3MRGA

Crystal structure of mhc class i hla-a2 molecule complexed with hcv ns3-1073-1081 nonapeptide
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Analysis of Relationships between Peptide/MHC Structural Features and Naive T Cell Frequency in Humans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 83
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mrgA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mrgA01
1Q9WA 2XKSA 1XF5B 3EGSA 4KZDL 5GQBA 2EC9T 2M26A 1WUNT 2GTWB 3I2CL 3W81A 4LQ1A 4PB9H 4M5ZH 1R5WB 5IB5B 1A21A 3B8YA 2H8PA 2XTLA 5C0EB 5C6TL 4XP5L 3WNMA 3GDBA 2DIBA 5TDPB 2D4DA 4XP6H 3FT2B 3SJVB 1WJ3A 1ZOXA 3KYOA 4YDLB 4LEXH 3GKWL 2RB8A 1DQTA 3QDME 3QQ3A 2H2PD 3MJ7B 4OJFH 5F1SA 4D0BB 5E2WL 3LKQB 3KJ4B 3MRCB 3GEWB 1CDHA 2YPVL 4IMLB 1U2CA 1U8IA 3VFWA 2FATH 4MCYB 4JFDD 3FT3A 3LIZH 1J0IA 1WCBA 4U6HA 1BWWA 3O8XB 4LNVA 1N5AB 4M1DH 1IGJB 4RX4D 4GBXB 5E5MB 2JCCE 1MPAH 1L0XA 1JPTH 5CEXB 1NLBL 3KPQB 3ZDYF 5FYKD 2Y5TA 4UINH 3GSUA 4XPTL 4MDIB 3E3QA 1ULVA 2EDLA 3PHOB 4RGOH 3M8OL 1HEZA 1MCFA 3KGRA 3NCBB 4V1DB 5AG9A 5ISZB 1EO8L 4LSQL 3N85H 5FM8A 1AH1A 2A77H 3MCLH 1IM9A 4GRMA 3MO1B 4GSDL 3V52L 4L4VE 4P59L 3LCYA 4IOFC 3TFKD 2YK1H 5F88B 1QEWB 1RFDL 4C56B 2XKUA 5HI5D 5AAMA 3UZVB 5H94B 1J1OH 3MLXH 1TZIA 1RHHB 1KEMH 4DJMA 1RUAL 4ZO8A 1TIUA 1EEYA 2OM5A 5K33A 2EO9A 3NN8B 2XTJB 5GRWA 4GUPB 4I9WE 1QACA 4PLNC 4HWNA 4E9LA 4OFDA 2CRZA 1E28A 5T1DL 4XPHH 3VXUD 4Z7WA 3GSOA 1UH3A 5DK2A 4WGWB 1DDHA 4LOUD 1BGXH 1AGCB 3QZWA 1MCHA 4OGYL 4WHYH 3CMOL 4MS8A 1A4KB 3HI6L 1KB5L 2DBLH 1MIEL 4PUBH 1BJ1H 2HFTA 4K94L 1GC1L 5D71H 1XR9A 1FZJA 3BGFB 5EC2A 3QIBB 4KK5C 2LVEA 3ROLB 1ZVSA 4JFOA 4Q0XH 4LKXA 3AAZB 2AVGA 4HUNB 4XB8A 4U1MB 5E8DL 4JEGB 5I16A 1NC2A 4K07A 4MXWL 5FECB 2P4AB 1RZJC 1C5BH 2IBGA 5SX4H 3BEWB 3OJMB 4RAUA 4L1DA 5AYQA 4ODWB 1QSFB 5CP3H 4UTBL 4UMGA 1JVKA 2AK1L 5DMGD 2JJTA 5CZXC 1MSPA 5K9KA 5J12B 3HPLA 5C0CB 5KAQG 1LD9B 3RP1A 3TJHA 4BELD 5D7JD 4PJ9D 2HJLB 4ZTPH 2ZNXA 2XPGB 3QPQD 4P2QB 2F58H 1X5AA 1WSST 1X5JA 4U7SA 3MRIA 4MA3A 3V0VB 3LV3B 3ZHKA 2FBJH 1Z3GL 2D7TH 5C71A 4NO0D 4MB5A 4ZG1A 1QSED 5CJOL 4CVXA 1S3KL 3QHZL 3LMJH 5EZJB 7CGTA 5L2JB 2HTLD 4P5TB 1NPUA 2A6IB 4R96B 5J13B 3PHSA 3GBNH 1PKQA 4PJDE 4J3TA 4DFIA 3EYVA 2WWMC 4Q7DA 4YC2C 4PGZA 4PD4J 4Z7OF 2MPAH 1G7HA 4JFFB 1NMAH 4HWEH 4Y4HB 4CMMB 1KXVC 5DC9B 2CKBA 2NXYC 3HZKB 4PGEB 4LLDB 3EOYG 2NY5L 1HI6B 3OPZH 3MUJA 3MXWL 1MI5B 1FYTA 5CZXD 4F33A 5HHPA 1CE6B 1SM3H 3GHEH 4V3EB 4DKFL 5DVNA 3OZ9H 4FQCH 3T4YA 3PWVB 1YZZA 1BF2A 4N68A 2W38A 4APQA 4JFEA 5ETUB 4CMHC 1D6VH 5TE6L 5DSCA 2J4WH 1SHMA 2BY1A 4M9OA 3TO2B 1VACB 4O00A 1WV7T 5MEOA 5DZOA 1MCPL 3MLUH 3S98A 1C12B 3J7HA 4GW4B 3O6FC 3KXFD 4X6CA 5DUBB 5E4EC 3TZVB 3P4NB 1QLEH 3D87B 3NIGE 1KCUH 1TCRB 1GVIA 4YHLL 1JGDB 1OTSC 2BSTB 1EMTH 2X4SA 1TVHA 4PJ5E 1J9CT 5FDYA 4WFHD 5DQDL 4K3EL 1FE8H 1UVQA 3UEZA 1G6VK 3GKZA 2OTWA 4FXKB 1UXSA 3DV6B 1CK0L 2AKRA 2JJWA 1E4KA 3QXTA 3T0EB 1Q9KA 1L8JA 1QHPA 2UWEF 5JDSA 5EBMA 3L3IB 4H8WL 4YXLL 1PJ9A 3S5LA 2EKJA 3SDXF 4Z95L 5E08H 4CW1B 2B4CL 3AUVA 3OMZA 4L3EB 4UB0H 5FO7A 3UTSA 3IDGB 4PP8C 4X5XB 2VXUL 3V5DA 3Q6FB 3NCEB 3QUML 1P7QA 4FQJL 4XX1E 3WNKA 2PTTB 4BH7B 1J12A 2PW2A 3MC0A 1D5ZB 3HAEH 5GGQL 5HSFA 3V7AE 1MAMH 1W8OA 2VDNL 4XCFL 4MVBA 1ZLVK 2BHZA 2LABA 2VH5H 3JVGC 1RY7B 2YSSA 5EO0B 1ZT1B 3E2HC 3QSKB 1LE5A 3SDDC 3MRMA 1MRFL 3ZDZE 1S8DB 3WLBB 2CSPA 1OTSD 1I7ZB 1NL0L 3MV8B 3TBWA 3VFUA 1P2CB 2R1WA 1HCVA 4PJ7B 1A6WH 2E6QA 3GRWA 4X7EC 4HPOH 4X7FC 5FYKE 4BQBA 2PO6B 4QYOA 1VFMA 1FV1B 5DR5L 1FDLH 3FHAA 1FNAA 5I2IA 1A1MB 1HIML 5D70H 1MVUB 3FOMA 4KHXH 5DD3L 1OP3H 5KN5A 1AD9A 1VPOL 3I6LD 3O4LB 1CFNA 2QR0A 5GIRB 3V5HB 4ZYKB 1W72H 4QOKD 2W0LA 3TF7C 1S7TB 1VDGA 3WD5L 1GGBH 4DKEL 3RNKB 5DT1H 4M7ZC 5SWQA 3QEUA 2PF6A 4U6VH 4K9EC 5HYSG 2QQNL 2YZ8A 4JFYB 4RGNC 3UBXA 5EU3B 5I1HL 5JW4R 2DQDH 1BAFL 1KYOK 3HMXH 4ODXB 1N6UA 4JG0L 2IAMB 4IOIB 1MFAH 4K2UL 3WO4B 3FQTB 1TDQA 2DIJA 4NUJA 2C4FU 3VXUE 4OT1L 4WW2B 1OGTB 1DZBA 1U3HD 4TOYL 3BN3B 4ZNCD 5FHAH 2IALB 1ES0A 4V1DE 1TMCA 2J7LA 4L3CB 3ZZ1A 4OUUB 3U6RA 3X14A 1YEIL 1YYLH 2EO1A 1AXSA 5E99H 5A43C 5E4IA 2X4NB 3KYNB 2P1YA 2XTJE 4KMLB 4G7YH 2HTKC 4MNQD 4NT6A 3RVUD 3HPJB 4TVPH 3A6CH 3DBXA 5HHMA 2DQFB 1KIRA 1JWUA 1TXKA 4KHTH 2ID5A 4W6XB 3FONB 3T3ME 1P1ZA 4RGND 2QHRL 1LDPH 1UG9A 1C08B 5DUPL 3BPOB 2AQ3A 5I1EL 3MLSH 1KG0A 3TPUB 4IS6A 2MQCA 4KGLA 4DZ8A 12E8H 1LNUA 3QAZB 1BFTA 4IRSC 4LSUL 2DMCA 4I77L 4IDLA 4U1HB 5IB3A 4J4PC 1JV5B 3QWQB 1AHWA 3H0TA 3DX6B 1P9MA 4Y5XB 3P0GB 2ERJB 2VXTL 4PGCA 1FGNL 4CAGA 4E41B 3JWNC 4WFEE 4AK1A 2CIKA 5HGDA 4NP4L 5I8CB 3T04D 4ZUUA 4P9HL 4AMKL 3C5JA 2APXA 1NFDF 3CXHK 4DGVL 3MRDB 1NBYB 4JGMA 1J8KA 3RWEB 1HDMA 4YHZH 1QSEE 1FQ9C 1OAXL 4XBEL 1BQUA 1JGVL 1G84A 3GFUA 5HY9A 1KBGL 1I7TA 5EN2A 5IHBA 2R2EA 4KI1A 5HHXH 3DUHA 2VNCA 3HNVL 3DRTB 4JFPB 3DLQR 3MOBH 1AC0A 4HBCL 2DTML 2DWDA 3CDGA 4HS6A 1FLRH 4JPIA 4PG2A 5FF6A 3IDJA 4P2QE 2WIIB 1EBAA 3CJJA 4PJIB 1LEIB 3CFEA 4IRSD 5ESAA 3LZFL 1KXTB 5HDBE 1F3JA 4L8BA 1OAZL 5D1XD 5I1CL 2Q3AA 4PTTB 3K1KC 1JZ2A 3B8SA 4WV1C 4YDKL 2I5YL 1CFVL 1MY7A 3DX8B 1YQVL 3HZVB 3TBVB 1VFUA 1DVFD 3L5IA 4OCSL 4LSRL 5I1KL 3GSRA 1K4CB 1ADQA 2R9HD 4JB9L 1QKZH 3NFSL 4FXGA 1GGUA 1Z9OA 2ADFL 3BPNB 4GLRH 5GGSB 4OLZL 3IFNH 2FL5B 3OJDA 5IBTL 3ZTNH 1MCWM 1YY8A 1IGIL 5GJSL 2BRRL 3H9SA 4X6FA 5DHXB 3TYFB 1N64H 3P2TA 3EFFB 4KU1A 3H7BB 2FCBA 4QNPF 3CVIL 5TDOA 4WFHE 4Y2DB 4ZNEE 2M2DA 4K3HA 4G9FD 2EH8L 2X4RB 1X44A 1T5WA 4UQ3B 5TF0A 1UWEL 5KOVC 5HHOB 2QSCL 4MA1B 1I3VA 3UAJD 3PJSA 1TCMA 2W9DH 4P3DA 1F8TL 1PG7L 3JVGA 3ILQC 5JUEH 1RUKL 1NDMA 1MUJA 4ZO9A 2A6DB 5ENWA 5D1ZB 4ZSOB 4LLQA 4WO4B 4LFHG 2R1YA 5CWSA 1I8LA 2D7MA 3RWDA 3TIDB 2Y5EA 4S0TD 1VFBB 3MCKB 5D9SA 2AJSH 3MV7A 5FK9B 1V05A 5F7HA 1JL8A 2VQTA 4TUJB 1DBKH 4QRPA 2X1QA 4LLYA 4XGZB 4D2NA 4K7PL 3B9KD 1V7NH 3QUXB 3IJYA 1IM3B 4LCWA 4OSUL 3TLRA 5F89A 3G08B 2BSED 4ZPTA 3BQUA 3QO1A 5HYSB 3O6LH 1X7QB 4BH8A 3HTLX 2A6JA 1D5IH 3EYFA 3PWPB 1NAMB 4I0PD 3TF7A 3KPRB 3T0EE 1DLHB 4JDVA 1HH9A 5D2LE 1JZ4A 2VDMH 4H1LA 4WDIA 4OCWL 1MWAB 2XN9A 3GMQA 3RTQC 2EDWA 3U4BL 2XYCA 3VXNB 1D5BA 4L3EE 1IKFL 3OB0H 1HNGA 5KS9F 3MLZL 1FG9C 3FB6A 2NX5B 3JTSA 4LCYB 1I3GL 1GPOH 1XGQA 3RKDC 5B8CA 2ZJSL 4NYLA 4TPRL 1ZLUK 3F58L 2FJHB 3MLYL 4OD2A 2EYRB 1AO7B 4M43L 3V4PH 4XVUD 2FD6H 3ZHDA 3VFOB 4G3YL 2FYYB 3HC3H 3MV8E 1UB5A 4Z7UB 2BSRA 3RI5K 5ITBL 4Q9QH 1CU4H 4NQSB 1ZMYA 3OGCA 4C4KT 3F7QA 5EC1A 5CS7A 4Z0XB 2XWTB 1YNKH 1F11A 5FYLL 3GSXA 4YHML 4ZS7H 4LSSL 4PJHB 3TBTB 5A16B 2ESVA 4N0CD 4OLVL 4YBQC 3WN5B 5B38G 1ACYH 1WEJH 1X5IA 3EO1B 2AXHA 1IKNC 4L5FH 1VB9A 3BKJH 5EOCH 3O4LE 3VFRB 1XGRB 3OKKA 5GS0C 2SEBB 3RTQD 1R3IH 3S35L 2HJFA 4F58L 3AC0A 3VXSB 5ICYA 2HFGH 1UXWB 4X4XA 4X5LA 2HFEA 3FQUA 2HA1A 4AL8H 1IAMA 5KVDH 4DZBB 2VLRA 2BVOB 1OQXA 3VI4E 3GMRA 3DIFA 4J4PA 5EU6D 3WLWC 3NA9H 4MNQE 4XCEA 5EIVA 3LS4L 5IF0A 2CMRL 3GIZH 1LP9B 2WINB 2DL9A 5E5UB 4XHJD 1H9VA 1Y6KR 2BSSB 1CXLA 2QLVB 2XFXB 4FMFA 5KVFL 2WBWB 4JZJC 5IW1B 4FNLL 3VFGL 3FQNA 4XC1L 1MCIA 3HR5A 1TJIL 5FO9A 1FL5B 2XA8H 3INUH 2R2HA 5FYJH 1OHQA 1K6QL 2OL3L 3VGAC 5CINL 4YBQD 5IIEA 2DMBA 1U8NB 3O11B 1HHHB 5I6XC 4OLUL 2C3VB 1A5FH 3OKMB 1N2RA 4G8IA 5DVKA 3DI3B 4LHQB 4O2EB 1YDPA 3X13A 5KSUB 2A1WL 1FG2A 3VD3A 1G9MC 5H8DA 4YWGH 4H25A 4OQTA 2X1WL 4P4KC 3FQRA 2DD8H 2IPTH 1KN2L 3FO0H 3O6ML 5C0GA 3LQZA 5IT2L 2QV2A 3TPUE 1BOGB 5ADOH 1R3LB 1WTLA 2CK0L 1A1OA 3WLWD 1CN4A 1G6RA 3S34H 5FHBH 1KJVA 5SWZA 2V17L 2VXSH 4IJ3C 4P3CL 3PL6C 1GXEA 2UWEA 3K1DA 1BZ9A 4QWWC 2NTFA 5DJYB 4PY8I 3U0WL 4TUKL 4HZAA 2R0KH 1IZJA 2JB6B 3ARYA 5BOZG 3IS1X 4YQXH 1FYHB 1RJZA 1CD0A 5J6GB 2IFFH 5INCB 2C4XA 2EXWC 4TQEL 5J1AB 3WO3B 4FXLA 2Q76A 3HNTH 3QZWG 5LG1A 2HG5A 4WIQA 4HGKC 1BF8A 2H32H 4OQ1A 4G8GD 3PP4H 1NUGA 1U36A 1EX0A 3OSKA 3VFNA 4OFYA 4R7DB 3IDIA 3NABL 3PWJB 1IBGL 2F54D 1T7ZA 3UYOD 1LO5A 2BNRD 5E6IB 4NQEA 2A83A 4M6NH 1YEFL 2VDLH 1U41A 3QA3A 1D5XA 3ET9F 4XP9H 4EN3C 3GJFK 4Y4FB 3SQOL 3LEYL 1JZ7A 1YECH 7FABH 3CVHA 1Q9LA 1KCSH 5EUKA 1U9KA 1V7MH 3EDDA 4OAWA 1N26A 2AJXH 5ICXB 3WHE0 2UZXB 3LH2H 4L4JA 2F53A 4HK3J 5DRZB 3HG1A 5D7LB 1DR9A 4PRHD 5F1NA 4HT1H 3SDCA 4NN6C 1XGYH 3GIVB 5J8OA 2VZ1A 1WZ1L 3D85B 3SGDI 3T3PF 3BD5A 2EH7H 1INEL 3RVWC 1P6AB 4UBDD 4KTDL 4MD4B 3VW3H 2GFBB 1RVFH 4FFZH 1XF4A 3N50A 5IVNA 1F58H 4MQTB 1RK0B 5E8PA 3BPLB 1NDGB 3PGFL 4HIIA 2OSLA 5HDOA 3G5YA 2IJ0C 2VJXA 1CF8H 3FMGL 3IJHA 4YZFE 3MRNA 1OTUC 3Q3GB 1JYXA 4MD0B 2VLJB 2HMIC 4PJAB 4ZXBC 5HHOE 4PRAB 4FZEL 2X4TA 3PABA 1NKRA 5DUML 3CSYA 3AXLA 5GISH 4O2FA 4EN3D 4S11A 3DX9B 2YPLB 4FQLH 1OY3B 1HZHH 2OR7A 3OAUL 5E8OB 4BZ1H 1EJ6A 1IGMH 1D9KD 3DI2B 4KRPD 5HHNB 3MYJA 4EIZC 3KYMB 4HKBB 4K71B 4HAFA 2WBKA 4FRWA 4F57H 3S6CA 4PB9L 4M5ZL 3BP6A 1GGCH 1JK8A 1MRDH 1RJYB 2VERN 3I75A 4L8SC 1F5WA 3TJEH 2FO4B 1C7TA 1YPZB 2YXMA 4UNUA 5FUCE 1QFOA 1DFBH 1SYVB 3ULUL 5BQ7B 4LEXL 3FN0H 1FFOB 1EHLH 1GGYA 4X5WA 5ESVA 3U4EB 3PWPE 5D6DA 5GRXG 5A2LH 5JXEC 2UUDK 3KPRE 2R0WH 1MCRA 3EOAB 3LIZL 4NHCH 4C83A 2K3TA 3QFJD 2PYED 2HAZA 5E70A 4P2RA 3B5GA 4M1DL 4J3XA 4WNQA 2VB5A 3LOWA 3PGDA 4IDJH 1JPTL 3PNWB 2HMID 4ZXBD 2XZQH 2H8PB 1NFDA 4UINL 1AI1H 2NX5E 4RIRA 1RSFA 4K94C 1GC1C 3AS1A 1ZHKB 3KYOB 1OP5K 3JV6A 5C08D 3QQ3B 3N85L 3STLB 3S36H 3MCLL 4JZJA 3KLDA 5BRZD 4DAGL 4KKCC 1U8IB 3MLWH 3VFWB 1KCLA 2Y72A 2BY3A 3FT3B 2AXFA 1WCBB 1J1OL 1R5IA 4U6HB 2VQ1A 4Z7UE 5F72S 3VRLE 2LU4A 5C07A 1A4JB 2F5BH 1LVEA 2CDEA 5CZVH 5TQ0L 4X8XA 3O0RL 2Q3ZA 4PGBA 1WVZA 5EPMB 4GMSH 3GSUB 1DEDA 5LQBL 2V5YA 1L9MA 3S5LG 5JXED 4PIRF 1AGFA 1HEZB 2YS4A 3IJSA 4G43A 4NGHL 1BGXL 4LPUA 4P4KA 4UIKH 1IM9B 2BRQA 4LSPH 3TV3H 3U1SH 1XF3A 2DBLL 5C86A 3UTTD 2BOBB 3KYKH 3ALXA 4PUBL 3QUKA 1TZIB 1I8MA 3W9EA 4M5YH 2CR6A 3B9DA 4F7PA 1EEYB 4ELKB 5K9JL 4LHUA 5F7KC 1G9NL 3PL6A 5CILH 4Q0XL 1I1AD 3V5KA 4Z7VA 3RRQA 4F15C 1T21B 3MTRA 2OJEA 2QJDA 3D1MC 3C08H 5LVEA 1E28B 2DBJA 4Z7WB 2OP4H 3GSOB 5DK2B 3KLHD 3WNNA 1DDHB 4X98A 4JFXA 1EBPA 4M1GH 3QZWB 4NZTL 3NCMA 4RRPA 5HI4C 4R26L 5M94B 5FA4A 4UQ2A 4TNVF 1CYGA 1EFXA 1T7VA 1FFPA 4R8WH 1MCSA 5HYJD 1XR9B 3P3YA 2NY5C 1WITA 5I73C 2DOCA 4NWUL 1I3RA 4JFOB 5BJTA 1I8IA 2MOVA 4MJ5B 4LKXB 4Y4KC 3UBXG 4NNXB 1KT2A 4L8CA 3VFSA 4J1UA 5F6HJ 5I16B 1NC2B 3V4VL 2EIBA 2F58L 3BVNA 4H20H 4P48A 4WHTA 1GZQB 2G9HA 2D7TL 2GIYA 2CUHA 3N1MC 4YH6A 1QYGH 1RU9L 5DURD 5IEKA 4RAUB 1DQQA 4KQ4L 5IW3A 2UZIH 3LMJL 4ZAKC 3HB3C 1S9YA 2HWZH 2V7NA 5IROA 5K9KB 4G8GE 1FH5L 3HPLB 1SYSA 3GBNL 3EDKA 1F3DH 3L95A 3ME0A 2MPAL 4HUKB 3F7VA 2BNRE 4I2XE 1NMAL 4IMKA 5CJXA 3P73B 2H26A 5KS9A 3MRIB 4LPWA 4MA3B 2X6MA 2AAVA 2APFA 3MJGX 1IGCL 3QPXH 3RKPA 4QY8B 4YHYB 4D9RD 2NW3A 4WI5A 1SM3L 4UUJA 1PY9A 4RMQA 2NY7H 5D4QA 4LPVA 4TNVK 1V3LA 4H8WC 5C0AA 4OBSA 1PKQB 4LPXA 4OIBA 3DTXA 2B4CC 2J4WL 2X4UA 2I26N 3O3EA 5EULV 1Q1JH 1U8KA 4EOWL 1G7HB 3F7PC 4ELMA 3BDYL 1Q0XL 2G60L 3BP7B 3P11H 3MLUL 2A0LD 2CKBB 1JRHH 1KCKA 2VLME 1FYTB 1KCUL 5HHPB 3BWUC 1UM4H 4NOFA 5GRVL 3T4YB 1W8NA 3PWLB 1MIMH 5C0IA 4APQB 3SOBH 4JFEB 3T0XA 2V2XA 2JB5L 5D7LE 1H3GA 3QIUC 1NCWH 1P4LA 4UTAL 3D0LA 4Y5VC 4RDQF 4DGYH 4HJGA 4AEIH 5MEOB 1HE7A 4JY4A 1JFMA 4P2OC 5CD5C 5LJYH 4WJ5A 1MCKA 4X6CB 2OZ4H 1A3LH 3T8XA 5I1AA 4HS8H 4ZOAA 3UC0H 2J8UF 2X4SB 4PLJC 1TVHB 3IS0X 2D31A 4U1LA 1UVQB 1U3YA 1D5MB 1I4FA 4HXAL 1EO7A 4RGMC 2OTWB 4PJAE 3GHBH 1UXSB 3W9DA 3L1OH 2AKRB 4FFVC 2X70A 1Q9KB 4U1SA 5JDSB 3QFJE 1W0WA 2PYEE 5EBMB 1N5YH 4JDTL 1A7NL 3S5LB 4ZD3H 3EAKA 4HPOL 5FO7B 3VI3E 5GGRY 1T04A 4LHJB 3GJFA 3UTSB 3V5DB 2DB8A 1FDLL 1M05A 1P7QB 3QQ9D 5ID1A 4NM8L 3LKOA 5D70L 2EIZB 4GXVL 5HTSA 3H2WA 5ESQB 5DD1H 2VDOH 1R3JA 4N90D 4AY0A 1S7QA 1W72L 5I15H 2YSSB 5BRZE 4WI4A 1LE5B 3LPWA 3MRMB 3MPCA 3VFUB 1GSMA 3TBWB 5IGXL 4BFBD 4PLJD 1QPPA 2R1WB 3HMXL 4OFPA 2J88H 3V8OA 1C5DA 2EDDA 2PR4H 3SBWC 1F4WH 3KPSD 4QYOB 4WUKH 4BZ2H 4Z5RA 2WNGA 4JR9H 2EKSB 3L7FA 1ACZA 4LIQE 3LQMA 4JRYA 4FFVD 1HINH 3FOMB 1QHOA 5KN5B 1IARB 1AD9B 1REIA 4X6BB 3RWJA 3C5SA 3CK0H 4XNZB 1CFNB 2QR0B 1ZHBA 4U0QB 5D1QA 1KJ2L 1NGQL 3DYMA 5F3HA 4Y88A 2OI9C 3QEUB 5SWQB 5E99L 5BMFL 4OLEA 4Q9BA 3PF2A 3UBXB 4P9HC 2J8HA 3SCMC 2GQHA 3QDGD 5F9WB 35C8H 4K23L 2Z4QA 2VC2H 4OZHE 4NUJB 2Y36H 3QI9C 3E3QE 4Y4KA 4TVPL 3OQ3B 2B1AL 3K4AA 5DVLA 4HGWA 1ES0B 1TMCB 2V9TA 4O2CB 1LDPL 3X14B 3U6RB 3HE6C 3AROA 1CDYA 5B3NA 5CFHA 3BIBX 12E8L 4PB0H 2UV3A 2V5RA 3UJIH 4HIHA 1A22B 4WFGD 3SQBA 4N8CH 2NY4C 5HHVL 2RCSH 2K9UA 1QFWI 3PDGA 5CSZB 4NT6B 4PRID 5ALBL 3DBXB 4Z7WE 4HUXA 2B8OT 5HHMB 4FQ1L 1KIRB 1JWUB 2E9WA 4OZGF 3WJJC 1P1ZB 4P9ML 5EOQH 1RZJH 4PP2A 3SCMD 4RMWA 4Y19A 1KG0B 2JELL 4I1NB 2F9BT 4IS6B 1YMMB 1W0YT 1L0QA 1LNUB 2WBJA 5EWIH 3BKCH 5E8EA 5HHXL 5IB3B 3BT2H 1FPTH 1AHWB 3H0TB 3O45A 1LO2H 4PGCB 4YXKH 2DYPA 4XNXL 3MOBL 4NBZB 4YC2B 3HE6D 4ZUUB 1UZ8B 3ESUF 3QUMA 1NANH 3G04A 4OF0A 3U9PL 1DQJA 3C5JB 1X5FA 2NXYB 1MJUL 4X7CC 4S1SH 4D9RE 3RVXD 1HDMB 4D3CH 1TVBA 4KQ3L 4ODTH 5HY9B 1CCZA 3IXTA 1I7TB 2DLFL 5EN2B 2R2EB 2DQIL 4KRLB 4FTVD 3HI5L 3QIUA 4OCXH 2DWDB 3CDGB 4RSVA 4YPGB 4NO2A 4HS6B 1QKZL 1YEJH 4JPIB 4YUEL 5FF6B 5KSBF 3IFNL 3OKOA 4XTRD 3LD8C 3ZTNL 4ZFOL 2YD5A 4QXUL 3CFEB 1UH4A 5ESAB 1AP2A 3O6FB 1F3JB 3BKYH 5E4EB 1N64L 4L8BB 3LSOA 2VDQL 5IP4A 4CRPA 5AAWA 4R97B 2BHUA 4RMSA 5F44A 5JTWA 5C09B 2YA1A 1ZGLM 4LAQH 1E4XL 3LAFA 1E27A 2XWBA 4GAJH 4MZ2A 2P7TA 2ZPKH 3DMMA 3GSRB 1VGEH 1WC7B 2W9DL 2NZIA 4HIJB 1S78D 4JHWH 1WT5A 2VE6B 1N0XL 3SY0A 1P84K 1YY8B 3V6ZB 3H9SB 4X6FB 2R1XA 2NCMA 3GSNH 1FYTE 4U1NA 4WWKD 1B0RA 5TDOB 5I9QB 5EFIA 4F7TA 2BNQA 4OZIF 5JOPD 1V7NL 4XNQA 4FOMA 4JFEE 1P4BL 1T5WB 5C2UB 4OCYH 3TBYA 3O6LL 2Q87A 2JJUA 3N06B 3JV4A 4PBWD 4N8VA 4JDZA 1NKOA 4P3DB 3LHPH 2DLHA 1NDMB 4K7FA 1MUJB 3SDDB 3RUGF 5ENWB 1UH2A 4LLQB 2EE6A 2R1YB 5CWSB 5ITFB 5CIPA 5C7XH 4MHHG 4HKJA 3RWDB 5DQ9A 3TH3T 4X6CE 5DGRA 5D9SB 4WI7A 1M71A 2VZTA 3MV7B 4XMLH 4JVUA 1FRGH 3NCFB 1U8LA 4LLYB 3CH1A 5CEZD 5D7KD 3WL9A 3QDJA 1Y0LA 3IJYB 4KFZC 5AEAA 1T89C 3QDHA 5F89B 2Y06H 4ZPTB 2RBLA 3CLEH 3BQUB 3QO1B 1ZWIA 3ALPA 2K1MA 4BH8B 2A6JB 3RL1B 4PGJA 4GOSA 3EYFB 2FLRT 4A6YH 1Q0YL 4TVSa 3WE6A 3HUJA 2ZG3A 1FFQA 4JDVB 1HKFA 1I1CA 4M7ZB 2OI9A 5HGAA 4C58B 1A7QH 4H1LB 4WDIB 2Z92A 1CU4L 2XN9B 3GMQB 3SKNA 2C9AA 1D5BB 4N0YH 2Q6WA 3X11A 5E2VH 4KJPD 3UTSE 1YNKL 1T1YA 1EH9A 5LXGL 4ZS7L 4ONHA 2R2BA 3VD7A 1RQ5A 4QRPD 1EVUA 2J1KA 3JTSB 4M48H 3B6SB 4RMVA 1XGQB 5B8CB 4LCWD 4F3FA 4LF3A 4NYLB 4OTXH 4X9IA 5EOCL 1K2DA 4S1RH 1NCAH 5IHZA 2X1XR 4OD2B 1O5DT 3NIDE 4KY1H 4N0RA 4K9EH 3P30H 4GO6B 4HMCA 1UB5B 5IVXF 2BSRB 1BVLA 4YE4H 3OGCB 3BAEL 3O2WH 1F11B 3GSXB 3H6JA 4PRDA 3ORJA 4U3HA 2ESVB 2Q8BH 4I18C 1OT1A 4NQDD 1A3RH 2QEJA 4M6MH 4W4OC 2G2RA 3DVFA 1NMCC 3WJJA 4GXUN 4WTXA 2HJFB 4I3SL 4POUB 1U93A 2DLGA 2ICWA 4NKIL 2XA8L 5ICYB 3VXPA 3INUL 2ENSA 4X4XB 5FYJL 2HFEB 3FQUB 3NCJL 3HN3A 4IRJC 3IAPA 2R8SL 3GMRB 1DL7L 3DIFB 5D93B 2DMKA 1A5FL 4HUWA 5IF0B 1A7PH 1RMFH 4DN3L 1K3IA 4PRBA 4YWGL 3BRFA 4DTGH 4HMDA 3TN0C 1MAJA 2DD8L 2IPTL 3GSWA 4R4FL 4WW1A 1EJOL 3HR5B 2ZG2A 1NBZA 5IMLB 4AH2A 3LKPA 5HGGS 1T2QL 4UZGA 3K80A 2R2HB 4RISH 4YDIL 3QDAA 2X7LA 4XZUA 5IIEB 1UYWH 2CDFA 3FZUD 2VXSL 2OQJA 2VLRD 4QRRB 2EECA 1DQLL 1N2RB 3P0YH 1PZ5B 4KI5D 2PYFB 1YDPB 3X13B 4EI5A 1FG2B 5DJ8B 4JO1H 2FWOA 4H25B 4UU9A 1ZGLB 2R0KL 3NOIA 3ZTJG 3OKDB 5HHME 5JPNA 3FQRB 1Y6NR 5C0GB 4G6AC 3BN9C 3LQZB 4IRJD 5JORA 3HCVA 4P2YA 3ZE0E 5CGYC 1A1OB 5HYEA 1G6RB 3FO9B 3IFLH 2X9YA 1KJVB 1GJIA 1QR4A 3HNTL 2DM4A 5SWZB 3BOVA 1MEXH 4Z76A 2C1OA 2VLKA 3PP4L 2UWEB 5DEZA 1BZ9B 5L2KA 3TN0D 2QADC 2HT4C 3JWDL 2NTFB 5HD8C 3SDXB 4HBQA 1IC4H 4U1IA 4ISVA 4LHUG 4OI7A 1TITA 3FFDA 3J8F7 5LGKA 4M6NL 4XNUH 3CZJA 2NY3B 4XP9L 3TT1H 1RJZB 4OM1H 5TDNB 4RFNC 1YECL 1M1SA 2F8VA 2AV7A 1V7ML 3H3BC 1E0OB 2Q76B 2AJXL 1UM5H 1KGCD 4C54A 5I8KH 4RRPG 3VXRD 3QH3A 2KDGA 4R4ND 3D3VA 4PV8B 5K59E 2Y6SD 3VFNB 3C2SA 1ORSA 3S3PA 4N1CA 1IAKB 3UMTA 3BN9D 5L0QB 3S8WA 3CXDH 2ED8A 1LO5B 3MA9H 4NQEB 5CGYD 5K93A 1T03L 2QQLL 2FH8A 1AKJD 1RVFL 3QA3B 2BXZA 3ULUC 1GIGH 1EEUA 2FZ3A 4Y5YA 2W60B 3CVHB 5FGBC 1Q9LB 3DO7A 5EUKB 2YOCA 3MX0A 4MNGA 5JOPE 1CF8L 5GGTH 2HT4D 4OAWB 3RGVA 4XNMA 5TE7H 3N9GL 4Q2ZA 2F53B 3HG1B 2ZCKH 3R0NA 5ALCH 1T89A 4Y2OA 3HE7C 1JJUA 5F1NB 5F9DC 1WAAF 1FNEA 5T1LA 3VWKC 1SVCP 3DVNA 2IAND 5GISL 2GSGA 3FKUS 4FQLL 3NGBB 4IOSD 3D2UA 2NY0C 1DLFL 1XIWD 1ZVHA 2DQTH 2OR9L 3VXOA 4HXBL 1S7VB 3T1FA 1IGML 3ZDYE 5C3LD 3L7EA 1CVSC 1RHFA 5E03A 1A0QH 3H9SE 4XPAH 1XF4B 4GAGL 5FB8A 5JMOC 4F57L 2WUCH 3PWUA 5E8PB 4AG4H 4M02A 4N5EC 4HIIB 2OSLB 3G5YB 1GCFA 1HQRA 3IJHB 4KK8C 4NJ9H 3MRNB 4N9OB 3ZKND 4HEPG 1JHKH 3RDTA 5IJVB 1B6UA 4AM0B 4TSCH 4N0UA 5KVEH 4GQ9H 2X4TB 3FN0L 3PABB 1WCQA 3CSYB 3AXLB 3L3HA 5F3BA 3SDCD 3P4MA 3ULUD 4CU6A 2BY2A 2K7QA 3NTCH 1CDGA 4PRPA 3WS6C 2R0WL 5D8JL 5TGBA 1WFTA 1OM3L 1PG7X 3MYJB 1CD9B 4OD1H 3EO0A 4Q97A 2VISA 3V2AR 3BP6B 1TQCC 1JK8B 1AFVH 3HE7D 4QRPE 3I75B 2EDRA 4LEOA 1XH3A 4KJYA 4AIZA 5SX5H 2FGZA 2HH0H 1UA6H 1U8MA 4ALAH 4LCWE 4K8RL 4YDJA 4K7PX 1DUYA 3U36A 2VLLA 5F9JA 4J6RH 3Q6GL 4LVEA 5EU7C 4X5WB 1G9NC 5ESVB 3RWIB 2D2OA 1FLTX 4N5ED 4M62H 2DDQH 1AGBA 4OKVB 3BI9X 3CDCA 4C83B 1KSRA 4E0RA 5A1AA 4MCZA 2XN9E 4KK8D 1FGVH 4WNQB 1MCBA 3ZDXE 5CZVL 3PGDB 2XZCH 1PYWB 1KCVH 1NFDB 4KV5F 4GMSL 4ONGH 4ODVH 3T1WA 3PQYB 3NAAH 4RIRB 5D7SL 4AEHH 1EZVX 4IIQC 4QRTA 5GS0H 3LEVH 3BZDA 3JV6B 4PBVC 4UIKL 4YFLF 3BPCA 1F45A 3MRKA 3BISA 4JZJB 3UTPD 3H3KA 3MNZA 4LSPL 3SEPA 3TV3L 4CNIA 1G7JA 3SDAD 3OXSB 4UI2A 5EH1A 3BZ4A 2AXFB 3UO1H 3CZFA 1R5IB 1JHLH 4M5YL 3R1GH 4JZNA 1MOEA 2CDEB 2ILLA 3VGAB 5FV2A 4GMTH 1F3RB 4P2RD 1IQWH 4HCRL 4CDGC 1M7XA 2VITA 2R0ZH 3IDMA 5I6XB 5CILL 3X12B 3QR2A 4PGBB 1KTRL 3DJ9A 3C5ZA 2Q86A 5SWSD 2ESVE 1DBJL 4HX1B 1YNTB 3SDYL 1OP3K 1AGFB 3IJSB 4G43B 3U30C 4P4KB 4M6AA 4M1GL 1JGLH 2HT2D 2R39A 1B4JL 5KJRH 4NC2B 1XF3B 3FOLA 3UBXI 3S35X 5CLWA 1WBYA 4WY7H 4HDIA 3QUKB 1I8MB 3T09A 3W9EB 1R6VA 4Z7OE 4R3SA 2VLRE 5C07D 4LHUB 4W81A 1MLCA 3ARGD 2ENYA 1KELH 3PL6B 1SEBA 1JPSL 4JM2D 3V5KB 1HHKB 4L1HA 1G9MH 2EC9U 4DK3A 5HPMA 1SY6A 1C16A 4JE4B 1T20B 4X98B 1JHTA 1FSKC 4JFXB 1MAKA 2ICWJ 5IBLD 5C9KA 4OZIA 3F12A 2H2SD 4MWFA 3OJVC 3BUYA 4UQ2B 1QYGL 1PLGL 4JPVH 4MX7A 5DRWB 4L4TD 3P77A 1PG7W 1FFPB 4BQ9A 4QRUA 5ANMA 4HC1H 3AREC 3F62A 3VG0L 1FAIH 3RUGA 3EBAA 2ZKHL 3IETA 1TFHA 2ZUTA 4QHNA 5BJTB 5JW4N 2IPUK 4JRXB 1JF5A 1KT2B 3O2VH 3VFSB 1ZLWK 2YZ1A 4GKOA 4CVZA 4J1UB 4HK3N 4PJFF 3BVNB 3FQXA 4WHTB 3I3EA 2G9HB 4GKNA 2YD3A 1PGRB 3HMWL 5T3XE 2OK0L 3QPXL 5JHDA 5IEKB 1DQQB 4D9QD 2WY3A 5FGBA 2NY7L 4H0HB 2W0KA 1EFXD 4WCYH 3VXRE 1S9YB 5SWZE 2V7NB 3B9AA 1INDH 3DXAD 4JFQA 1SYSB 4AQOA 1ZVYA 2UWEE 5HI3C 1R5WA 1QRNA 2WP3T 3L95B 3ULVD 1Q1JL 4NN6B 3O4OB 4G6JH 3T2NH 4O51A 2QTEA 2CIIA 5KS9B 1NUFA 3MBEC 4YIQA 3SJVA 2JF1A 4X83A 1JRHL 4OGXL 5JA8B 1HK6A 1Q72L 1A14H 2XKNB 3R06A 2VDRL 1CDBA 2NW3B 1UM4L 1P69B 4KZDH 3JZ7A 4UUJB 2E8YA 3U0TA 1DANT 5IV2A 5HHQA 3SOBL 1B4RA 1CS6A 5GJTL 3RWHA 3I2CH 4V2CB 5EOTA 5E5MA 3TO4C 5I19H 2VOTA 2I07B 1NCWL 3DTXB 3VFVA 2X4UB 5IVXA 5CEXA 3IDUA 3O3EB 4KJQC 1A2YA 1U8KB 5C6TH 4LARL 2I25N 5DTFA 4AEIL 3U7YL 4NQEE 3WS6A 4LPTA 3GKWH 2OZ4L 1A3LL 3C60C 5ISZA 3HRZA 2YPVH 3UC0L 4DK6A 2DRUA 4C56A 4EEEA 2ZUUA 4L8SB 4QTHA 5C0IB 4Z7NF 3VGHA 4P0DA 2F53E 3CX5J 3HG1E 5FYKL 1M4KA 5C0AD 3GHBL 1JCKA 3L1OL 3RWFB 2F15A 3D0LB 3WJLA 4XPTH 4HJGB 4P99A 1VFAA 4JY4B 1OWWA 3G5ZA 3QRGH 4MNHB 4WJ5B 3I85A 3T8XB 3WV0A 1VEMA 4LSQH 3HI1A 4ZD3L 1FVCB 3D39A 4GSDH 3TA3A 3V52H 1HHGA 2YRPA 3BJ91 1S9WA 5DD6A 4XBPB 3I02A 2D31B 3MV9D 5B21A 1S7SB 3T0VA 4ODSL 1I4FB 5DVMA 5DO2D 5DD1L 2FHCA 1LO4L 2VDOL 3UTZA 5JIHA 4IIQA 3W9DB 3BZEB 2BHYA 3C60D 4WU7A 3VG9B 3AAZA 2X70B 4X80L 5T1DH 4U1SB 2C5DC 1CDIA 1W0WB 1TJHH 4WEUD 1BWMA 1JPST 1AGEA 1H3UA 4OGYH 2P44B 3X3FH 4XT1C 1T04B 2CO6B 3HI6H 4BZ2L 1KB5H 1QD0A 1L7TL 1NGWA 5ID1B 1M05B 1QSFA 3LKOB 4WFFD 4K94H 1GC1H 1H3WM 1HINL 2CD0A 3CK0L 1S7QB 2F5AH 3UTPE 4KK9C 1JZ6A 2XPGA 5E8DH 5C0FA 2A2QT 1J8HA 2B5IC 2EDOA 4WGVB 4JO3H 4ZQKA 2N56A 2IQAA 1BZQK 4JLRA 3MGTA 4MXWH 3LV3A 4N8VG 4P2RE 4XRCA 35C8L 1QLFA 1C5DB 1BD2D 3ZO0A 4A2MA 5DS8A 3OB0K 3H3PL 2VC2L 1NFDE 4DGIH 3L7FB 4HWBL 4UTBH 2AK1H 4F15B 2OTUA 3RWJB 3C5SB 4V2BA 5DK0B 1ZHBB 2FRGP 3D6GA 5SV3A 5D1QB 1CLCA 1S5IH 1BBJB 4BUGA 1WLHA 3MUHL 3CFBA 4JFFA 5B22A 1P84J 5KG9A 4X4ZA 3DGGA 4GRLC 5C07E 5E56A 5A2KH 3UJIL 5MHSE 3MSPA 1Z3GH 4NFBA 2P8MA 3AREA 1MI5A 2Z4QB 4NCC1 5I73B 3GI8H 4HUVB 1I9EA 3AS3A 5CJOH 1F00I 4KK9D 3P0VH 3S96A 3QHZH 4Y4KB 5IOPA 1HKLL 4JRYD 4X99A 5T1MB 4HGWB 3ES6A 1Z9LA 3CLFL 4WEBL 5GGRA 2NR6C 3PDDA 2WLZA 4H26A 3B9EA 3TO2A 3T77A 3VXMD 1WAAA 3EJYC 4CN4A 5EWIL 4GW4A 3DWTA 4LASL 5DUBA 4ZAKB 5IMOA 3TZVA 3B2VL 4JY5L 4TTGA 1TQBC 3W0WB 4YXKL 4HH8A 2BSTA 1PEWA 3L6FB 4Z7VE 1G9EA 1O7SA 2EE9A 4DKFH 2Z8RA 4BUHA 2LTQC 4G6FD 4WUUA 4HUXB 2Z31D 4QNPE 3NCCB 5TE6H 3L3JA 5F6HI 3MBEA 2Z35B 3H42L 3HAEA 4PP2B 3THMH 1CXFA 2NQCA 4Y19B 4I4WB 5DWUL 4ODTL 3ETBF 1MCPH 4PTUB 2WBJB 1U3JA 5E8EB 3RVTD 5FFLA 1URLA 5DD5H 4YHLH 4R2GC 3BYTA 3TO4A 1QTYT 1UJ3C 2DYPB 4X5XA 2NR6D 3OB8A 4WU5B 5AD0A 5DQDH 1YEJL 4K3EH 3QUMB 3G04B 1D5ZA 3RVVC 1DQJB 2V5MA 3EJYD 1T3FA 2MQ3A 3EYSL 1CICC 3WFBH 4CJ0A 1FNGA 5C1MB 3MYZA 1W72A 1TVBB 3KVQA 3CPLA 3IXTB 5A3ID 4YFDB 1A6AA 4JN1H 3EO9L 2MWCA 2NPLX 1T1ZA 5AUMB 4PJ7A 5KVMC 2ZPKL 1B9ZA 3LRSB 2PO6A 3QIUB 3HMXA 3BD4A 5H2BA 4RDQG 4NO2B 3UJJH 4JHWL 2YD2A 1UCBL 1OB1A 1U58B 1PZUB 3QNXA 1IZKA 2PW1A 5EO9B 5KS9E 5GGQH 3AS0A 4P2OB 3OKOB 1T1XA 5GIRA 3V5HA 1QO3A 4KJWC 5C0BA 1AP2B 2YUXA 4ZYKA 1X5XA 4NKOA 3LSOB 3ARBC 3FFCD 4QGTA 2IBBA 4U0RC 4WENB 4R2GD 4MMZC 3RBSA 5C0AE 1V3JA 2AEWA 4MHHI 4OCYL 4OB5L 4ODXA 3QNYB 3RVVD 2X1PA 2ZWLT 1UQSA 2P7TB 2ATPB 3LQAH 1S7WA 1WWBX 2UVFA 5DR5H 1DSFH 3LHPL 3QULA 4UT7H 4ELME 4KKAC 3U7AA 5JPMA 5DD3H 3SY0B 5C7XL 2BOCA 4OGAD 4NNPL 1M7IA 4JGJA 5E2TL 5F7LB 2R1XB 1C7SA 2BJML 4KTEL 4XPGH 3WD5H 1W0VA 3QG7H 4PJ8D 4U1NB 3BSZL 4X7SH 1B0RB 3HS0A 1FRGL 2NY2C 4FA8A 2D0GA 5EFIB 3ARVA 2X89A 2JCCF 2JJSC 2QQNH 3OKYA 1JPGA 2Y06L 4FQIH 3JV4B 4JG0H 4ZUTA 2E27H 3DMMD 4N8VB 4KJWD 4NC1E 2NYYC 3PV6A 4K7FB 5DHVH 3ARBD 4OT1H 3X17A 5CIPB 4HKJB 3GMLA 5DQ9B 5JOEA 4P46C 3FRPA 4N0YL 5E2VL 1UACL 4YHNA 4XCNA 2IF7A 5FAAA 1U8LB 2V7HB 3CH1B 4UT6L 4HS3B 3WL9B 3QDJB 2BNQD 3GO1L 4M48L 3RZCD 1ZWIB 4HLJA 4S1RL 5E9DD 5IHUH 5KANG 1BMGA 1IJ9A 1CFSA 3WFHA 1NEUA 5MENA 5ACMA 3WE6B 4LPCA 4LGSB 3P30L 3D69A 4LMQE 4PJCA 2OI9B 5HGAB 2QSTA 3MXVH 2Z92B 1L6XA 5H37H 5JQ6L 3SKNB 2QHRH 4GRLA 1GOFA 3RIFF 2Q6WB 4PJFA 4YAQB 3X11B 2AXJA 4ONHB 2R2BB 3MRGA 2J5LC 3QI9B 4LSUH 2NYYD 1HQ4A 1IGTA 3FO2A 4I77H 4F3FB 1N7MH 4LF3B 1HN1A 1K2DB 4RFOL 1OW0C 3QCVL 1R3HA 1WFUA 1IGFL 5IB2B 2XZAL 1AGDA 1DBAH 5LWYL 4OCLC 3U79A 1F6AA 4P9HH 5E2JA 1BVLB 1MF2L 3EZ8A 3FTGA 4Y16D 4DGVH 1QFHA 3ARUA 1A47A 4XXCC 1XZ0A 1HILB 1T7XA 4ZFOA 2NY4B 1OAXH 4XBEH 3LEXA 1FFRA 4MAYC 1KBGH 3DX8A 4JRYE 1CT8A 5E6YA 3QEHB 4QT5B 4YR6A 4GKZA 3MREA 2G2RB 3MV01 4FP8H 1FNFA 1KIUA 3JWDC 4OLWH 4LBEB 2ICWB 3VXME 4MGXA 3VXPB 1ETZB 2MKLC 3P9MA 1JGUH 4XWOD 5E2UL 4DFHA 1GH7A 1BIHA 1UYWL 3MLRL 5BS0D 3TYFA 3EFFA 2ZUXA 5I1CH 3H7BA 3QQNA 1R3KA 3MJ8B 3P0YL 2I27N 3MUGA 4HUWB 5JZ7C 3RIFK 3DSFH 1CFVH 1UJ3A 4NM4H 3MRFA 2YBRB 3O3BA 4I0CC 4JO1L 4PRBB 2FDBP 1CFQB 1HNFA 2X4RA 4GW1B 4KROC 5GZOD 3RIAF 1BFVL 2ARWA 3GSWB 3WIHL 4WW1B 3FAWA 3A0OA 1NBZB 5TFSH 4MJ4A 4AH2B 3NFSH 3LKPB 2VZ3A 2WQ8A 1CICA 3RY6C 2ADFH 2A6DA 2FEEL 1GOHA 3IFLL 4WO4A 4LLUA 5KSAC 1BQSA 2PCPA 3KR3H 2X7LB 5KVGH 1J0KA 1CTOA 5GJSH 1VFBA 2BRRH 2CDFB 4MJIA 3T3PE 1MEXL 2OQJB 2J6EH 5IKCA 2OX5A 5FK9A 4D0DA 2MTPA 4MXQC 2A9NH 3CVIH 4CL7A 5IEHB 1YEKL 5KBNC 4EI5B 4F8TA 1LMKA 2JK5B 4RCAA 1NJ9A 2FWOB 4UU9B 1YN6B 2EH8H 2J8UB 1UWEH 4CKVX 4X7DC 5T3ZD 3DETC 3LD8B 4Y19E 2GJ6D 4OM1L 3VCLA 1F8TH 1NAMA 1OGAD 1PG7H 3HCVB 1RUKH 1BBDL 5TQ2L 3E6FA 2ADIA 1GL4B 2G75A 1OAUL 3NIGF 5CKAA 1UM5L 3Q5OA 4LL9A 3I6KA 5I74C 3M45A 5F6IC 3LPGA 4Z76B 2C1OB 2VLKB 1IILE 3NMEA 5DMIH 2OXGA 5KW9L 3VMOA 2FIKA 5L2KB 1V5JA 3GBML 3ZL4H 4UAOB 4ONOA 1EXUA 4ISVB 2ARJQ 3O3DA 5BW7C 3OKNA 3WHE1 4Z0BH 3S88L 4YX2L 3PXHA 4KUZL 2GKIA 2P5WD 3V8CA 3RIAK 2OCFD 3I9GH 2XRAH 2FYYA 4M3KB 5GGTL 4DEPC 1A7OL 5TE7L 3MGAA 3QH3B 2ZCKL 2JIXB 1DQMH 1KF9B 4BYHA 1R5VA 3D3VB 3ZSSA 3ISWA 5CEZH 3CUPB 3QT2A 4Y7MA 1UENA 1G7PA 1ORSB 3VWJA 3DETD 2FECL 2KBGA 3VFTA 2O26U 3EO1A 1I3GH 1E4WL 3U46A 3ABZA 3Q2CA 4K8RC 5CHNA 5J11C 4C59B 3SE8L 3F58H 5GGSY 5IFAL 4NQVA 1XGRA 4ODBD 3MLYH 5D72H 3QUZC 2PN5A 4Y5YB 5EZOL 3QDMD 3QHFL 2GK2A 1K85A 3BP4A 3VXSA 3DO7B 1D6EA 4L9LA 1WBZB 2WWKT 1MWAL 2YD6A 4NJ9L 4XNMB 5DFTA 3GNML 5I0ZA 3EOTL 4TRPH 4P57A 2FH6A 3V4UH 1CIDA 4DQOL 1HCFX 3L5JA 1FNEB 5T1LB 4U6TA 4YHMH 2GSGB 1LP9A 3NTCL 4XI5D 3D2UB 3VXOB 3GJEA 3RNQB 3L7EB 3MLVH 1TPXC 5F96L 1RUMH 5FB8B 2VABA 1F42A 4F58H 2KPNA 2RR3A 1AFVL 5FDWB 1KV3A 1K8DA 1HQRB 2BNQE 2HH0L 1UA6L 3GMOA 4ALAL 3RGVD 5EUOF 4JJHA 2HKHH 4FQXC 5A2IH 3RDTB 2OL3B 5FOBA 1DQDL 4N0UB 4K8RD 4J6RL 2ZCLH 3L3HB 4X6DE 5F3BB 1KN4H 1P5UA 2FX9H 3P4MB 4KMTH 3LS4H 1OW0A 4I9WD 4NKMA 4PRPB 4I48A 5TGBB 1BM3L 5J89A 3SE3A 4FNLH 3EO0B 4URTB 4XC1H 1FGVL 2K7PA 2VISB 2Z0BA 1BOGA 5DC0A 1BIIA 2D3VA 4R7NA 4OZGB 3VD4A 4LEOB 1XH3B 4KJYB 1ZXQA 4AIZB 1VCAA 4ONGL 1TNNA 1RD6A 4ODVL 3QDJE 1K6QH 2OL3H 3UPCA 4GG8A 3OR7A 2NY6C 1DBBH 3AM8A 3RZWA 4PS4L 4I18B 3OAZH 3U36B 2APVA 3OX8A 2VLLB 1R0AL 3LEVL 5A2FA 4OLUH 4LP4A 3HLAB 1QFWL 2H32A 4WHYG 4NQCD 5DZLA 3W2DH 3HUJE 4OZ4A 4QHMA 1P7HL 2AGJL 3T3MF 4GAYB 1KACB 1AGBB 1I3UA 2XI9A 1CXEA 4E0RB 2APWA 1JHLL 4LLWA 5T1KA 4NRZA 3R1GL 3O6MH 4MB3A 1ZE3C 5IT2H 1B6DA 2YA0A 3IT8D 3PE9A 2R0ZL 1TJGH 3IFPB 1JI1A 3NZ8A 2DM3A 1U92A 1X4ZA 4PR5A 4M3JA 2V17H 2XIDA 4QRTB 4P3CH 4B41A 3BPCB 3E1F1 1WBXA 3MNZB 4CNIB 2R56L 1G7JB 3DUSA 3BZ4B 1O7VA 3GMMA 4WY7L 3RY6A 2MFNA 3C6LA 3CZFB 5F7MC 5KSAA 1ZLVH 4JZNB 5DJCA 4YGVA 1J05B 3QUYA 4YJZL 5KSBB 4TQEH 3C5ZB 2Q86B 4MXQA 4FG6C 5J3HD 5ICXA 1QBML 5I0DA 2DQJH 3LRGA 1IC7H 2C1PB 3GIVA 1A6ZA 4KMQA 1FO0L 3UZEA 1Q9OA 4X9FA 5CAYB 4OM0L 3KJ6L 4JPVL 3U9UA 1FCGA 3FOLB 4GKSA 4P23A 1WBYB 4HDIB 2EDNA 5DK3A 4FABL 3EDFA 3KNBB 1YEFH 1GGIL 4R3SB 3ZT6A 3NFNB 1FORL 1KIQA 4DUVA 4NPYA 1FAIL 5FGSA 3SQOH 2RIKA 3LEYH 3MV11 5L88L 1MLCB 3G6DL 2CH8A 2R0LL 4RQQB 1SEBB 1QP1A 4UOW0 2QADB 4BQ6A 5GRYA 2PXYA 3O2VL 5F7FA 4HSQA 3ARDD 1XGTA 5HPMB 5J0BA 4QHLA 1C16B 3DURA 1SEQL 3K8KA 5BVJA 4GRWH 1JHTB 3DX7B 5LAXA 3SE4A 4OZIB 2JCCA 3F12B 2GJ6E 5HDQH 3CU7A 1OGAE 3A6BH 4MWFB 3HZYA 2M1KA 1WZ1H 2YPLA 4MX7B 2N1KA 4KTDH 2VIRA 1DE4A 4NWTL 4WCYL 3WSQH 4KC3B 5HHNA 4WI3A 3JXAA 5ANMB 1INDL 5B38A 3RUGB 1F4XL 1IT9L 3IETB 5I8EA 4L4VA 2AV1A 2W91A 2NY1D 3FMGH 3ZE1F 2UY7A 4G6JL 5DYOA 4CVZB 4FQHB 1YPZA 4KKBC 3ARTA 1FCCA 3OF6D 5DRNA 5BQ7A 1EK3A 1QSZA 4FZEH 1FFOA 1A14L 5HVGB 3G9AB 3TVMD 3QUZA 3QWRA 5JHDB 3OAUH 3NA4A 4EUPH 5C9JA 3EOAA 3KLSA 1C1EL 3MLTA 4OLYH 4KKLD 1S5HA 3IF1B 4JFQB 3RX5A 2VLKE 3TFKC 5I19L 1H3XA 3MJ9L 4BK4A 5HI5C 1QRNB 3QJFA 5L2KE 3PNWA 2X4PA 3F8UB 3TC9A 2DI7A 3VWKB 4O51B 2CIIB 2NY0B 3ZKMD 4YIQB 3ZYJA 1ZHKA 3ULUH 3ARFD 3STLA 4M1CD 5D2LF 3R06B 3ZKXB 4LOUC 3U0TB 2XWJA 5IV2B 5HHQB 3KPLA 1FP5A 3HAEG 3O9WA 3QQ4A 1A4JA 3RWHB 4F9LC 5EOTB 4GW5A 4UT9L 4KKBD 3D3VE 4C55A 3C09C 5IVXB 3VFVB 1V3KA 4XC3H 1A2YB 5EPMA 5DTFB 1CIUA 5CD3A 5EOCJ 3QRGL 3B9VA 2E8ZA 2XTJC 2HKFL 3SJVD 2WMPA 3HRZB 3MZGB 1II4E 4DAGH 5IMKA 2NW2A 4MNGE 2BOBA 1MQKH 4WI9A 4QTHB 1KENH 1FZMA 3SKUD 2OR8A 3QIWA 3UCRA 5F7YC 2HRPL 2P5EA 5ADPL 3O8XD 5TQ0H 4ELKA 2Q7YA 4GBXD 4G80A 5JIPA 3O0RH 1G0YR 5DJZA 4CU7A 3HZMA 4Y1AB 1WWWX 4LIQL 3HRPA 5DMGC 5LQBH 1T21A 1VFAB 1ZT7A 3I6GA 3G5ZB 3BGFC 3SPVA 4B7IA 4NGHH 5D7JC 1TJHL 3IRPX 4JREC 3M07A 4PJ9C 3HI1B 1BECA 4V1DD 3D39B 5ISZD 3X3FL 4PFEA 3MOQA 3TA3B 1ZAGA 3T08A 1HHGB 1I1RA 3QPQC 1T83A 1S9WB 5DD6B 1ZLSH 2MCPH 3I02B 1MFEL 1MHCA 1JNLL 3VI4F 4C56D 4J3VA 2IH1A 4ZFZA 3UTZB 4N0UE 5K9JH 4IIQB 2F5AL 1G9NH 4NQCE 4WW2F 1PW3A 2L7UA 2VO5A 1LEGA 1BOYA 2XTJD 2PKDA 4MJ5A 4NNXA 4WU7B 3KLAB 1MREL 2HTLC 4G7VH 2CR3A 1YN7A 3FT4A 1OLLA 5IR1A 4JO3L 5GRUL 5I1IL 1GZQA 3BO8A 4NZTH 1AGEB 4DOHE 2IPUG 4R26H 1UWGH 4JANB 4AYFA 5F8RC 4FFWC 2IWGA 2VAJA 1NGWB 4DGIL 4OBRA 5DFWH 1MNUH 3Q5YA 1MCWW 3T2QA 3ZYOA 4CADA 1GAFL 4NWUH 3U30B 3QIBD 4WI2A 3VDBA 1RPQA 1UWXH 1YNLL 4WFED 3MOAL 1S5IL 3IFOB 4WI6A 3S36X 5C0FB 3V4VH 1J8HB 3P73A 3EFDH 2V5TA 4ZQKB 4UDUB 2IQAB 4JLRB 5ID0B 3MGTB 3JSSA 4EVNA 4EKXA 4Z7QF 4XRCB 1QLFB 3DO3A 2G5BA 5DS8B 4MA7H 1X9QA 4QY8A 1YC7A 1RU9H 5BVPL 3GI8L 5JDJA 1JPFA 4KQ4H 1CL7H 3P0VL 4ZMAT 3FRPG 1LO0H 4NZRL 1FH5H 2OTUB 4YO0B 3VGGA 1VERA 2N7AA 5C0CD 3MRRA 4NNYA 1FSKB 1H8NA 3CCHA 2CXKA 3CFBB 4FFWD 3BP7A 5KG9B 4ZFFA 3DGGB 4KTYA 2AS5M 4P2QD 1UKSA 4PG9A 5FKPB 1IGCH 1FL3A 2P8MB 3AREB 2HJKA 2OZ4A 4UOJA 4JFDA 3S96B 3PWLA 3QCUH 3L3DA 5IOPB 2FX7H 1N8ZA 4X99B 4PV9A 2YKLH 1Z6JT 1S7UB 3ES6B 3ULVH 4M93B 4RX4A 2MNUA 4P5TD 5GGRB 2CRYA 4KDTC 2OLDA 1QG3A 3THML 3W82A 4H26B 2ICWI 4EOWH 2IQ9L 5EZLA 3T77B 3BDYH 1Q0XH 4RBPH 5C0ND 2G60H 2V6HA 4YHKL 5C0RH 4JFFD 5I71B 2AK4B 5J1TC 1MHPH 4Y4HD 4B0MM 2LQRA 4ZDHA 2OS7A 4RAVA 3L3OB 5IMOB 1U91A 5DD5L 1YEDB 2AP2A 3T0EC 3OV6A 3TFKA 1MI5D 1NC4B 4TSBL 4JCMA 1PQZB 5L9DL 4YNYA 5KTEL 4PP1D 4WUUB 2JB5H 1NUNB 1D5MA 1MHHA 3L3JB 2H45A 3MBEB 4OZIE 3WDIA 3HAEB 4UTAH 5EUOA 3CMGA 2EDFA 3WFBL 1KC5L 2NNAA 1KPUA 3IYLW 2CKBL 3VXUA 2GTZA 1A64A 5FM5M 4ODHL 4JN1L 1CXKA 2YD4A 5GGUA 5ANME 1WIOA 3RUGE 2ZUVA 3TZVD 5K9QG 4E5XA 4YZFF 1HSAA 3TO4B 1HSBB 3UJJL 5AD0B 1N59A 5DEFA 3MLPA 2H3NB 2VDPL 5DJDA 3DRQA 2HT3D 2EIZA 4JAMA 5ESQA 1T66C 3C6SA 3QEQB 4HPYL 4HXAH 4TTDC 5CEYB 5MERA 3GK8H 3L5WA 1E4JA 4OIAA 1T3FB 3SGEH 4K3DH 5F7DA 1FNGB 4XHQA 5JHDE 1U3HC 1W72B 4JFZH 3UPRA 4LVOB 3CPLB 3T0ED 3W39A 4PGDA 4JDTH 1A6AB 4BM7A 1A7NH 4HJJH 4HV8A 1T1ZB 4HJ0D 3SGJC 2IH3B 5KOMC 4AENA 1QRNE 3L9RA 3LQAL 4L3ED 2YWYA 5H2BB 1DSFL 2NMSA 4NM8H 5J57B 2EKSA 2O93L 4UT7L 1OB1B 3QNXB 2PW1B 3OKEA 4GXVH 4X6BA 3SJVE 5I30L 1T1XB 4FZ8H 3NH7L 2QQKH 1QO3B 2IAMC 5C0BB 2HLFC 4MLSA 2EZ0C 3AB0C 4NKOB 4XPGL 3RVUC 3IU4H 3QG7L 4QHUA 4X7SL 3WKMH 3AU1A 2E7HA 1JF1A 4HW6A 4WW2C 1QLRA 4F9PC 4X7TA 5IGXH 4WHCA 3Q5TA 2P24A 3MV8D 3EYQD 5CBAA 4FQIL 2VZVA 2YD7A 1UQSB 1AR1D 1T66D 5IVXE 4NO0A 1S7WB 4TTDD 2E27L 4XP4H 4WRLA 1QSEA 3WIIH 2MHAA 2PO6D 4X8JA 4XWGL 3QULB 1CLOL 43C9B 5JPMB 4RWYH 5F7WC 2ZOLB 2BOCB 4OZFH 4LSDA 1M7IB 3O4LD 5ISZE 4O2CA 3ZKSD 1KJ2H 1NGQH 1W0VB 1BFOA 2VL4A 4NN5B 2DI9A 3HS0B 5KANI 4LCIH 4G8FA 2EDQA 4C56E 4QRSA 5BMFH 1BP3B 4OIIH 1DUZA 1JPGB 3GRWL 2N4IA 1QFUH 1T22B 1T1WA 3S37H 4K23H 5IHUL 4LK4A 3MRJA 4J3WA 4ZUTB 1QBAA 3HFML 2EDKA 3JWOL 2IAMD 2HLFD 4JHAL 5EU7E 3PV6B 5CSZA 2EZ0D 4CN6A 4UILL 2B1AH 5T33L 1UEYA 2F8OA 3QFDA 3GMLB 3MXVL 2H9GB 2B5IB 2PNDA 3MGOA 3D39E 5GS3A 1HHJA 4YHNB 4XCNB 1YMMA 3E6HA 1TTUA 3BUTA 1U0QA 1AE6L 2X89D 3KXFA 2WLYA 1N7ML 5D1XC 1FZKA 4RFEB 5HHVH 4OV6F 3EUUA 1CFSB 1SQ2N 4P2CG 3JUYA 3WFHB 5MENB 1ZA3B 2VXQH 4DVBA 1DBAL 4M6OH 1OAYH 3D69B 5ALBH 1HH6A 1DVFC 5GZNC 4PJCB 1EGJH 1UZ8A 1X6LA 4Q6IC 4ZS6D 3ZLQC 4FQ1H 3K0WA 4P9MH 2R9HC 4GRLB 4PJFB 5LBSH 4W70A 4P5KA 3LN5A 5MEPB 1F4YL 2JELH 4NFDA 4U1GC 4Q9RH 2IBZX 3MRGB 1WK0A 1QSFE 2MKWA 5I75C 5HVHB 1HQ4B 1IGTB 3FO2B 4F7EA 1LQSR 1UKQA 5C0CE 1AD0A 2UVEA 1F3DJ 1RK1A 5IVOA 4FP8L 5EA0L 1R3HB 2VSDA 4XNXH 4E41D 4YPGA 4OLWL 1AGDB 5FCUL 3WEXA 1F6AB 1J8HE 3U9PH 3UP1A 1JGUL 3FTGB 3UAJC 2JE8A 4PRNA 4R6UA 2RHEA 1MJUH 1XZ0B 3FN3A 3O6FA 4KK6D 4ZFOB 5DLMH 4JY6A 4KQ3H 1TQBB 3LEXB 1AQDB 3DSFL 3VFMA 4LDOB 3BPNC 3GSNA 4NM4L 1V3MA 2DLFH 1IE5A 2H1PL 5C09A 2LTQB 1CT8B 5D2LA 5DMYA 2Q8AL 2DQIH 1CD8A 5GZND 4YR6B 3C87A 4GKZB 2DQCL 3MREB 4KXZI 1RULL 3HI5H 4XBGA 1WC7A 3B9KC 5TFSL 2LVCA 5EIIA 2BVTA 4I3RL 4HIJA 4JFFE 4NHUA 4YUEH 2VE6A 2A74A 1EEQA 5IMMA 3P9MB 3KS0H 3KR3L 1HWGB 5KVGL 4QXUH 3V6ZA 4QOKA 1G7IA 4I0PC 2J6EL 3BGAA 3M17B 1MI5E 1KIPB 2VDQH 1MJJB 1R3KB 3MUGB 2A9NL 3OJ2C 1UJ3B 2RFXB 3MRFB 3O3BB 3PDOB 1E4XH 4JHBA 5DI8A 3LY6A 4ODUB 2Y25A 4BSWA 3QUXC 1CICB 3E2HA 2XA3A 3SDDA 1U3HA 3IDYC 4W6YB 4O58H 5FUCC 4A6YA 4LLUB 1N0XH 5ITFA 4R90L 2PCPB 1IEBA 1FC2D 4MJIB 5C0JA 4HGMA 1JNNL 2QSQA 4XVUC 5DMIL 5IKCB 4D0DB 2BCKA 3SGJA 3ZL4L 1NJ9B 3REWA 4Y2DD 4WUUE 3QNZA 1P4BH 3PXJA 3N1GC 4Z0BL 2W65A 3RL1A 5BO1L 5HHOD 1JZ8A 4N0CC 3VCLB 4ENED 4MNQA 1IC5L 1WGOA 3I9GL 2XRAL 3E6FB 1F6LL 2ADIB 2G75B 4U0RB 1F4HA 4Y89A 5D1ZD 4F9PA 4WO4D 1DP0A 3I6KB 4KPHL 1GOGA 5C2BL 1DQML 3HNSH 1NCBH 4PDCE 2OJZH 2FIKB 5B3JE 5CEZL 5JW3H 3T2OA 3RAJH 2EE2A 1GHFH 1VGKA 4OF6A 2NLJA 3WDJA 1EXUB 5IK3A 3QUXD 3B6SA 2RJMA 3DVGA 2KL6A 2E7LE 3O3DB 5FGCB 3OKNB 1XR8A 4ACPA 5D72L 5E6ZA 2YN3A 1Q0YH 4XHJC 1U8HB 3WN5C 5I1JL 3PWPD 3FCTA 2VMFA 3KPRD 2NY2B 3VI3F 1BLNA 4TRPL 4PJ7E 1R5VB 4JGUA 2F74A 2WZPD 3V4UL 1MJ8H 1QR1A 1G7MB 4OF3A 3QG6A 5LXGH 1G7PB 3VWJB 3VFTB 3ZMRA 2NX5D 3GSVA 5DJ2A 3U46B 5CHNB 3WXVL 4U2ZA 4KV5E 3ILPA 3MLVL 4NQVB 5E1AA 3I84A 4RMTA 1RUML 1T0MA 5C0BE 1RZIA 2HRLA 2HVKA 4G5ZH 5I18H 1IMHC 4P46B 4LCCC 1AO7D 3BP4B 3WUZA 5LCVL 1D6EB 2OXHA 4L9LB 5JR1H 1FZOA 2HKHL 4QXTB 1BREA 4EZMA 5F21B 3BAEH 4IRSA 2EYTA 3MA7A 4P57B 5D1XA 2ZCLL 4FFYH 1KN4L 4AT6A 2FX9L 1ED3A 4KMTL 4DW2H 2VKXA 1I7RB 1QVOA 3D18A 3V6OC 3GJEB 2CK2A 1DVFA 5B4MD 2QHLA 4Q6IA 1IEHA 5KZCB 2VABB 4I3SH 3MMEB 5IMLA 2HLAA 4NKIH 4ONFL 4DVRH 5DC4B 1K8DB 3VXSD 3UJTL 3GMOB 4LLAA 3NCJH 1DBBL 4OZHF 2X4OA 2CJUH 5FOBB 1DN0A 1HHIA 2R8SH 1DL7H 4QRRA 1GGTA 1SJXA 5IB4A 2EEBA 1PZ5A 2PYFA 3W11C 3QRFM 3TPKA 3SKJH 3W2DL 3MRQA 5BV7H 4DN3H 4NKMB 5DJ8A 4I48B 4BZYA 2DM2A 1ZGLA 4G9FA 4LAJH 3OKDA 1CWVA 5JXAL 3W5MA 1RZKL 2GJJA 4R4FH 1EJOH 4WI8A 1BIIB 1L7IH 1TJGL 4R7NB 1T2QH 4PJGF 5SX4I 1Y18A 1CDUA 3FO9A 4FS0A 3TH4T 4YDIH 4WV1A 4GG8B 4MAYB 3OR7B 1NLDH 4FQQA 3HC0A 4G59A 3MACL 3OX8B 1CLZL 1DQLH 4E41E 2H32B 5MENE 1KEGL 4Z7WF 4OZ4B 1HYRC 3SDXA 3B9KA 4QHMB 1L0YA 4PJCE 3WS3A 5MEQA 2XOTA 4LLWB 5T1KB 4NRZB 2OYPA 1M6OA 4HMEA 4QCIA 3RWGA 4PJFE 5TDNA 3BYYA 4I0PA 1SJHB 4UBDC 3MCG1 3NZ8B 1JWMA 3FB8A 2BK8A 5E6IC 1U92B 4BQ8A 4PR5B 3SE9L 3W11D 3D25A 4Y4FC 1FIGH 5GGTA 3NIFF 1LGVA 2DQJL 1IC7L 3HC4L 4KROB 5J6HA 1N6VA 4PV8A 3JWDH 1WBXB 3LKRA 3LS5L 3TNMA 4O02L 5DQJA 1MH5A 1IAKA 3DUSB 3T0DA 3TWCL 1QA9A 3MRPA 5T3ZH 4EIGB 3GMMB 3C6LB 1NSNH 4P5MA 4ETQA 4PJIE 5KSAB 5DJCB 4YGVB 5T3XL 2AEQH 3QUYB 1X3DA 4EJ1C 5FYJU 2W60A 2E9IA 1G6RL 3OXRA 5JO5A 1D9KC 4KRPC 3UZQA 5ACZA 4OFKA 4MA8L 3VXQA 4NRXA 1NCTA 4LFHD 1A6ZB 5HDQL 4FFEX 1UB6A 3A6BL 3PHQB 3EJZD 1Q9OB 2AJVL 1S9XA 4N0CA 3U9UB 3MR9A 4GKSB 1OQOA 4P23B 1S7VA 1T03H 1NUDA 2OMNA 2QQLH 4OD3H 5E6ID 3WSQL 1EIBA 3OHXA 1KIQB 2BVYA 4NPYB 4P4RA 3RTQA 1MCCA 2FHBA 4Y4FD 2FSEA 5F6IB 2VLMD 4LDEB 1C8PA 3ZE2F 2W92A 2PXYB 1HXYB 1BVZA 5TPWH 1OD7A 1KTLA 2DKSA 1XGTB 2X05A 3N9GH 4QHLB 3DURB 5BVJB 5IJVA 5FA3A 4AM0A 4ZTOL 5D7LD 5EU6A 5LAXB 3KPPB 2JCCB 3VE0B 4Z7NE 4TSAH 3HZYB 3ESVF 2OR9H 1DLFH 4YK4C 3D85D 5L8KB 3LN4A 4ZSOE 5E94A 1WZLA 4HXBH 3DECA 4OLYL 2VIRB 1DE4B 2FBOJ 2X9WA 4DEPB 4MJIE 5B38B 4GAGH 2P8PA 1JWSA 2VZUA 4LRNH 5I8EB 5ICZA 4XX1G 4L4VB 2AV1B 2WAHA 1OL0A 3V7AG 5DYOB 5GPRA 3BKMH 3VRIA 3CH8A 5DRNB 5I66A 1IKNA 2VLJD 1KTDA 3JTTA 3RWIA 3B2UD 2FNBA 1KLFA 2MSPA 3QUZB 3TT3L 1IAIL 4HFUH 1HWHB 2IFGA 4X6CF 4AEFA 4LCCA 2YPLD 5D8JH 5C9JB 2UY6A 5MI0C 1EAPA 3C9NB 3MLTB 4OKVA 1OM3H 4LCUB 3TBSA 1FIEA 1S5HB 3WDHA 1J7VR 3QJFB 4XC3L 1PYWA 1A6UH 2X4PB 4H0GA 4UIMA 5DJXA 2ED7A 3PQYA 2RGSA 2ZSWA 4K8RH 2XG5A 5EBLA 3V6OA 4QXGL 1I1AC 1FJ1A 1TPXB 3Q6GH 4DWHA 1S9KC 1AO7E 3E3QC 3IXAA 3OXSA 3KLHC 2EEDA 1MQKL 2XWJB 5AYUH 3KPLB 3NACL 1KENL 3O9WB 3QQ4B 2B2XL 3WNPA 3ZKQD 4FQXB 4GW5B 2HFFB 3WXWL 2Y7QA 3V0WL 4JPKH 4HIXL 3X12A 1ZANH 3CFJB 5C6WH 4HKZA 4PJHE 4KKNA 4HX1A 3PV7A 1YNTA 5D7SH 3NIDF 5CD3B 4G6KH 1NCNA 3CFDA 1S9VA 2GSIA 4XVJL 1AXTH 2EDTA 4YFLI 5IMKB 4MQXC 2NW2B 2PTUA 4J23A 3VXSE 2F54A 3FB7B 3Q1SL 1ZLSL 2MCPL 3CDFA 2NXZB 4I2XA 3VJ6B 4S0UC 5EBWA 2D7OA 4XXDA 4PJEF 1FNLA 1FZMB 3QIWB 4C4KO 2H6PA 5DA4A 2P5EB 1RURL 2NY6B 1OF2A 4HCRH 2Q7YB 1ODAA 2A6KB 4G80B 4HC1A 5DJZB 3HZMB 1HHKA 3UYRL 1RZ8A 1LP9E 3ROOA 1DBJH 4G7VL 1ZT7B 3SDYH 3I6GB 2YRLA 1KNOA 3SPVB 3C8KA 1T20A 4PRHA 4XMPH 5CGTA 5AZ2L 3BH9A 1UWGL 1IM9D 1B4JH 3K2UH 5DD0H 3H9ZA 2ED9A 5DRWA 3WIFA 2AQ2A 1MHCB 1MNUL 4DUWA 2IH1B 2DQGH 2XXMB 1KJ3L 2Z91A 4ZFZB 4EQ2A 1LE9A 3RX7A 3O81A 1MCNA 2FEDC 5EORH 5D7IF 1LEGB 4JRXA 1JPSH 3FO1B 2R4RH 3P9WB 5AZEL 3EHBC 1DANU 3LPFA 1YN7B 3V9FA 4OV5A 4MQXD 3FT4B 1OD9A 5CGMA 5IR1B 3EFDL 4NO3A 2VTFA 1HYSD 3BO8B 4HUMB 6FABH 4EN3A 2XQBL 1NH6A 1MCOL 4MA7L 3VXTA 1PLGH 2A0LC 4MS8D 1CL7L 3QEGL 1D9KA 1BZ7A 2WM0A 3EKCA 4KUCD 4CADB 1OT2A 4D0CA 1LO0L 4W4NA 3VG0H 4OI9A 2DIAA 2ZKHH 5CJ8A 4NBYB 4PJ5B 5CMAA 5L8JB 2XQYK 1K8IA 3SO3B 1EUUA 1NC2D 4EVNB 1NCUA 2AJ3B 4KVCL 1FBIH 2GI7A 1HOCB 4YHPA 2G5BB 3HMWH 3D5OF 3PGCA 4H88L 2R15A 1YEGH 2XKNA 4HLZH 2OK0H 5GS1C 4WVRA 2VXVH 1JPFB 2FEDD 5T5NF 1T5XA 2L0DA 3REVA 2ZOKA 3QCUL 3QFJA 3QO0B 1CG9A 2FX7L 3EHBD 2YKLL 4XCCH 3ULVL 3MRRB 2I07A 4TULL 4NNYB 3OGOE 2E3VA 4ZXBA 3TJHD 4E42A 5IQ9B 1FNSH 3CCHB 4APQC 4NSKA 3DROA 4ZFFB 5C0RL 1CDCA 1MHPL 2YA2A 3FJTA 4GLRI 4PG9B 1J86A 4OGXH 5C08A 1D7FA 1Q72H 1FL3B 3BEVB 2HJKB 2PETA 2VDRH 3LDBC 2L7JA 1OSPH 4JFDB 3QJHA 3UX9B 1KTKE 4L8SA 1BVKA 1A7BA 3L3DB 5K59F 1N8ZB 5GJTH 3MODL 4PV9B 1E4XI 2VN4A 1WFOA 3SKOA 3MNWA 1DJSA 3QQ9C 1NFIA 3RWFA 2WIMA 3LQAC 2VZSA 5K9QI 1OCWH 4LARH 5CP7B 5EZLB 3U7YH 5JXEA 3KDMA 3GI9H 1DBMH 1RIVH 1CGTA 4GQPH 4MNHA 5EU4B 4ZDHB 4RAVB 2VSCA 3V7MA 5JQHC 1KCRH 1P6FA 1P4IH 1U91B 1FVCA 3BZFA 1E4KC 1OSZA 3BE1L 5EZIL 3STZA 1FYTD 3UTTA 5CSBA 2J12B 4X0KB 4XBPA 4YNYB 3ARWA 1KB5A 4JKPH 1S7SA 1AR2A 4APQD 1NCCH 2VLJE 4JFED 5FYKH 1MHHB 3GK8L 2GAZA 5ELIA 4ZFGL 3BZEA 5EUOB 1B2WL 1I1AA 2VKWA 4K3DL 2QSVA 4OZHA 1VEOA 2NNAB 2YPLE 1KPUB 4JFZL 3TNNA 4CDHA 1XGUB 3VXUB 2GTZB 4MVBC 5GGUB 2CLRB 1P5VA 4HJJL 4NZUL 4LLMA 4AJ0A 2VL5A 4LQFH 4O9HH 4E5XB 4Z8FL 1FVEA 2VWEE 1HSAB 1U95A 4LNRA 4GG6F 3C09B 2B1HL 2BP3A 2ICEA 4MXVF 1N59B 4JZOA 5DEFB 4JJ5A 5DJDB 5HYJA 3IKCA 1YPZE 4JPWL 3DRQB 4ODSH 4JAMB 5MERB 3C6SB 1LO4H 4PJGA 4FZ8L 4QKXB 3L5WB 2QQKL 5KSVA 2DQEL 1J1PH 2IG2L 1LK3L 2DF3A 3IU4L 3QXWA 3JWOC 5F7DB 3WKML 1KXQE 4D9LH 3UPRB 4X80H 3CSPA 3GGWB 4CGTA 3W39B 1MELA 1FC1A 4PGDB 1RZ7H 4XNZC 4HV8B 3NZHL 4U6YA 2E9BA 2ITDA 4ZPVA 2DWEB 4MJ2A 2E5EA 4AENB 3L9RB 5JIKA 5CJQH 3WIIL 1L7TH 3D0VA 4XP4L 3UTSD 2KZWA 2YC1A 5I1LA 3MRLA 1P7QD 1FL6A 4RWYL 3LB6C 3OKEB 1U8JA 5F9WC 1RJCA 5DK0A 4YEFA 4PREA 4MVBD 5D7JB 4PJ9B 4JREB 4QHUB 2YXFA 3OL2A 1Z2KA 3AU1B 4LCIL 1JF1B 3SN6N 5D96C 5IVZB 1BBJA 1QLRB 3T0BA 4X7TB 1AC6A 4IOFD 3ZDXF 2P24B 2ORBH 4OIIL 5CBAB 3QB7C 3O3AA 1MJ7L 1QFUL 3S37L 3QYCA 1A7RH 4NO0B 3FRUA 3H3PH 1TETL 1X5LA 1QSEB 4HUVA 2MHAB 2X44D 1JBJA 4X8JB 2BXYA 4B7LA 4HUUA 4HWBH 5LGHL 5FYKU 2O61A 1YEEL 5T1MA 2JLLA 4QRQA 3IRZA 4XPFL 4QHKJ 1BFOB 4RMRA 4EI6A 5HBBA 4G8FB 4EDXA 4QRSB 5DHYA 3JV0A 1DUZB 4I5BA 2P5EE 4ZAKA 3RVXC 1T1WB 3RHWF 3LB6D 5FUOH 3CX5K 3MRJB 2PTVA 2FB4L 3W0WA 1GYAA 3H9HA 3L6FA 2GK0A 4KK5D 2VXQL 1ZTXL 4M6OL 4XVSL 3O2DH 1OAYL 2ZSVA 2QKIA 1EGJL 1HKLH 2WSKA 3QFDB 1AHWC 3E8UL 1P9MC 2P43B 3B5HA 2VR9A 3CLFH 4WEBH 4PBXA 2Z35A 4OCMC 3MGOB 3RJQB 5DMJB 1CD1A 4MMXC 5E00B 1Q8MA 5LBSL 1HHJB 4ZUVA 4KAQH 4DN4H 4S10A 4I4WA 4Q9RL 2JKXA 1N3NA 3E6HB 4Z77A 5GS1A 1VENA 4XTRC 4PTUA 1F90H 4KI5F 3KXFB 1E6OL 4LASH 4ZOEA 3VGBA 3B2VH 1FZKB 3UROR 4JY5H 3RPIA 4UDTB 4JM4L 4WU5A 4NKQB 4DVBB 1ZHNB 4J8RA 5FGRA 1HH6B 2VAAA 5HHMD 1XCQA 2R23A 3H42H 1S78C 4P5KB 3LN5B 5DMKA 4KRNA 5DLML 4Y8AA 3SGDH 5DWUH 4PG2C 1YMMD 3BHBA 4MQSB 2MQ0A 4D8PA 1UM6H 5GSRA 4F7EB 1QBBA 4JO2L 4WWKC 1I75A 5AUMA 1AD0B 3OAZK 3DUUA 1KUMA 1RK1B 2CGRL 4CMHB 3LRSA 2ZUYA 3RHWK 4R97C 3K8LA 2X10A 2WWMD 4Y5VA 5IW6A 2GT9A 3WEXB 1U58A 1CQYA 5EO9A 3FQWA 4P2OA 4PRNB 2D7PA 4X6EA 3IAGC 2NXYD 1MRCH 3EYSH 2AJUL 4JY6B 8FABB 3VFMB 4JHZA 3GSNB 3KPOA 5L6YL 2LAGB 3O41A 5D2LB 3EO9H 3KG5A 4GRWF 1G7QA 1PKQE 3QNYA 5EO1A 2ATPA 3KPSA 3B3IA 1BJ8A 4XBGB 3TM6A 5I9QC 5DZNA 5EIIB 1T0PB 2E7CA 1X5YA 1UCBH 4NHUB 2A74B 3QXUA 4O58L 2P48B 2B0SL 5IMMB 1QNZL 5DHVA 4QOKB 1G7IB 5CSGA 5C6PB 3M1BA 1ZK9A 5BZDA 3O6FD 4QTIL 4JFDE 1ITCA 1I8LC 3I3BA 5C70A 4MB4A 1MFCH 3KAAA 5C09D 3QDGA 5DI8B 4KJPC 4OB5H 1JZ5A 4QLRA 2X09A 3BRGC 4BFGA 5ABDE 5F1IA 4PJEA 4BSWB 4YHIA 4NQTA 5JOFB 2BDNL 1Z0MA 5FOJA 3E2HB 2Q20A 2Q1EA 1U3HB 4A6YB 3CD4A 3BQUC 2IPKA 5C0DA 1IEBB 3SO5A 3A67H 4NNPH 5C0JB 5E2TH 2W9LA 3K74B 2BJMH 4KTEH 3S3JA 3H9SD 3HNSL 1NCBL 2OJZL 2BCKB 3BSZH 4G6ML 5JW3L 3B43A 3RAJL 3SBWA 1Q38A 3BGMB 2V7HA 5JHLL 1GHFL 4HS3A 3REWB 4JN2A 2A73A 3QNZB 1PDKA 3ULUF 3EIFA 2ADJA 1LILA 5F9AC 2COQA 3DV4A 2W65B 5EUOE 4MNQB 1CGUA 3AB0B 4PRIA 5B8CC 4M9PA 3SDDD 5D7IA 4ERSH 5CUSH 4RGNB 3SCMA 5E95B 4YAQA 3MV7D 1MJ8L 1UACH 3G6AA 2DLTA 4TYUA 1MVFA 1VGKB 2NLJB 3RWCA 4UT6H 2V5SA 4K3JH 5E0QA 5IK3B 3QI9A 3GO1H 3DVGB 2CLVA 1XR8B 1WIUA 3BQUD 5F71A 2DJ4A 4G5ZL 5I18L 5GRJL 4EBQH 3ARQA 3VRJA 5CJ5A 2Y07H 5IB2A 3FCTB 3DPBA 3HE6A 3OKLA 1T6WA 1ZLWH 2C7UB 1J18A 2BVUA 1A8JH 5JR1L 2AXGA 3U0PB 5JQ6H 1BLNB 2XN9D 5K9OB 1RZKC 3OR6A 3CFKA 2F74B 1HILA 1AJ7L 1QR1B 3IAQA 4BSVB 4YFEA 4FFYL 3QG6B 1NBQA 2DQUH 4DW2L 5GXBB 4UNVA 3FZUC 3GSVB 5DJ2B 1KLGB 3QEHA 5CBEA 3ILPB 3F65A 4QT5A 5D93C 4FTVA 4HH9A 5E1AB 4KI5C 1T0MB 4RFOH 1RZIB 2HVKB 5HDLA