDGB 3ISWA 3LH2H 5KAQG 5JUEL 3HI6H 3OR6A 3OX8A 4OCMC 3BKCL 1NKRA 4F15C 3U1SL 4F7EA 5E6ID 1VSCA 5BV7C 1SBSL 1FH5L 2P5WE 2GY7B 4PTTA 4XAWL 3D6GA 1UGNA 2A9NL 5DQJA 4RIRA 4WUKH 2NX5D 1T5XA 1CTOA 5FYJH 1KN2L 1IAIM 4WV1A 4APQA 2CXGA 5D71L 4G43B 5I71C 4I0CC 4D9RE 3WSQL 3UTSD 4ZD3L 1IEAB 3HHRB 3IFPA 2F8OA 3BKCH 2FO4B 1DSFL 2X4NA 4LSVL 4WU5B 3U1SH 3VXMA 4WY7L 1SBSH 4KK9C 1FH5H 4AK1A 1X5YA 5J56B 1DTUA 2DMKA 4XAWH 2D3VA 4Z7WA 3GNML 3GSRA 3ORJA 2QSVA 3VXUB 2P24A 1E4XI 2GITB 1KN2H 2AV7A 2ZP0T 3GSNA 4FFEX 3FB8B 4W4OC 5FM8A 4ZXBD 4G9FE 1JZ2A 4K71C 3WSQH 5H35A 4ZD3H 2ED9A 3A67L 4JKKA 5HVGB 2OZ4A 5SX5H 1U8PB 4LSVH 1NDGA 4X6CB 2OCFD 3FO2B 5E7BA 5GS2D 1QG3A 1BVLB 3CFKA 3PNWA 4Y4HA 4GSDH 1FV1B 3DSFL 5I75B 3EDJA 4OZGE 3GNMH 3HE6C 4RMTA 5IMOA 3RZWA 4QRTB 4PB9L 2AI0L 3HNVH 4MNQD 2G5BB 3SCMA 1U93B 5KTEL 3VD9A 3ARFB 4YBQD 1LK2A 1LP9B 3GMLB 4KTEL 2PUQT 2ID5A 3IT8D 4UBDD 3RX8A 1OTSC 4LIQL 1W0VB 5HYJA 5ID0A 4WHYG 2OQJB 3CCHB 4Z6AT 4KDWA 2DQIL 1U36A 3BP6B 3LS4L 2X05A 5EIIB 1G9EA 3EBAA 3DSFH 4XI5C 4JFOB 4PB9H 5KTEH 5EOQL 1OHQA 3QUXC 3F8UB 3N1QC 4OKVA 1FL5A 6CGTA 4G59A 1HHKB 3UTQA 4HIEA 4KTEH 2YSSA 1TJGL 3T3PF 4UILL 2V2TA 1YJDL 4IRJC 1D6EA 4PJEE 3MV7D 1F6LL 3TCXA 3GHEH 2DQIH 4A2LA 1CVSC 5AZEL 3QEHB 4KKBC 4P2QB 4YXKL 5IVZB 5GS3A 5F1IA 3C60D 3IJYA 1UWXH 5EOQH 1ZMYA 2Q6WA 4KZDL 4XNXH 1O7VA 3MNZB 3WNMA 4HPOL 4OLWL 1JPGB 4KJQD 2EDHA 1Z6JT 4GAJH 5GSVB 4NQDA 1AD0A 4UILH 5CSZA 3NCJL 1UKSA 1YJDH 4XBGB 1DBJH 5DUMH 1N8ZB 1S5HB 5C0CB 5FGBC 5B39B 1J9CT 1MCBA 5E2JA 4KRMB 1HHGA 4QHNA 4GAYB 4NUJA 1DUYA 5AZEH 3ULUL 1MY7A 3RUGE 3S88L 2DRUA 1KCUL 3ZDYF 5HHOB 2BJMH 2V7HA 4KZDH 4Y89A 5K9QI 1BD2A 4HPOH 3OB0K 4RISL 4WW2B 5GXBB 2UWEA 5IG7B 5DRXA 3H9SD 1ZT7B 1IEBA 1O7SA 5ADPL 3RIFF 3NCJH 5CP7A 5EWIL 4X5LA 3BSZL 4X4YA 4LNVA 2OI9C 4L9LB 3EOYG 1LDPL 1Q8MA 3ZE1F 5IGXH 1NBYA 3ULUH 2ED7A 3C8HA 4HV8B 5I66B 4G3YL 3S88H 1KCUH 1K4CA 1FGNH 4LCYB 1B4JH 5ELIA 5FDWB 5F6HJ 3REVA 4GQ9H 4JY6B 4BM7A 1OGTB 2JCCE 4RISH 3O6FC 5LVEA 2XQYG 1IVLA 1K8DA 4LHUB 1DDHB 3P4MB 3PQYD 5ADPH 2FZ3B 2JIXD 4H26B 1OD9A 2G2RB 5EWIH 3BSZH 5I1EL 1LDPH 2I9LA 2VWEE 3QO0B 32C2B 4P49A 4G9FA 1HSAA 4UUJA 2F19H 2YPKB 2CLZB 4LKCA 4G3YH 1DQDL 1UB5A 1BFVH 1JHTB 5IB3B 1DANT 3EYUH 2BOCB 4HKXB 2JB6A 5DEZA 4KK5D 3AUVA 2B7DT 3X17A 3UDWC 3MBED 4YR6B 1Q9WB 1H3VA 3L3OB 4MB3A 1P7KB 2X9YA 1V05A 1WWBX 3TBWA 2V9RA 3UBXG 4E42B 2VLJE 2X4RB 2EIEA 4HUXA 4OF6A 5I1EH 2NY0B 4GS7B 1J18A 2VWEC 5EC1B 1S78D 5SX4I 3LEYL 2MKWA 1DQDH 3M17B 2ZOLA 5DK3A 2G5RA 4G8IA 4LGSB 1I8KB 3QDHA 2XZAH 3X13A 4QOKE 4RFOL 1IGIL 3FRUA 3EYOB 4L3AA 3NIFF 4RBPK 2OTUA 5CEYA 1TCMA 1X6LA 1KGCE 5F93C 1FZOB 3LEYH 2VLME 3WE6B 4PJEA 1VESA 3S97C 3MX0A 1NAMA 1Q94A 1QSFE 3DBXB 1E4KC 5CINH 3GMMA 3RTQD 1HNFA 1IGIH 1IM9A 1QLRB 3KPNB 4MNGB 5E5MA 4HUKB 3UAJC 3ROLA 5C07D 3WHXB 3R8QA 1ZLSL 3ZO0A 3OX8B 3W11D 2KZWA 2R29L 4F7EB 2J88L 3B83A 2CGRL 2EH8L 4PTTB 2OP4L 4UV4L 1D5XA 2FLBT 2WAHA 1UB6A 4RIRB 1T5XB 2E8ZA 1P6FA 3WIHL 1ACYL 4WV1B 2E27L 2XTJE 4APQB 3MUJA 3BPOB 5FEBA 3WDHA 1UKTA 2YA2A 1TZGL 3BPLB 5E03A 2X1PA 2OXGA 5GSRA 4ONFH 3O6FA 1NCAL 3FRPA 2X4NB 5DJDA 2R29H 5KSAD 3VXMB 3DUSA 3DNKA 4M7LT 2DS4A 1SMAA 2J88H 2CGRH 2EH8H 2F53E 4PRHD 2OP4H 5KVDL 4Z7WB 1GYAA 3GSRB 4IJ3B 2P24B 2P48B 3WIHH 3LKPA 1ACYH 2E27H 3GSNB 3R1GL 1YNKH 4KUZL 2XTJC 4KRLB 1EZVY 1EEYA 5INCA 2BVOA 4JFDD 2X9WA 2JCCA 1KJ2A 3UJTL 1NCAH 1QSED 35C8L 5C0BD 1NDGB 4IOIA 4PJCF 5DD0H 4NBXB 3CFKB 3PNWB 4Y4HB 5IMOB 2EC9U 5CGYC 5DFVC 3SCMB 1PX4A 4FTVA 5LBSL 4ZYKA 4QXWA 4A2MA 1T21A 3O3DB 2BXYA 1XMWA 1LK2B 3R1GH 1NANH 4KUZH 5D7KE 1MHPH 3VXQA 4U1IA 4Z95L 3B2VL 3IFOB 3O2DA 4QRRD 5FF6A 4PJ7F 2Q8BL 3UJTH 2BSTA 4YHLL 1NUGA 2OK0L 3ERYA 2MMXA 4HCRH 2VLJA 1B6DA 3G6AA 3TO4C 1JNLL 1KXTB 2R15A 4JKMA 1IL1A 2R1XA 4JAMA 4OKVB 2NTFB 1FL5B 4P3WA 4G8FA 3SDCC 4OCXL 1AGBA 3R0NA 1FYTD 4TVPE 3UTQB 4HIEB 2A83A 2YSSB 4ZMAT 4Z95H 4FFWC 2W38A 3B2VH 2D03L 2V2TB 4NO3A 4O2EA 1D6EB 3WXVL 1S9VA 2V17H 4YHLH 3FN0L 5BOZG 4RGNE 4QOKA 2F15A 4XCYA 4NQUA 2OK0H 3P9WB 5DA4A 5GZOC 5JQHC 4I0PD 3ARDA 3JWDL 4QXGL 1MCPL 3EHBD 5F1IB 3IJYB 2KUTA 4WU7A 4Z7VE 3Q0HA 2VSDA 1S7SA 5T1MA 1XGRB 3UBXI 4DKAA 1MJ7L 4F58L 2O5YH 4OCXH 4KQ3H 2FHFA 3VRLE 1ZE3C 4E41D 4NQDB 1AD0B 1QSFA 4NQCD 1QPPA 1C12A 3O41A 4K7PX 3WXVH 3WCYA 3BRGC 3GMQA 4QHNB 1BLNA 4NUJB 1DUYB 4KJWC 1J11A 1YECL 1MCPH 4PY7B 5EUOF 3MLVL 1MWAL 2V7HB 5HHNA 4J3UA 3T0WA 4U3CA 1TQBC 1EX0A 1JZ5A 1BD2B 4FHBD 4Y1AB 4F58H 2XKNA 2QQNH 2UWEB 3SGKC 4M9OA 4MNHA 5DRXB 3AAZB 4L4VD 1IEBB 4N5ED 1J8HE 3U83A 5FO7A 2A2QT 4OCWL 5CP7B 2P5ED 3NIGF 2HVKA 4CKVX 5LWYH 4H0HB 5J57B 4HIJA 4PJ7B 1CLOL 2VN4A 2AEIT 2AEPL 4HX1B 4XB8A 2W59A 1H8SA 4XVJL 2VXQH 3HMXA 2BNQB 3TZVD 1MWAH 3BDYL 1CN4A 3F6IA 3REVB 4Z7OE 2DLFL 4DZ8A 2F53A 1K8DB 4I3SL 1RU9L 5HHQA 3G6JF 3B9DA 3MXWL 4XWOD 2I9LB 1KFAL 5DJZA 1CLOH 3U9UA 2ATKA 3SOBL 1X3DA 2AEPH 1U8LA 5SWZE 4G9FB 1HSAB 4XMKL 4UUJB 3KPOA 4LKCB 4XVJH 1UB5B 3HPJA 5F44A 5F7EL 1MHCA 4S1SL 1FNSL 2JB6B 5D1QC 5GQBA 2WBKA 4RGMC 2GW5A 5DJ8A 2XA8H 2DLFH 1T1XA 1DBAL 3L95A 1BQHG 5H94A 2NY4C 1TENA 1RU9H 3TBWB 4YXLH 2DTSA 5DRWA 4OFYA 3VH8G 3OKMA 4HUXB 1MCKA 2FBJL 2C9AA 1OM3L 3BOVA 3O9WD 4M5YH 1CXHA 2FECL 5F7EH 3PWLA 4S1SH 1FNSH 2ZOLB 2R4SL 4CRPA 4FQLL 3X13B 4MDIA 2PF6A 2ICEA 5KSBF 1WUNT 3FRUB 2O26U 4XCEA 2F8XC 1BREA 3BKYL 5TH2A 4WO4C 1CFTA 1OTUD 2OTUB 5CEYB 5IMLA 4QHKJ 5ENWA 4HPYL 1OM3H 4BFBD 4HS6A 3LCYA 2F54E 5DK2A 3NCBB 5IHLB 4PJEB 4POYA 1KC5H 5EBGA 1Q94B 3WUWG 5ICYB 4YHKL 5KSUA 2YUWA 4G6KL 1IGTA 4UOW0 3GMMB 3CMGA 3DV6A 1BQUA 4LQ1A 1IM9B 5TDOB 3RWDA 3VGBA 5E5MB 1KPUA 4TNVF 3ROLB 2Y25A 4C58B 1EO8L 2QKIA 3BUTA 4U0QB 4ZQKA 4FRWA 3AREA 4N1HB 2BNRE 3OJ2C 3ARGD 3OJVC 4FFZL 2KH2B 3S7GA 1D5XB 1XF3A 1UB6B 3NFSL 4YHKH 1I1AD 3UPRA 1BFSA 4U1GB 1MCWM 3Q1SL 4JY4A 4HUNB 5JXAL 3KDMA 1FL3A 5GSRB 5E5RB 1EO8H 5DJDB 1EAJA 3DUSB 4X80L 3VWJC 5C7XH 1ZHBA 3A6CL 5TE6L 2VXTL 5LG1A 3DRTA 4FFZH 5FYLD 4JO1L 1BWMA 2CIIA 3DXAE 3NFSH 2LABA 3QXVA 3LKPB 1DBBH 1L6ZA 1G7PB 3E8UH 5C0ND 3FONA 4P0DA 4NYLA 3V4VH 5L8JB 3Q1SH 1QFOA 1B3JA 3UYOD 1EEYB 5KSBB 5JXAH 4EQ3A 1KXQE 4HWUA 5E94A 5INCB 2BVOB 2R23A 4RMRA 1F2XK 2JCCB 1KJ2B 4LP4A 4XAKE 1NMCC 3O3EA 4I1NB 4QT5A 4ERSH 1CXEA 4XPGL 4MVBC 4X80H 2DDQL 4IOIB 3A6CH 5TE6H 4B0MM 4X7TA 3C5ZC 2YD8A 3ARBC 3BT2L 4JO1H 4ZPVA 1RZGA 3KS0H 4N8PA 4WIQA 2X40A 4FTVB 5SWZA 2ERJC 1T21B 1UT9A 4EN3D 2ORBL 3VXQB 3QEQA 4U1IB 4ZTOL 2Y1VA 2C3GA 1OAXL 3H9YA 5FF6B 4HQQL 4MHHI 5J13B 2BSTB 4ZFGL 4QXUL 3ARUA 4XPGH 4K94C 2QQKH 2DDQH 1ITBB 5D1XB 4NQEA 5DHVB 1T83A 2FBOJ 3G6AB 1GL4B 2BZDA 4H20H 4H25A 2GFBA 2VE6A 1FGVH 4HBCH 4WCYL 4Q97A 4K94H 3L9RA 1IL1B 2R1XB 4JAMB 4NWUH 4Y88A 4G8FB 5JIHA 1AGBB 4P57B 4Y19A 4J4PA 2ORBH 3IS0X 2A83B 1OF2A 3PHSA 1OAXH 5FUOH 4MWFB 4NO3B 4HQQH 4O2EB 4QCIA 3VGEA 1S9VB 2FIRT 3CK0L 4ZFGH 4QXUH 4QOKB 4OZFG 4XCYB 5C0EA 2EKSA 2DWDA 3TJHA 1U3HC 2ZUQB 3RIFK 3ARDB 4XX1G 2NXZC 1EXUA 3CGTA 3GGWA 1F3DH 4WCYH 1A64A 4WU7B 1S7SB 5T1MB 4NZRL 4FQXD 3WFCL 5L6YL 1G6RL 3HFML 4JVWA 1T6VN 4DGIL 4BQBA 1T0PB 1K4DA 4JRXD 3WL9A 1QSFB 1OAQL 5J3HC 4LRNH 1C12B 3O41B 1IGFL 3BKMH 3CK0H 1UACL 4DAGL 3GMQB 3HRZA 1XGYL 1BLNB 5J11B 5D72L 2PCPA 4K23L 5B22A 1KNOA 2RB8A 1ETZA 1X5AA 1S9YA 3MYZA 5HHNB 4G6JL 4NZRH 4U7SA 1BF8A 2XKNB 1U95A 4DGIH 5D7LB 4QY8A 5FO7B 4JRWA 4J12A 4JHZA 2HVKB 1IGFH 5AUMA 5IJKA 1MELA 1UACH 3KYKL 4HIJB 2AK4A 4DAGH 4CGTA 4ZS6C 3QHZH 1QFWI 4PJDF 5D5MA 4K23H 3BN9D 3RY6A 4DVBA 2JK5A 4TSAH 5EN2A 4G6JH 4OGYL 1YEHL 3LB6D 1A21A 3HC0B 5E2TL 3C5ZA 4OZIF 4P2RE 5TDPA 2Y4SA 4KROB 4ODWA 4DZ8B 2F53B 2BNUA 1MAJA 1I1RA 3DXAA 4G42A 3TGXA 2P8MA 5ICZA 3TEUA 3UPCA 3ROOA 3KYKH 5IEKA 5DJZB 3U9UB 2ATKB 2NPLX 1U8LB 1W72A 3QT2A 1XEDA 3KPOB 1KYOJ 2VXSL 3WNNA 2D7PA 3H3PL 3SDAA 3HPJB 1OCWH 4OGYH 1YEHH 2YPLD 5E2TH 5IBLD 3VDAA 1FORL 2AS5M 5DJ8B 1A9BA 3MZTA 4KY1L 1MIML 1T1XB 3L95B 5H94B 3D3VD 1VENA 4JCMA 2GJ6D 1I8IA 5FB8A 4H0GA 4O2FA 5DRZA 1CXIA 5DRWB 4O2CA 4WUUD 2VQ1A 3OKMB 3TBYA 3T3PE 1GGCH 3T08A 1A1MA 4UT7H 1OT1A 3T3ME 3RDTD 1W2KT 2PXYD 3ARQA 3BXNB 4OB5H 3ZYZA 5IFAL 3MLSL 5J89A 3IU3A 3BP7A 4WI3A 5IHBA 3PWLB 1FORH 3QQ9D 2EDQA 5F3HA 2AW2A 3B8SA 1MIMH 1F6FB 3OGOE 1CDHA 4MDIB 2C3HA 3IJHA 2ICEB 5EORL 4JO3H 3ZE0E 4M7KH 1OQXA 1HXMA 4XCEB 1TQCC 3MA9L 5TH2B 4LVHC 1CFTB 2YC1A 4TNWF 5IMLB 5ENWB 3RX5A 2R1WA 1T20A 1YEIL 5DURB 4JKWA 4HS6B 2WBWB 1MJ8L 3ZL4H 5DK2B 3UTTD 1A6PA 1XGQA 3O6LL 3ZDYE 4RGNB 1CZ8L 1BQHA 3CVIL 4RMQA 3FT2A 4CMMA 2QADD 3QJFA 2NXYD 4Y16D 3U30B 1IGTB 2IAMA 3KS0J 5A43C 1CGXA 5DI8A 4Q9RL 4YJZL 3JZ7A 1NJ9A 3VH8A 5EORH 2QSTA 3RWDB 3DMMC 3MA9H 1KPUB 1LILA 4FXLA 3EYQC 1K3ZA 4JQVC 3N1GC 3SE3A 1YEIH 4XNQA 4ZQKB 4P4RA 1MJ8H 4XT1C 5FOJA 3AREB 3OPZL 3O6LH 5DFWH 5I8CA 5ACZA 1BJ8A 1XF3B 1CZ8H 4GRLD 3CVIH 2ZOKB 3UPRB 4Q6YA 2YD3A 3OJDA 4QRQA 1EVTC 4Q9RH 3NMEA 5BMFH 5D93B 4JY4B 3KDMB 4ZPTA 3KXFD 4YHYB 2ZCKH 4G7VH 2WY3A 3MRPA 3HR6A 1JGVL 1ZHBB 3OPZH 3CXHK 3MRDA 2UUDK 4RNRA 3DRTB 2IMMA 3WUWA 3QDME 1UXSA 1F3DJ 5DLML 4F7PA 1MCSA 3RGVC 4HWNA 3FONB 2VQUA 1KCRH 3IXAA 2YA1A 3C2AH 1DLFH 3ETBF 1M6OA 4U7KA 5E94B 3DYPA 2R23B 5C6PB 2VL4A 3C6SA 3MRHA 4P2RA 4AZ8A 2R56L 1QTYT 4QT5B 3VGAC 3TFKC 4OZHE 1E4JA 5EU6E 3NOIA 1JGVH 1IM3A 1QRKA 1H3PL 4X7TB 3L3KA 4PJ9A 3L7EA 5HY9A 3PXJA 4ZPVB 2YZ1A 5SWZB 1D6VL 2BK8A 4X9GA 3T0ED 1RIHL 3BMVA 3QEQB 3O0RH 4M43H 4ZTPL 2EZ0D 5CILL 2Z31A 3HI5L 5C09D 3NIFE 2JE8A 4PGBB 2CR3A 4YH6A 3SKMA 3GSNL 1OSPL 1FSKC 1H3PH 4NQEB 3TT1H 1PSKL 2YEZA 1ZANL 2GFBB 4H25B 4FZEL 2AVGA 2VE6B 1PG7W 3L9RB 5FK9A 4BYHA 1DL7L 4Z77A 1D6VH 2OZ4L 2VRAA 3WLWD 4TRPL 1RIHH 4Y19B 3KVQA 3UP1A 2WIIB 1OF2B 4MAYA 4ZTPH 4V1DD 4Q9CA 3QUMA 2JB5L 2V6HA 4NOBA 3HI5H 2H32A 3B6SA 4I8DA 1QO3A 4JZJA 3DMMA 5C0EB 2DWDB 3GSNH 1CWVA 3ARRA 3E6HA 4JFZL 1EXUB 1ZANH 3GGWB 2VLRE 4FZEH 4PLJD 3U36A 1TETH 1WZKA 3HAEG 2NY7L 4PYHA 2VISB 1P7QA 4TRPH 4L29A 1JTOA 2ZUSA 5D7JC 2X1WL 5CIPA 1K4DB 1ZOXA 3QJHA 5CZVH 2JB5H 1X5JA 3QAZB 3CUPA 3HRZB 3JVGA 3L6FA 2PCPB 3K0WA 4YDKL 1KNOB 3EYVA 1ETZB 5CZXD 1IAOB 1S9YB 3CVHA 4ODVH 4L3CA 1IC5L 5IMKA 3HR5A 1V5JA 1YYML 2NY7H 2X70A 3RNQA 4IIQC 3FT3A 1U95B 4FQ2L 5D6CA 4U1NA 4CVXA 2EDRA 1C8PA 4LDLB 5JA9A 3AM8A 3WNOA 2XPGA 1KEMH 3RGVA 4GXVH 3GBNH 5KZCD 1G7HB 4OZFA 3TJEL 4L4TE 5AUMB 1RJCA 2AK4B 3QYCA 1A3QA 5H37G 1RZJL 5D5MB 1XAUA 2DBJA 4YDKH 3QBTB 4KGJA 4DVBB 2JK5B 1FVEA 5J8OA 1MIEL 2DLIA 4PLKD 5EN2B 2ZUTA 3GIZH 1AGEB 1I1YA 1IC5H 2CRZA 4DGYH 4HZAA 3QIUC 3HG1A 4KK8C 1YYMH 1AD9A 4KJPD 5TDPB 2BY3A 2ICWI 4FQ2H 4XWGL 1GPOL 1QBAA 2BNUB 1FNHA 2NY5C 3U7WL 4G42B 3BP4A 3IAGC 2P8MB 5ICZB 5CJQL 2R9HC 3ROOB 3L5HA 5IEKB 3SO3C 4WI7A 5I17A 3IXTB 3RKPA 2AJZB 1W72B 5F7WC 3W0WD 1RZJH 4S1RL 1U2CA 2NY3C 3SDAB 2GUOA 2HFTA 1MIEH 1WICA 1NAKH 1NGPH 1TIUA 4LVNC 1BX2A 4OZHA 3MRKA 1A9BB 4NO0D 4HS8L 4KVNL 4FQJL 1I8IB 3JV4A 4XWGH 1L4IA 1WIOA 2QV2A 3U7WH 3WS3B 1PG7L 5DRZB 4NGHL 4O2CB 1YYLL 5HI3D 2VQ1B 4A6YA 1A2YA 4GMTH 3TBYB 3F5WA 3H9HA 3T4AA 2K9UA 2W9DL 1A1MB 2W65B 3CLFH 4S1RH 1MEXH 1E4XL 3IU3B 3BP7B 3NIDF 3MV9E 4LU5L 2R0KL 5BO1L 5L8LB 4TNVK 2ENYA 1LEIA 1TZHA 2OLDA 5L2KE 2UUDH 1WBYA 5F3HB 2VZTA 4E9LA 4FQJH 3BRDA 2EKJA 3FQUA 1M05A 3D0VA 3QUZC 2X1XR 1RUAL 3IJHB 4NN5C 1PG7H 4OI8A 1YYLH 1HXMB 2GK2A 3O11B 5DK0A 2QR0A 2O61A 1DLHA 2W9DH 1KENL 3ARVA 2R1WB 1T20B 4XNMB 4J3OC 5E2WL 4RZCA 3TVMA 3HZYA 1E4XH 4YFDB 3W39B 5GRVL 4XXCC 4LU5H 2EH7L 5BO1H 1XGQB 3O4LB 1GGTA 1LK3L 2FEDD 2Q76A 5EUOE 5H2BA 1BQHB 3FT2B 3QJFB 3VG9C 3B8YA 1P2CB 2IAMB 3LQAC 3MYJA 3WHE0 4I2XA 4YDLC 1RUAH 1RZ8A 3KPSE 1NJ9B 3VH8B 3FQNA 2VLRA 1REIA 3QUYA 4FG6C 4IMLA 4F57L 3MJ6A 3NIGE 1KENH 4KZEH 5I0DA 4W6YB 5E2WH 1RUMH 4XNQB 4P4RB 4ZAKC 4Z9KB 2EH7H 3SQOH 1Q9OA 5TF0A 4LLQA 5B21A 5I8CB 2MPAL 1LK3H 2E7BA 5ACZB 2A6KA 2PR4H 1JHKL 2QBWA 3UCRA 1MI5D 1UFUA 2CRMA 2V2XB 3RU8L 1HILA 3OJDB 4QRQB 3MRNA 5F21B 1INQA 3WD5L 3QIUA 4P4KD 1U2HA 1G7JA 4F57H 3RWGA 2VR4A 4KWUA 4GLRH 3BIKA 4ZPTB 1NAML 5F9WB 4R4ND 5FM5O 4IM8A 1I9EA 5L2JA 1XF4A 4DN4L 3MRPB 1LVEA 3MPCA 3W5NA 2EDLA 3JV6A 2Y6SD 3MRDB 4RNRB 4KK6D 3WUWB 4L4TA 1FRGL 2MPAH 1UXSB 2YR3A 1JHKH 2WNGA 5EU3B 4CU8A 2E9BA 5BW7A 1UZ8A 4F7PB 1DP0A 2H45A 2CUHA 4YXHL 4WHTA 2OL3H 3IXAB 5TDNB 4PP8C 4HUUA 4PJ5E 5JXEA 4D2NA 1FO0A 3L1OL 1M6OB 3KPMA 4MDJA 3C6SB 3GMRB 3MRHB 1I75A 3N9GL 1HKLL 4PBVC 1IM3B 2MCPL 3Q6GL 3L3KB 4PJ9B 3L7EB 4HJ0D 1KG0A 4KGLA 1FRGH 2Q86A 4BH8B 2YD4A 4PGZA 5MP6L 4K2UL 4K7FA 4XPHH 3V0VA 1DVFA 1DBKL 1HYRC 1JV5A 3R8BB 5F7DA 2Z31B 1D5IL 1ZSDA 3WKNA 3TIDB 4XP4L 4DZBA 2DKSA 2X7LA 7CGTA 1B90A 3SKMB 4X8XA 4P3CL 3Q6GH 1ZLVH 2IC2A 3VMNA 5ISZE 1PEZA 1NCNA 1KJ2L 2CXKA 3LZFH 5CJXC 4M02A 5FK9B 1G9NC 4Z77B 5MP6H 2XQBH 3MV9A 1UA6L 1N6VA 1DBKH 1CG9A 4MAYB 5BZWA 5B4MC 3QUMB 5JHDD 1NFKA 3A0OA 2H32B 3WUZA 4D0BB 3GSQA 4JZJB 1QO3B 4NKQB 4U4BA 5EIQA 5DYOA 3IRZA 5D2LE 2UYLA 5E00A 4X4ZA 1YEKH 4P3CH 2ICCA 1Q1JH 3B2UC 3EAKA 1NEUA 3E6HB 1FVCA 2WUBL 3SGEI 3O2DL 4C56D 2ESVD 3QWRA 3MCKA 3U36B 1T66D 1KJ2H 3LDBC 4M1CD 1Z9SA 1P9MC 1S7UA 5HYJD 3RJDA 1I7TA 4OSUL 5SWSB 1OWWA 1P7QB 1IILE 4L29B 2D7TH 1UA6H 2E7CA 3RIAK 2N4IA 3QNYA 5CIPB 3QJHB 4AG4L 3ULVD 4LNRA 1R5IA 1JK8A 2NY6B 3TBSA 3CUPB 4WHCA 1C5CL 1XFPA 3L6FB 4EI5C 1KXVC 1BECA 1U3JA 1T2JA 4N8CL 2WUBH 5L8KB 3O2DH 3CVHB 4L3CB 5IMKB 5F88A 3WFEL 3HR5B 4I5BA 3I84A 1QBMH 2NMSA 4OSUH 1JGUL 1GOGA 2VC2L 4YK4C 2X70B 3RNQB 3FT3B 1QUNA 2IG2L 5D6CB 4PJAF 4U1NB 5DHVH 4CVXB 3WFBH 2IFGA 3ZTJG 5GS0L 4OZFB 3L5XL 4QLRA 3DI3B 2PO6C 4P46A 1C5CH 4FZ8L 4KRPC 4W81A 3DVNA 4N8CH 2ZG2A 2FIKA 4DJMA 1FVEB 3MLRL 4FS0A 3MRGB 1JF1A 1FCCA 5FM5M 3HAEA 1I1YB 2IPUG 2WV3A 4R2GC 3HG1B 4PJXF 1AD9B 1JGUH 2OR9H 3AC0A 4N0UE 1MOEA 2IG2H 3QIBC 3L3HA 4JFFE 5BS0E 1I9JL 3BP4B 3V4PL 4Q0XL 2VZVA 5GS0H 4WI6A 3L5XH 4FZ8H 2LQRA 5DJ6A 5FO8A 5GRUL 5I17B 4KK9D 5HPMA 4QRPE 1BM3L 1J1PL 3QIWC 4PJ5A 3SDYL 2VDQL 1JVKA 4P5TA 4QRUA 2P5WD 3MLRH 2GUOB 1RZKL 3CX2A 3MV11 4TNWK 1LEKB 4OZHB 3MRKB 2RR3A 1GZQA 5DUPL 4M93C 3AY4C 2W60A 3JV4B 4PY8I 4OGXH 9CGTA 1I9JH 3HMXL 4Q0XH 3V4PH 4D9RD 4A6YB 3W82A 1A2YB 3F5WB 3H9HB 1VGKA 4XCFL 5JDJA 2FWOA 1BM3H 1MCWW 2CDGA 2VDQH 3V2AR 3HE6D 1RZKH 4EDWL 4BJLA 1TZHB 2UY6A 1MNUL 1NUNB 5DUPH 3F58H 2WUCH 3FQUB 1M05B 3DUUA 1OTSD 3DROA 5AG8A 3HMXH 3F6LA 5MENA 5DK0B 2QR0B 4V3EB 2O61B 2R2CA 1DLHB 3KPRE 2CUMA 3TVMB 3GHBH 3HZYB 5GJSH 4Y2DC 4KKCC 4DUXA 4XI5D 1FFPA 3ZE2F 4EDWH 3QUXD 4DCQA 2Q76B 5H2BB 2YKLL 5IW1A 1X4XA 3KYNA 3BZFA 5D2LA 3MYJB 4N0CC 4I2XB 1RZ8B 1MHHB 1RK0A 3FQNB 2J7LA 4P23A 4IRJD 3QUYB 4IMLB 1CDUA 4OM0L 2UZYB 1D9KA 3TCLA 3B9KC 2BSRA 4KKBD 1MFNA 3CPLA 4UNVA 2KZ1B 4PJDE 2IH3B 1Q9OB 4LLQB 3S34H 3HE7C 2A6KB 5A1AA 3C09B 1CDCA 4ZOBA 3P0YL 1HILB 3MRNB 1INQB 3WIFA 3MXVL 1G7JB 3EFFA 1QLFB 4J6RL 4MLSA 4OM0H 3QIBA 4YGVB 2R39A 5E6IA 1XF4B 3VD5A 2BFVH 1QLEH 3JV6B 4LCCC 3H9SE 3LKRA 4K8RL 3EDKA 2YXMA 4L4TB 3TPKA 3RVVC 2WP3T 2NX5A 3MUY1 5F8QC 4L4JA 4NKMB 1UZ8B 2ADIA 3P0YH 5EA0L 4Z7NF 1Z2KA 4WHTB 1FN4A 4HUUB 3UTSA 1FO0B 4DUWA 4RGOL 5CFHA 3KPMB 4J6RH 4MDJB 4F80A 3GI8L 1EJOL 5I6XB 4JFFA 1BVKA 5F7MC 3TWCH 1B9ZA 3PQYE 4TSCL 1KG0B 3TV3L 2Q86B 1JL8A 2YXFA 1NUFA 4LSTH 4OJFH 4QRPA 3O6FD 4K7FB 2D4FA 3V0VB 4ZXBA 1DVFB 5DVNA 2GQHA 3ZHDA 1JV5B 2RAMA 5F7DB 4Y5YA 2W0FA 5C70A 3RBGA 1EJOH 1DR9A 1ZSDB 5HSFA 4DZBB 5JHLL 1A14L 2C26A 2X7LB 4U6HA 4B50A 4L8DA 4LDEB 4TSCH 3PG2A 3TV3H 1J0JA 2COQA 4MNQA 3HI1A 3RWJB 3S98A 3BAEH 3CIQA 3I02A 2FATL 3MV9B 3CX5K 3KYOA 1CG9B 3JTTA 4OCRH 5BZWB 4D3CH 1TNMA 3OF6D 4N1CA 4PG2A 4WI5A 4KQ4H 3K4AA 4ETQA 4WFHE 3WJJC 1KF9B 1YDPA 5IKCA 4OLYL 1A14H 1OLZA 3T0BA 2NNAA 2VAAA 1KJVA 5DYOB 3BPNB 3VFNA 5E00B 1PBYA 4JQXA 2CDFA 1R6VA 1AI1L 3EFDL 1FVCB 1RK1A 4BZ1L 1RJYA 3MCKB 4WI2A 5HTSA 1NFDE 1S7UB 1YPZF 4RDQF 3TPUE 1I7TB 1BOYA 2BP3A 2FATH 2AXFA 2ZUVA 3QNYB 2GHWB 2VLJD 3NZHL 4YDVA 3MV7A 1KB5A 5E8OB 4LNRB 1R5IB 3TBSB 4OLYH 4OF0A 3NABL 3TBVA 3EFDH 2EEDA 3C60A 2YUVA 4BZ1H 1UH4A 4NN6B 5C07E 3MV01 5F88B 1Q9LA 4O51A 1AE6L 1HQRA 1Z0MA 1NC2B 3GM8A 1PW3A 3G9VA 1D5MA 3I9GH 3QXTA 3NZHH 5CJBA 3UAJD 4F33A 3K4DA 3U46A 3H0TA 1XZ0A 1R3IL 4P46B 1QNZL 3MLXH 1KGCD 4I4WA 3MA7A 4LAQL 5CCKL 3NABH 3GM0A 3BGFC 1V8HA 3SKOA 2VLMD 2FIKB 2ZSWA 4U3HA 2OS7A 3RJQB 1J10A 4L8SC 1JF1B 2QL1A 1I9RL 3MQIA 5DQDL 2NY2C 2GSGA 4NP4L 4BA8A 4QHUA 1YZZA 4FQ1H 3H9SA 3L3HB 4F9PC 1ZEAL 3D39E 2J4WL 4F9LC 4HIXL 2Z93A 2DMCA 4UNUA 3ES6A 3O6KL 1R3IH 3P73A 1QNZH 5DJ6B 1A1NA 5CCKH 4LAQH 1NLBH 5HPMB 3WLBA 4PJ5B 3ARTA 4P5TB 2YUXA 4QRUB 1EH9A 1JYXA 4LLMA 4NHCL 5B38G 1I9RH 1RFDL 1NMAL 4PRBA 2RFXA 4K3EH 4NP4H 4AIXA 1IKNC 4DOHB 1GZQB 1QSEE 4OFDA 4LCWE 1CFBA 2XTJD 2W60B 2FD6H 4HGMA 4K3JL 3PQYA 4DQOL 2ZNWA 2FGWL 1ZEAH 1DZBA 4IOFC 1CR9L 1JWMA 3MGAA 1HIML 4LPUA 2J4WH 5KG9A 2VKXA 5I1GL 4HIXH 1RY7B 1N6QL 1UM4L 1SBBA 1VGKB 5JOEA 2FWOB 2CDGB 3CDGA 1JJUA 5CGYD 3WJJA 5DFVD 3NACL 5F9OL 1NMAH 3JWNC 3WKML 3MBEA 5KANG 1JPTL 1W72L 3DUUB 4DTGL 4F7MA 4DQOH 5I73B 2VKWA 2FGWH 5JW4R 3C08L 5MENB 5I1GH 1N6QH 1AXTL 3NFNA 4MA7L 2AJUL 1E6OH 3VFOA 3X14A 5CBAA 2DOCA 3TO4D 5FUZL 2BSED 3C6LC 5JPNB 1FFPB 2HFGH 3MFGB 3NACH 5F9OH 5IIEA 4DCQB 2XACC 3WKMH 3SDCD 1J05A 5IW1B 1UQSA 2GSIA 5D2LB 3KYNB 3BZFB 3NPSB 5JORA 2QHRL 4FFWD 4U1HA 5D7KD 15C8L 1RK0B 4P23B 3C08H 4M1DH 1AXTH 1NFDA 2A73B 1YEGL 4MA7H 1D9KB 3TCLB 4F3FA 2AJUH 1Q9KA 5GGSA 5GZOD 4B7IA 3EOAA 2BSRB 5FUZH 3UROR 1H9VA 1MCNA 5KJRL 1GAFH 5EFIA 5CGTA 3N0PB 3RTQA 1SJXA 2PYFA 2DLGA 2H8PA 4R7NA 4TULL 4TVPD 3CFBA 3JWOC 4W68A 5J4MA 2YWZA 3EFFB 5C07A 4DGVH 1MCLA 1YEGH 1Q0YH 1A7RL 1JF5A 4KJWD 4YFLI 5E6IB 3JWOH 3CLEL 5E1AA 3LKRB 2ED8A 4JVPA 1SEBA 2NX5B 2PKDA 2ADIB 4TULH 1FN4B 2B4CL 4DKFH 3UTSB 1P4LB 3N85L 4U3XA 5DGQA 3C5JA 2AKRA 4CVUA 1A7RH 2X4OA 1DFBL 3PP4L 4P2CG 2CJUL 5KSAA 3V8CA 5JZ7C 1DQJA 3PL6C 1LE9A 1BVKB 1G0DA 5A16B 4KXZH 5ACMA 5FUCE 2R4RL 4PRHA 3NIDE 3PWJB 2Z91A 5FGCE 4F7TB 2IEPA 1HYSC 5HBBA 1ZVYA 4QRPB 4UT6H 4ZXBB 2B4CH 2EIDA 2JF1A 1J8HD 3B5HA 1UWGL 1DJSA 3N85H 4JFDA 4W6WB 1GHFL 4Y5YB 1QSEA 5C0BA 1DFBH 2ITCA 4OUOA 4LCWA 1YN6B 3NCEB 4U6HB 2R4RH 3TNNB 3DOSA 4YPGA 5D1QD 5FUCC 1S7WA 4MNQB 1JWSA 4LOUC 3HI1B 3IDNA 3STLA 1IJ9A 2NY4D 4G9DA 3VXSE 5I1IL 4Z78A 3I02B 4JKLA 5K9KA 4Y4FC 4FA8A 1UWGH 3KYOB 3JTTB 1GHFH 3VXRD 2I5YL 1S3KL 2ZCHL 4ETQB 2P47B 3LKNB 1TCRA 1YDPB 5IKCB 4ELMF 3T04D 2VAAB 1KJVB 3VFNB 2CDFB 1RK1B 2PYED 1XF2A 4PJFE 1RJYB 2EEBA 2DJ4A 3QXDA 5ESAA 1J5OH 1FYTA 4G8GE 5I1IH 2AXFB 2UV3A 4X6DA 1OAKH 5DC0A 4P9HC 1F11A 2Y7QA 4JY5L 1BJMA 4YDVB 4WO4D 1U8KA 3MV7B 1KB5B 4NSKA 2ZCHH 2CPCA 4I0PA 3RAJL 3TBVB 25C8L 4HJGA 3C60B 3NCYS 3QUML 4NRXA 1Q9LB 4O51B 1RJLA 1R5VA 2Z0BA 1HQRB 5EC2B 1QEWA 4E41A 1RUQL 1TZIA 5HDLA 1X5LA 3HUJF 5LCVL 3RVWC 4F33B 3U46B 4GJTB 4WTWA 3H0TB 3T4YB 1XZ0B 1PY9A 1PYWA 4I4WB 3MA7B 4RMUA 4Z5RA 4HG4K 3SKOB 4HUVA 4K3HA 2F54D 4AL8L 1FPTH 2VL5A 2ZSWB 1WTGT 2DWEA 4Y4KC 5KOMC 3VFMB 1T04A 2V5RA 1KLGA 4QO1A 2GSGB 2XXMB 1U91A 3GI9L 2H32H 5C0RH 1RUQH 5I1HH 3H9SB 4L4VA 4N5EA 3VCLA 3K1DA 3AB0B 5AWNH 2P5EA 5J6HA 1T3FA 1F5WA 3P4LA 1JNHA 3CVHL 5L9DH 1UG9A 2Z93B 3ES6B 4IMKC 1MRFH 3MLYH 3VWJD 1BQLL 4NKOA 1A1NB 5DD5L 3CFEA 3U0PA 1FFNA 1PX3A 5B3JF 4AL8H 4PJIF 3TZVA 1FDLL 2BNRD 4UQ3A 5CIPH 2W0PA 4LLMB 3EDFA 3NA4A 1OT2A 1OOAA 5IBUG 4NUGL 4JN1H 4PRBB 2RFXB 4PBWD 1OP5K 3J7HA 5JW4Q 2EYSA 3T09A 3FB7A 4OCYH 3PQYB 4JVUA 4HFUL 4IOSD 1JWMB 3P4NA 3PDDA 3LPFA 5I9QC 5KG9B 4GRMA 4QHLA 4JM2F 4AM0A 4MVBD 2F5AL 1C7SA 4Y4FA 5DD5H 3C5ZD 3ARBD 3CDGB 1FDLH 4GAGL 1CBVL 3DXAD 4NUGH 4WEUD 3O45A 4OZFH 5HHPA 5JIPA 2Y23A 3MBEB 3OGCA 4M1GL 3RQ3A 4X9FA 3DVGA 4F7MB 1A8JH 1MCJA 4HFUH 2XG4A 1JTPA 2XN9E 4WI8A 3NFNB 4XAKD 2F5AH 3WDIA 1OP3K 2J8UE 2PTVA 2SEBA 3TP4A 3X14B 5CBAB 5B38A 3SKJH 1CBVH 4MXQC 1H3WM 1UKQA 4PRIE 1KCGC 5IIEB 4A6YL 5FOBB 3LEVL 1J05B 2HT2C 1UQSB 2GSIB 4R90L 5EULV 4K55A 4U1HB 4PJFA 1NFDB 1OPGL 1EBAA 1QRND 4G8GA 4F3FB 1Q9KB 3DX6A 5GGSB 3KPPA 3EOAB 1SY6H 1U3HD 4X6BA 3VXTB 1C1EH 2HMIC 3GK8H 3QR2A 4JFEE 2NXZD 1YEJL 5IQ9A 3D85D 3KLHC 4N0FA 4Q6IA 1A7NH 5EFIB 2XICA 3LEVH 3RTQB 2Z9TA 3T77A 4R90H 2VUOA 2PYFB 2H8PB 4R7NB 4PJXE 1KULA 5HYQB 3CFBB 1JFQL 4ETYA 5J3HD 5C07B 1DE4A 1OPGH 1QR4A 4HC1A 5MHSD 1VKXA 1GC1C 3ARGA 5JIIA 4I48A 1SEBB 1GC1H 5SWQA 4OD3H 5F6IB 2H2SC 1F90L 4WGVB 1CYGA 1JFQH 1RI8A 3SE4A 2JJSC 4GRWF 4ZS6D 4UTBL 3C5JB 2AKRB 2YA0A 4U0RC 1WK0A 5KVGL 1YEFL 5KSAB 1LE9B 1DQJB 3U0WL 3BH8B 1I85A 5DC9B 5CEZH 4PRHB 3SGJC 2Z4QA 2D4DA 2Z91B 1CIUA 2Y72A 4UDTA 5CJ5A 4RAUB 2JJTA 4UB0H 1QBBA 4WFGE 2LTQC 3VD3A 3BIAX 4Z7QF 2GTZA 1HE7A 1AHWC 3GBML 3UTZA 1A6AA 1NMBL 3MOBH 5HD8C 1NEZB 2HFEB 4JFDB 4X5WA 1RUKL 3KLAA 1FZKA 2I24N 2YD1A 2PW2A 1QSEB 4M3KB 5C0BB 2ITCB 1Y18A 1YEFH 2R2HA 2VITB 4YE4H 3ULUF 5E6ZA 1NBVH 1B0WA 3U0WH 3D3VE 2X4UA 4PREA 5IROC 4R6UA 2B2XL 5I8KL 2B1HH 4YPGB 1N4XL 1FO0L 2B5IB 4FFYL 4ODSL 4JREB 3HCVA 3VXOA 5DQ9A 3IDNB 3QPXL 3STLB 4G9DB 4EN3A 4P2RD 1RMFH 4Z78B 4M6AA 2FL5B 2VLKE 4MQXC 3WIIH 5K33A 3LMJL 4O58L 1NMBH 2OYPA 4QRRB 1RUKH 1WFTA 3Q5TA 2DQHL 4KUCF 2W0KA 2ZUXA 1TCRB 4PV8A 1DANU 1EZVX 1A3LH 2VR5A 1X5FA 2XN9A 3S37X 5I8KH 3ZKXB 1EMTL 1N4XH 4UV7L 1XF2B 1FO0H 1NDMA 4FFYH 3OSKA 4ODSH 2DQUL 3BE1L 2J8UA 3QPXH 3QXDB 1FYTB 3L3DB 1DUZA 1RIUL 4X6DB 3E2HA 4O58H 5GGVY 1F11B 2Y7QB 1HKFA 2WW8A 2EXYC 1U8KB 4MJ4A 1S7TA 2DQHH 4NSKB 4AEEA 5FKPA 5ID1A 3VFGL 4I0PB 4FQQA 3UPAA 1EMTH 2A9ML 2DQUH 2FRGP 4FQXA 3HC4L 4HK3N 3BYYA 1RJLB 1R5VB 1RZFH 5BQ7A 1QEWB 4LVOC 4E41B 1RIUH 2B1AH 1LEGA 1TZIB 4FXGA 4Z7UA 3DMMD 4JRXA 3HZVA 1EK3A 4N68A 4NT6A 3BH9A 4NQCB 3EYQD 1H5BA 5T5NF 5FHBL 4FNLL 5EZOL 4OCNC 2DQEL 1ULVA 5C3TA 3VFGH 4P59L 4Z5RB 5BXFA 3FB5A 4YHML 1OP3H 3EZ8A 2VL5B 5I15H 5FKAA 1SHMA 2DWEB 5GRYA 1KLGB 4HUWA 1F4WL 3HC4H 1P69B 4MA8L 4PJGA 2DKUA 3I75A 3P0GB 4L4VB 3VCLB 2RCSH 2P5EB 4P5KA 5J6HB 1T3FB 1Q0XH 1MVUA 4QTHA 1JNHB 3NGBC 5TQ0L 5FHBH 3QCUL 4FNLH 3UTPE 2HKFL 2DQEH 1UZ6E 3MLZL 5ANME 4NKOB 4AH2A 1F45A 3CFEB 1FFNB 3WFDL 2NCMA 3CAFA 1FL6B 3MLUL 5T3XH 1J12A 3TZVB 3F7YA 1LO4L 4UQ3B 4LF3A 4EOWL 2NW3A 3F12A 3SBWA 2DLTA 3KLSA 4LCIL 3RGVD 4MA8H 3QG6A 4GBXC 5IVXF 2AQ2A 3FB7B 3S3SA 4GG6E 5FGCB 5M7QA 4OQTH 4AEIL 3P4NB 5J12C 1YA5A 4GRMB 4FMFA 1SJVA 5TF1H 1R5WA 3TFKD 2EDTA 2HVJA 3MLZH 4AM0B 4PRDA 3HLAA 3VXNA 5A40E 3MLUH 4ODHL 1TVHB 4EOWH 4Z76B 4NQVA 2XWJA 2YPLA 3QDMD 3O45B 4LCIH 2FB4L 5HHPB 1TPXB 1EAPB 2DM3A 3TNMA 4IBLT 5E8DL 1J1XL 3D3VA 4GW4A 1T1YA 2GJ6A 3DVGB 1GRWA 1YPZE 1IE5A 1OD7A 4WUUA 3REWA 4AEIH 4LPWA 5B3NA 3VI3F 4PLNC 2NYYC 4UINH 3RDTA 2VLKA 1IMHC 4MD0A 5EU6D 1ZVHA 2Z92A 1U41A 5B38B 1YY9C 2CKNA 4V1DE 5K59E 1L7IH 2FB4H 2IBGA 4TUKH 5E8DH 1J1XH 1FE8L 4DUVA 2KKQA 2YWYA 2E6JA 4DEPC 1NL0H 1NBZA 3MBXH 4HJJL 2DD8L 3DX6B 1WBZA 3NFPA 3KPPB 1JPFA 4X6BB 5KVEL 3T8XA 4KKLC 1U6AH 4KTYA 3UTTA 1LO3L 1FFRA 5IQ9B 2VIRA 4GG8A 4X8JA 3DURA 3M8OH 4GKOA 4N0FB 4Q6IB 1CD9B 4HZLA 1JBJA 4Y16A 1FE8H 3T77B 3ILQC 1VCAA 5H37H 5D7JD 1L8JA 1ZV5A 3V0AC 1EGJA 3LRHA 1IGML 4GFTB 2Z8SA 1A7OL 3V6FA 1DE4B 4WRLA 3MLWL 3QCTL 4HJJH 4EXKA 5KBNC 4Y5XC 3ZT5A 2BY2A 4PJHF 3CC5A 3LOWA 1ZT4B 4S2SA 3LS5L 1JZ7A 4LP5A 4RWHA 3ARGB 5D96B 5FO9A 4I48B 1MUJA 2DQJH 3LD8C 2VLRD 4GRLA 1J88A 2XYCA 3D18A 3MJGX 1I1AB 5SWQB 3OQ3B 3GJFK 5FYKH 4BKLA 2XTLA 1WAAF 5DGRA 3V95A 2CRIA 3P4OA 2G75A 3TH4T 2V5MA 1AGDA 4P99A 1IGMH 3KXFA 1A7OH 1QBLL 3MLWH 3QCTH 3DRQA 5DF0A 3SGEH 1I9IL 4U6VL 5C0AE 4D0DA 1JYVA 3VGHA 1F3JA 5IB5A 4QYOB 3SDDC 3MJ9A 2YD9A 4OLZL 3T1FB 2Z4QB 3GSUA 3QIUD 4KK8D 3VI4F 2IADA 4MXWL 4YHNA 2HRPH 1L0QA 5ANMA 4UDTB 3KPQB 1AKJD 4CJ1A 1I7RA 2BVYA 2WWKO 2GTZB 1NFIA 3H7LA 2EXWC 4RAHA 4ZNEA 2C1OA 3OBAA 1A6AB 3UTZB 4S11A 3CDCA 3O3UN 2R9HD 5CLTA 4X5WB 1SMOA 1FZKB 3KLAB 4IRSC 2PW2B 1XIWC 5GGVL 1Y18B 1PAMA 1MCIA 2R2HB 5KVMC 4U6VH 1RIVL 3H42L 3SDXF 2NY3D 2X4UB 4PREB 4NZDA 1WT5C 1FIEA 4JPVH 3HCVB 3VXOB 1H3XA 5DQ9B 3MNWA 3Q6FA 4UQ2A 5DMGC 4EN3B 2BHYA 2HH0H 5DD1L 1NGZA 3ZDZE 1ROWA 1A6UL 4MD4A 5CEXB 3K4ZA 1F58L 3EO9L 4H88L 5HVHC 2H9GA 4XBPA 5GGVH 4P3DB 2AEWA 2DIAA 4PV8B 5AAMA 3H42H 4D9QE 3QDJE 5J0BA 1BBDH 3E6FA 1J0ZA 1N26A 2EDFA 1NDMB 1XCQA 4NHUE 3O6ML 1BVZA 3CDYA 3OAYK 3T2NL 4TOYH 3QH3A 3QUZD 5JW3L 2UVEA 5I74C 2CK0L 2XXCB 5DD1H 1XCTB 1T5WA 1DUZB 1A6UH 1F3RB 1UM5H 3E2HB 4V1DA 3W81A 3DX7A 5I1KH 3OG6B 1F58H 1S7TB 3EO9H 2G60H 5JR1L 4AYFA 3E1F1 4YDIH 5FKPB 5ID1B 2APFA 4FQQB 1ZXQA 4J8RA 3O6MH 5E9DE 3P3YA 1FG9C 5L2KD 2PTTA 4FQXB 3WYRA 2CK0H 5BQ7B 1W0WA 2LVEA 4LSUL 5GS2H 3GMPA 1LEGB 4Z7UB 4FXGB 1NC4D 4FG6D 5LAXA 1CD1B 4JRXB 3HZVB 1EHLL 1WV7T 3BH9B 1AO7D 1H5BB 3DSNA 4S1QL 1S5IL 3NCFB 1GZPA 2GAZA 4YZFF 1CLYL 4ZAKD 5BXFB 3FB5B 4Y5VA 4EEEA 5FKAB 4NO5A 2APVA 1KB5L 2AJVL 2I60H 4HUWB 5DJAA 4BFIA 1ADQH 4PJGB 5T5FL 2R0ZL 3CFIC 4LSUH 3KPSD 3I75B 4XMPH 4MA3B 3PABA 1CFQB 4P5KB 5AD0A 1VHPA 4KDTC 1BP3B 1MVUB 4QTHB 1S5IH 1RVFH 4PGDA 4H8WC 4AH2B 5IWLC 1OW0A 3DYMA 1GOHA 2RJMA 1XIWA 3HN3A 3ZKMC 3F7YB 4LF3B 1G7LB 1MCHA 3F12B 1KB5H 3VGGA 4H8WH 2A38A 5I1AA 4L9DA 3QG6B 5C0AA 4C4KT 2EDOA 1MFBL 2HFFA 4JEGB 4M7LL 4OBRA 2N7AA 1JNNL 5T3ZE 4EI6B 5F1OB 4BQ8A 1YY8A 1JI1A 4R0LC 4QWWC 1R5WB 1WWCA 3QI9C 3HLAB 3W0WA 4ZFZA 5HVFB 3H8NA 3VXNB 2A0LC 3QFJE 1CCZA 1ZA3A 3U79A 4NQVB 2X09A 3PGFH 1VPOH 2IQ9L 2XWJB 2YPLB 3MV8E 4XVTL 4NFBA 4NO0A 3U9PL 3D69A 4OTXL 3TNMB 3D3VB 4GW4B 1T1YB 1U3YA 2GJ6B 4ONHB 1JNNH 3NZ8A 3OXRA 4UAOC 1WITA 3MRJA 1N5AA 4WUUB 4NM4L 3REWB 4J3SA 3RA7H 4JFQB 2W9EL 5LJYH 1ZLUK 4FQCH 3RDTB 2PXYB 4PRPD 4WFED 3FZUC 1AY1L 5F97E 4MD0B 4MXVE 2Z92B 4DWHA 1ZHNA 3HNSL 4UNTA 1VFBA 2IQ9H 4NQXA 3RKDC 5I1LB 1FAKT 4XVTH 3TF7A 2I27N 2Y5TA 3U9PH 4OTXH 4UT9L 1T0NA 5HDQL 3INUL 1NGWA 1ZHKA 4NKDA 5HGBA 5B4MD 4NHUA 4AEFA 4NM4H 3HUJE 4K7PL 5EOCH 2W9EH 2Z8RA 1NBZB 5CD5C 4HK3J 1JRHH 1BFTA 3BUYA 1WBZB 3NFPB 1JPFB 3T8XB 3B2UD 1K6QL 2P42B 3UTTB 4GKZA 2VIRB 3ZTJH 4X8JB 5E8PA 2BRRL 4LLDA 5IHUL 5T33L 4HZLB 5ISZD 2QADB 1KJ3L 2N7BA 2NXYB 3EYSH 4UT9H 4Y16B 3F7PC 3INUH 3DIFA 1WZLA 2YBRA 4MYWB 4UOJA 5F6HI 4PP1C 1N5YL 4PGJA 3FOMA 3V79C 4M03A 4K7PH 4H0IA 1NCCH 2XRAL 3V6FB 4AY0A 4IRZL 3VRJA 4XCCL 4EI5D 4JG0H 5MERA 3CC5B 3LKSB 3LIZL 1HHIA 4S2SB 1K6QH 1J86A 3B9VA 3KJ4C 5FO9B 1KB9J 2BRRH 1MUJB 2YMXH 1Z3GL 4GRLB 5IHUH 5T33H 3D18B 3M1BB 3N50A 1MI5A 5FHAL 4BKLB 2CO7B 5I30L 4X6CF 1KELL 5C0JA 5FYJE 1FBIL 5ITFA 3OAYH 3CJJA 3P4OB 1N5YH 4P4KA 2PTUA 1AGDB 2DYPD 4GKNA 3KXFB 4PUBL 2XRAH 4ZODA 2PO6D 1MRDL 4KRPD 3DRQB 3FO1A 4XCCH 3G6DL 4XPBH 2WWMC 1CD8A 2DQTH 2GJJA 4L3ED 1LP9F 5D6DC 4JFHD 4D0DB 3MUGA 1T1ZA 1F3JB 2CMRL 5IB5B 4NO2A 3IU4L 3UJIH 5EBWA 4M6ML 1CL7L 4R2GD 3GSUB 2IADB 5JO5A 5FHAH 4YHNB 5IFHL 3VD4A 1TITA 5ANMB 4ZUTA 4YC2B 5I30H 3DX9A 3QIBD 4FFVC 1I7RB 5AYUL 1KELH 3V6OE 4YQXL 4NRZA 1JGDA 1NFIB 4Y2OA 3QQNA 1NBQA 3X3GL 4PUBH 5GS1A 1MRDH 3G6DH 4XP9L 3QIWD 4OGZA 4HF5L 3SJVD 5C9JA 3V4UH 4JM2C 2CMRH 3IU4H 3RWFB 1CL7H 5D70L 5IFHH 1PKQB 3HC3L 4NQSA 4MJIE 5JUEH 3MNWB 1VFAB 2GI7A 3Q6FB 5AYUH 4YQXH 3T0EB 4BH7A 1NGZB 2HT4C 5I16A 1KTDA 3V6OC 3JSSA 4FQHA 4JFFD 4MD4B 3S3JA 2Q7NA 4ZSOE 5BS0D 3CH1A 1ZLWH 2X6MA 4ZS7L 3BDBA 4PRAA 2A9NH 5C09B 2H9GB 4XBPB 4XP9H 1P5UA 3OAUL 2XZCL 2XFXA 4QRPD 3BO8A 2ZKHL 3P9LA 4PJBA 3OHXB 5D71H 2J1KA 3E6FB 2E7LE 4LPXA 4KKNA 1A9EA 1XCQB 2IBZX 1CXFA 5GJTL 1XGPA 3QH3B 1DSFH 4ZFFA 1T5WB 4WY7H 3TA3C 3EJYC 4N90E 5FFLA 4V1DB 3DX7B 1Z5LB 5JHDA 2GEEA 4ZS7H 4PLOB 2JLLA 4XNZB 4WW2F 2VSCA 4Y2DD 4KKCD 5IW6B 5GRWA 4MQTB 1MFDL 2ZKHH 3S5LG 3VGFA 4UDUA 2Z8VC 3FOLB 4C56A 2ESVA 2LAAA 2DI8A 4J8RB 3RWIA 2E7LC 2PTTB 1XF1A 4P2YA 3MJ7A 4N0CD 3A67H 4RSVA 5EU4B 1G6RB 3V6BR 3QZWG 3GMPB 4XP5L 3WNKA 1Y6MR 4BELD 1M7XA 3B9KD 5IOPA 1OWRM 1CXKA 1YN7A 1GZPB 2GAZB 2ZG3A 2AI0H 3KPRD 1UJ3A 3S9DB 3E3QC 3KNBA 1ZLUH 4BUHA 4Y5VB 3U7YL 2O5ZL 1Q72L 3HE7D 4N8VG 4LIQH 4NO5B 5DJAB 3WN5C 4BFIB 2HLFC 2XZZA 1OARL 4XP5H 3DHJA 1T7YA 3LS4H 4HMDA 3PABB 3THML 3BD5A 4UTAL 5AD0B 1LNUB 5KZCB 1GJIA 3BKJL 3DYOA 5MI0C 4GH7B 3LSOA 1U8MA 1YJDC 4M7ZC 5DVLA 4PGDB 5EOCJ 5TPWL 3WFHB 3CNKA 5J9PA 3IDYC 4LHJB 2P1YA 3RVVD 1TJGH 2O5ZH 1WZ1L 4OLXL 3DARA 4GRWH 4D0CA 3MR9B 5I1AB 1OTTC 5C0AB 1OARH 2HFFB 1ZVSB 3L3JA 2JJWA 2I07A 4UTAH 2EE2A 1J7VR 4H1LA 4YXKH 3V7AG 3BKJH 3I2CL 2D2OA 3V6OA 3SE8L 1OVZA 3JUYA 3W0WB 4ZFZB 4OLWH 1S9XA 5FAAA 2P5WA 1OQOA 1ZA3B 5B8CC 5ALCL 3ZYIA 3BQUC 3ULUC 1WZ1H 5DO2C 4OLXH 4M9PA 2H6PA 4NO0B 4W4OA 3D69B 2WMPA 3PP3K 5HYSG 4JJ5A 5A2FA 3OXRB 3MRJB 1MF2L 3D1MC 1N5AB 2HG5A 3I2CH 5IB2A 1BIIA 3SE8H 2DJSA 1VGEL 3RBSA 3MRFA 3GBLA 5EO9A 2YUZA 5EU5A 3BPCA 3HE6A 5ALCH 4MJ5A 4CMHC 1ZHNB 4NQXB 4LRIC 5L0QC 1CICC 4ISVA 4C55A 2Y5TB 4N0RA 1T0NB 2NY1C 1NGWB 1T1WA 1ZHKB 2BVQB 4ODTL 3VE0B 4NKDB 5HGBB 2E7LA 5HHME 1MF2H 5LGJA 4NHUB 3OG4B 3T2PA 3WO4B 1R3HA 3P77A 1TTUA 3L3GB 1VGEH 3O4OC 2R0LL 3BUYB 1WIUA 2CSPA 1PVHA 2H41A 3HPLA 5I1CL 4JRYE 1F4YL 4GKZB 4CN4A 3G5VA 5E8PB 4OZGA 3QUXA 4LLDB 1CE6A 2GJZA 2VDRL 3O2VL 1A47A 3QO1A 3V6ZA 1FNGA 2YBRB 4ODTH 4M62L 3VDBA 4AJ0A 5CKAA 4IRJA 2EDWA 1WC7A 4S10A 4Z7WF 2BVEA 2DB8A 3S4SG 5GZNC 3VRJB 2J8HA 4ZG1A 2R0LH 4WFHD 5MERB 4N5UA 3TH3T 4Q2ZA 1HHIB 3HNTL 1F4YH 1ZGLP 1EPFA 3O9WC 4MA1B 3H9ZA 4UOW1 1QR1A 1MI5B 1ORSA 1CF8L 4OF3A 4W6XB