3MRLA

Crystal structure of mhc class i hla-a2 molecule complexed with hcv ns3-1073-1081 nonapeptide c6v variant
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Analysis of Relationships between Peptide/MHC Structural Features and Naive T Cell Frequency in Humans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 80
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mrlA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mrlA01
2NR6D 3MJ7A 5FUOL 1G9EA 4C59B 2CR6A 1S7VA 3BDYL 3HI1A 5KANI 4DKDC 3CFDA 3D48R 3QIWA 5FV1L 1WEJL 4PJ5D 1YECL 1D5BA 5D2NB 1AGEA 3DUSB 3MRGB 5EU3A 1UKQA 2WV3A 1OTUC 2ICEB 4JZJA 5H94A 3U4EA 4JDTH 1XCTA 1URLA 1NSNL 2BJML 2YC1A 3HC3H 4HQQL 5C0JA 1AHWC 3BUTA 1IM9D 3L3JA 3KDMB 3O9WB 3BZFB 3P0YL 4JY6A 5I8OH 2B4CH 4XH2B 5C0AE 4B7IA 1BVLA 1I8LA 3FB6B 3T3MF 5FYKD 1MUJA 4MWFA 2YEZA 1WCBA 3ARUA 1Z5LA 2AJVH 5C6TH 5IK3A 3PXHA 3FN0L 4OJFL 1FZMA 1TZGH 4YHLH 4O51B 1NC2A 5DO2C 4NSKA 4U1NA 3R0MA 5F3HA 1U8NA 1MHEA 1T3FB 3KJ6L 4S2SA 1JGLL 1MCPL 3L3DA 1XF3B 5DHYA 3A67L 3ARYA 1I3RB 4POZC 4QKXB 5EIQA 4KFZC 1DE4B 3PWJB 4OCSL 4N8CL 1YNKL 3VXUB 5J56B 3C09C 3CMGA 4R8WL 4XCCH 2HWZL 2QADD 4XVJH 4MXQC 2R0LL 1NGYB 1R5VA 2R0KL 3VH8G 1FBIL 3FQWA 5HYFA 4TTDD 5D1XD 2C9AA 4P3DA 2DQUH 4UDTB 4KGJA 2V9TA 3ZT6A 2G5RA 1JPFB 1FORH 5CZVH 3L7EA 1IKFH 5F1NB 5E6IA 2NY0B 4NPYB 3TBWB 4ZSOA 3TNMB 3ULUC 1BX2A 3QCTL 5DD5L 3MX0A 5DQ9A 4QTIL 4OZGA 4WFGD 5EWIL 2GSIA 4I3GA 4LVOB 1CDIA 4HS3B 4BKLB 3RNQB 1CF8H 5FUZL 3W82A 2HJLB 3T77A 4HBCH 5BRZD 3SDXE 1NJ9B 4EI5B 1FH5L 3U30B 4V1DE 2WAHA 4CW1A 3CK0H 3MJ9L 4S0UC 2VE6B 3CFKA 1NEZA 2BNQB 4JJ5B 4PRHA 3T0EC 3QA3A 3IFPA 2AQ1A 4UMGA 1UA6L 4GMTH 2FX9H 4PJGE 4EOWH 1A6VL 2BY2A 4JGJA 3PJSA 3IETA 2Z93A 3EDKA 1KGCD 1RIHH 4UIKH 3ULVE 2VDOH 5EO9A 1IAKA 5DD0L 1NC2D 1NLDH 5JOFA 1BQLH 3QUXB 3MLSL 3MR9A 3QHZL 3SE9H 4KK6D 1WWAX 5ALCH 1E6JL 4KKAD 5GGVL 3HNVH 1E4WL 1XF2A 2YD3A 4N8VG 4NKIH 5GRWA 3BP6B 5IESH 1OW0C 3BN9D 5H2BB 2C5DC 3C5ZC 3BH8B 3G5ZB 3V5DB 5JIPA 3GHBL 1RZ8B 3QUZD 5ESVB 3OHXA 4PJXB 4ZXBB 2NY5L 2V5RA 2XTJB 1L0YA 3IAQA 3WFEH 5E6ID 3IXTA 2V2XA 2JCCF 4MJ2A 2E7MA 4YWGL 1UJ3B 3V6ZA 3QRGH 2R2HB 2BY3A 3RGVC 3MOQA 3TBYA 5C0AA 3JWDH 1SBBA 1ADQA 1KEMH 3KHQA 5CSBA 5I75B 2EIDA 3HRZA 1LO5A 2R2BB 5E8OA 5IQ7H 5SWQB 2QR0B 4MZ2A 4DVRL 3HRPA 4OFYD 1F3DJ 3I9GL 4JFXA 4RGND 3SGDH 1LEKB 3VFSA 1YJDH 3HUJF 3RVWD 2MKWA 3SOBH 3VE0B 4U0RB 1UVQB 3EO1B 4JFZH 1KV3A 1RUML 3VFGL 1OVZA 1T83A 3KG5A 4NO0A 1AI1L 3GRWH 3RI5K 5TE4H 4XCYB 3N0PB 3OG6B 5JLZA 3IDXH 5J11C 3E2HB 2VISA 3OJDA 4PR5A 3V52L 3MLPA 2OM5A 4Z0BH 1SYVA 3TZVD 4MJ6B 5EUOA 3GJFA 1HHKA 4W4OC 4S1SL 5EIIB 1BVKB 2CKBB 5CJOH 3GMNB 1CGUA 1C7TA 5JPMA 4NFDA 3ARWA 3QCVH 2VAAA 1WK0A 3ARXA 2FWOA 5HGAA 2IBGA 3PWNA 5IGXH 1ZANL 1G7QB 2VDKL 2GUOA 4UOW1 4MVBA 2L7JA 3MCG1 5F70A 4P2QD 2W0KA 5HI5C 1XCQB 2B0SH 1M71A 1A7QL 1MCDA 3T0AA 4I0PD 5D93B 2XI9A 5F1SA 3EHBC 1T4KB 3SDXA 1T20A 1OTSD 3VGAC 2VOTA 2X7LB 4KHTH 1R3KB 1KN4L 1QLEH 2NY2C 2EDKA 4MDIA 1W72B 1NMAL 3T0EE 4AENB 4PJGA 4YX2H 4EI6A 5GZOC 5CIPA 3OB8A 2LAAA 2HLFC 4KROC 5C0AD 4NC1C 3WIHL 1FRGH 2VKWA 4Z5RB 1A7BA 1BAFH 3TNNB 3GI9H 1OGAB 2H6PA 1J0KA 1AHWB 2QSCH 4LPTA 4ZUSB 2J8OA 3WD5H 2BSSB 1A1MA 4YUEH 3D25A 4ONGH 5FM5M 5IHZA 1FE8L 5FOBB 3SGKA 4TNWK 5DLML 3STBA 5CP3H 1KPUB 4U1HA 2RBLA 1RY7B 5BZWA 3WN5C 1U91B 4XAWL 3P4OA 1NBQA 3PHOA 5CUSL 3V5KA 4DN3H 1LWRA 4LCWB 4IM8A 5D9SB 3ZT7A 1HILA 2WLZA 3GIVA 1KB5H 2V2TA 1A5FL 1TCRB 4XWOD 1J1PL 3ZKMD 4N0YL 4AEHL 2ZUQC 2HFGL 3QCUL 4QRRE 1MVUB 1A3LL 2DJUA 5D7IE 2W60A 4MAYD 5HHPB 4KTDL 5EN2A 4OTXL 4NFBA 4GRWB 4OCMC 3RL1A 2ID5A 1Q8MA 2BVPB 4OLUH 2AI0L 1B9ZA 1KIPA 5D1QA 2P8MA 4GQ9L 3NH7H 4JDZB 3CLEH 2WLYA 1JNHB 1MWAB 2WW8A 3VXMD 5AD0A 3T1WA 3CJJA 4YHIB 3VWKA 3Q48A 4V1DD 3SGJA 3BZEB 2ADGA 1AR1C 2I9TB 4IDJH 4NWUH 2AJXL 1RMFL 2XWJA 4JAMA 4ZFZA 2OZ4A 1MCNA 3LH2L 2D7OA 1A9BB 4Y2DC 3MUJA 1C5CH 1RZKL 3HZMB 1HCVA 5EBMA 4XP4L 3H9YA 1I8MB 1I8IB 2A77H 3FOMB 4D9LH 3ULVD 3CDFA 1I1RA 3TPUE 5KSVB 4YXHL 1UENA 3MNWB 1ORSB 4PJAB 1NC4A 5DI8A 2P8LA 3GSXB 3G9VA 3ZO0A 2E7HA 4K23H 2FBOJ 5HGBB 4YHZL 4KMTL 2BSRB 3KPMB 1F6AB 2DLGA 2VUOA 4ELMB 4WNQA 5SWZE 4F7EB 4R4ND 1LO3L 4I0KA 5EA0H 4UDUA 3P9LB 4PGEB 2GFBA 4HXBH 1KEGH 5D6DC 1FAKT 3ARFB 4JKWA 4TUOA 1IGYA 4L3AA 4G8FA 1MNUH 1IEHA 5T1LD 4GW5B 3WO3B 4LK4A 3UO1L 2P8PB 2NY1C 1ZHBB 3MLZH 5IFHL 2EDXA 2F53B 3VMOA 1YEFL 3RWHA 3C5ZB 3BGAA 2A0LD 2EO9A 2ENSA 3HC4H 4KK9C 5IW1A 4B0MM 3T0EA 5EU4A 2IH3B 5E08H 3KWWB 5IFJB 4YXLH 5DK0A 1DDHB 2R1WA 1R5IB 2DIJA 1CIDA 3HPJA 5FYJE 4NC1E 5IEKB 1REIA 3BGFC 2BSTB 2OBGA 4LLWB 3TFKC 3BX7C 3VWKD 4OQ1A 5E2UH 1JZ8A 5FKAB 1CXHA 1OCWL 4LBEB 1G7MB 4JO3L 4NZUL 5B8CA 1KBGL 4MA1C 4HWZA 4JFHE 3B9DA 4JB9L 5I1EL 1MFDH 3GSRA 5C2BH 3PP4H 1QRNE 4G8IB 1SM3H 1FVEA 4XB7A 4N0CA 4EQ3A 3IFNL 4J2XA 3DOSA 1YN7B 1RZJH 2OL3B 3LEYH 2OMBA 5AAWA 4XBEH 3MC0A 1NC4D 5J11B 4NHCL 2GCYB 1FJ1B 4PJ7E 1OAYL 4AMKH 1C5DA 4ZYKA 4JQXC 2H32B 3BO8B 2YBRA 1MHCA 5D7IA 3LPGA 1NCTA 2RFXA 3VXPB 3U7YH 5ACLA 1SJVA 4LFHG 3RGVA 5GJTH 1FFQA 4GXUM 3E3QC 5ESQA 2NXYB 3SKMA 2FATL 4Q9QH 5ACZA 4Q97A 3NIGF 2WIIB 1KXVC 3OKLA 1U8LB 3NTCL 3RQ3A 1R3LB 2BOCA 4PJFE 4HT1L 4NM8L 4MS8A 2A1WH 3IDMA 4YO0B 4ODWA 1BLNB 2AV1A 2V5YA 2Y72A 4Y1AE 1INQA 1G9NL 1ZHKA 5DFVD 1A1OB 4KI5C 2GEEA 5BMFL 2CDEA 3K80A 2XRAH 3DV4B 2OCFD 4I9WE 4KQ4L 5IJVA 3IJSB 4W4OA 4ZFFB 5FYKU 1IGML 3GMMA 5J3HC 4WW2F 4D0BB 3OAZK 4Y19B 3AXLA 4RBPK 32C2A 2J88L 3CFBB 1X5KA 3O8XC 4OJFH 2CJUL 4X5WA 3KJ6H 4GAFB 4QRUA 3A67H 3L9RB 4M6MH 5F71A 5SWZA 3TCXA 5A2JH 5MENB 1J1XH 4N0CD 4N8CH 2DMCA 1MJUH 4R4FL 4NKOA 2AXJA 1T6WA 1FBIH 4YAQB 4LRNH 3VXRB 1SEBB 4JFDB 2Q3AA 4UILL 4XNUL 4HG4J 4QRRD 3HR6A 4N0FA 4WHTB 1CGSL 3CSPA 4L3CB 3GHEL 1Q72H 2IGFH 1F2XK 3X12B 5KG9B 1JUFA 1DQJA 3G6AA 2XZAL 3RVXC 4JCMA 3ZE0E 1LE5B 4AQOA 1KYOJ 3MGTB 4MXWL 1H3TA 5LBSH 5FUZH 1A3RH 1P7KA 1WFUA 1DQLL 3DROA 3T65A 2OS7A 4NUGH 4HJGA 1JHKL 5L2KE 1XIWD 4LKXA 4Z78B 4QYOA 1FH5H 4MS8D 4XBGB 4P59H 1S7TA 3U0TB 4PP2A 5T5FH 4JFYB 5L8LB 4M1DL 4PRPE 5L88L 5DT1H 2KQNA 1ZT4A 2CMRH 4JFFA 4NRXA 3O4LB 1UA6H 4NQSB 4TN9A 3WN5A 1AXTL 2X4UB 1U36A 2ZUWA 4YE4L 1HH9B 3QQ9C 3F8UB 4NQXB 4JFED 2A83A 2C3HA 2OTPA 4Y2DB 1PKQE 4XCNA 3B83A 3MACH 3EFDL 4HZLA 2B1HL 3CVIL 5BQ7B 2ENYA 1ZGLM 2PO6D 3FTGB 3DIFB 4ERSL 4P5MB 5EZIH 4EDXA 3TBTA 3LN4B 4PJ7A 2BERA 3MRLA 1U3ZA 1YEDB 1FFNA 4YJZL 4KV5E 3BW9A 4MB5A 3LKPB 3P4MA 1WVZA 4MA3A 1YPZE 3EO0A 3WXWH 5E8PB 4HCRL 4RMRA 1FNEA 4G5ZH 3H42L 5EBGA 4DKAA 5MEOB 4Y16C 4GRMA 4QOKD 3T04D 2V9QA 4OZFH 3S5LG 1ZA3A 4WFEE 4P2OA 1MCOL 5DWUH 4NCC1 4JPKH 5TH2B 1I7UA 4DKFH 3KS0J 4PJFA 1RK1B 4X80L 4Y8AA 4NQCD 2FGWH 4KY1H 4ONFH 4XRCB 1CG9A 4J8RB 1BHGA 3ARTA 4HC1L 4Y1AA 3QNZB 4ZFOL 1DTUA 4P3WA 4ZQKA 3IS0X 4O5LH 1T1ZA 4NO5A 1KN2L 4JN2A 2C7UA 2NY7H 2YOCA 2BNUB 2J4WL 1Q9KA 1OAKL 3A6CL 5GS2D 3H9SD 4GAGH 5FA3B 2O5XL 5C0CE 1FZOA 1G6RA 3T2NL 1OWWA 1QUNA 4F7TA 1JL8A 3U4AA 4X4YB 3GGWA 4LLQB 4NNYA 4XAKD 1K5NA 4LIQH 5IWLC 3BGFB 4JFHD 4W81A 4U6HB 2IFFH 3MLTB 1QRND 2JJUA 4H8WL 3GSNH 3PGDB 3MV9E 2XOTA 1EGJL 4HUWB 4XXCC 1P6FA 1U8PA 1BOGB 2DD8H 3T1FB 1IGTB 4LFHD 5D6DA 1KCUH 3MO1A 1LHZA 1DFBL 1RURH 4QRPE 4S1SH 4Z0XB 1L4IA 3VDCA 3UYRH 2HFEB 2NY5C 1KFAL 4CGTA 2WK2A 3NZ8A 4HH8A 1Q94B 4A6YB 1CFQA 3QULB 2FRGP 4DZ8B 2VDKH 2P47B 4TQEL 2DYPA 3I3EA 4GQPH 4TOYL 3G04A 1KB9K 5SX4H 3EGSA 1A7QH 5I1HH 1D9KD 5HD8C 1N2RB 5AZEL 4DEPB 2ZUVA 2YUZA 3TFKA 3EYVB 4FQ1L 1IL1A 4NN6B 1T03L 1AD9B 1QYGL 1DBJL 4NOBA 5GRUL 3E6FA 1KN4H 1A7PL 1XAUA 3N50A 1IEBB 4DQOL 2XICA 4L4TE 1N3NB 1HXYB 1MHHB 3HMXL 1BWMA 1CDYA 5A2FA 3U4BL 4HK0B 2BVTA 2HVJB 3ROOA 4J6RH 3GMQB 2K7QA 4L29A 5SX5H 2J2ZA 1ZLVK 1VGEL 1X5ZA 1PKQA 3E8UH 2XXCB 3WIHH 4I9WD 4L8SA 2A9NH 4G7YL 3BD3A 4NJ9H 5GJSL 4HJ0C 3HHRB 1E27B 3MUGB 3OPZL 1P9MC 4RA0C 3S5LA 3P9MB 3QIBC 2J12B 2G75A 4MNGB 5TE6H 4BYHA 2Y5EA 3ELAT 5D72L 5F7EH 5GGRA 1IC5L 2HMIC 2EYTB 3KXFE 4X6CE 4DUWA 5CILL 1BZQK 4UU9B 3QEQE 1SBSL 4OD1L 1YPZA 3O8XB 1MI5E 3KPNB 3ARSA 1A0QL 5IF0B 1NGPH 3GB7B 2NY3D 5E5RB 1YEHL 4AY0A 4YHNB 5FB8A 3WLWD 4NQEE 5FO8B 3ARDA 5HI3C 4N0YH 3SJVB 4GKSB 1T5XB 4ZOBA 1B0GB 4HFWA 2JK5B 3EYSL 1G7HB 1UM5L 2A6JB 1RUQH 5DJ0B 5EU7E 5ADPL 3BUYB 1I7TB 4TUJA 4KTDH 4HEPG 5T1KA 3J7HA 4EDWH 4JKMA 3D1MC 3H9HA 5JORA 2OQJA 4NQDA 1SEQL 5C0CA 1N5YH 2PXYB 5BOPA 1JMXA 5L2KD 1NFDF 5C9KA 4X99B 3P0GB 3W11D 4HK3N 1LILA 3GO1H 4O2FB 5HPMA 4PRPD 2ORBL 1PLGH 1AIFA 1U58B 5DYOB 4KQ3L 3QR2A 1EXUA 1KCKA 4N68A 1NDMB 5I1KL 4I2XB 2V2WA 3S3JA 2CLVA 3TO2B 3RAJL 1FNAA 2EDJA 1RZKH 5GHWL 5K59F 5DR5L 3FCTB 4LARH 4Q7DA 1A47A 2WWKO 4XX1G 5L2JB 1FQ9C 3L5JA 1PY9A 5DQJA 4FXGB 4OSUH 5JHLH 4KK8D 5HGHB 3K4ZA 5C86A 1RV6X 2Z92B 4OLWH 3PABA 1XGPB 4O2EA 5DK2B 5EZLA 4OZIB 1BQHA 2PKDA 4GXVL 4YIQA 3NPZB 3AREC 3ESUF 2ADFH 4KRLB 4K3JH 2ZG3A 1QBLH 2ZJSL 2UZYB 3MMEB 5CKGA 5KZCD 1BD2E 4J1UB 4FN0A 5JXAL 1ITBB 3D18B 3PGCB 4WFED 1BIIB 1A6TB 3BKJL 5AZ2H 2CRIA 4LQFL 5L8JB 1JNJA 1Q1JL 4J3XA 4JO2L 1NGXB 3ARDD 2YPVL 5FDYA 1QKZL 4H1LB 4P46C 4Y16B 1J86A 4XPBL 1EJ6A 3O2DL 4AZ8A 4LLVA 4L4TA 3KYNB 3KYAA 2PTVA 3SY0A 2AQ3A 4R7NB 2R8SH 3LQAH 3N1PC 5KSUA 3X17A 2C3GA 4OF7A 1HYRC 1F58H 4JKKA 5GS0H 3OR7A 4PV8A 3EDJA 2GSGB 1HQRB 2GJZB 4PPTA 4CDHA 1JK8B 2WINB 3IDUA 3O0RL 4S0SD 1QPXA 2ZPKL 1J8HE 2NY6D 2FBJL 3OR6B 4X5XB 4HIIA 3MRHB 4D8PA 1F4WH 4NNXB 2P5EB 1HSBB 4JM2B 2DBJA 1JRHI 4JRYD 1RIVL 2WP3T 3KXFA 5I73B 3MV9D 4XGZB 4P2YA 3QEQA 1DN2A 4JB9H 1J88A 4QTHA 1AR2A 2DWDB 1X6NA 1M7XA 2FR4B 1AY1H 3AS3A 1JV5B 3ET9F 4S0TD 4K94L 3VMNA 3WFCL 2YHGA 4LLDA 3FAXA 3IFNH 4KTYA 5ANMB 3QXAA 1N6QL 1F4YL 2KZ1B 4QRPD 2ZCKL 4NQEA 4D3CH 4M5ZH 1JGUL 4ZUVA 2H9GA 3FO2A 1MCHA 1ZLUK 1OAYH 5F9WC 3BSZH 3L95A 1J5OL 3MJ9A 3VRJA 4DZBB 2HVKA 4HJJL 4WTZG 3GNML 4HUUA 3OF6A 2A6KA 2OI9A 3D39A 3GSWB 3MOAL 3N1QC 3H3KA 1KCLA 3ILQD 4HDIB 3BQUC 4PJDB 4XCFH 1QEWA 4QGYA 2CDGA 2PUQT 3HS0B 3GZKA 3MJGX 4GUPA 4IIQB 4R2GC 7FABH 1CD0A 1S7RB 4HT1H 4NM8H 1UWXK 3O11B 1H0DA 1UZ6F 4BUHA 5HHXL 2C26A 1WAAE 2PW2B 3BIBX 4XP1H 2NZIA 2MQCA 3EOYG 5CGYD 4L9LA 5L9DL 5HYIA 4DFHA 2ZUUA 1JTTA 3PL6D 1S3KL 3MLRL 1K2DA 5BVJA 2OTUB 3DVNA 5E00A 1T0MB 3BDBA 2WSKA 3EFFB 1NUGA 2XWTB 3QG6A 4JVUA 1W72H 4KQ4H 4ODHL 4OZFA 2P7TB 1IGMH 5LGHH 1S7XA 1A6AB 1X4YA 2FX7L 2G9HB 4NRZA 4M7ZC 5C6WH 4PREA 2XY1A 3KXFD 3GKZA 1ZVHA 3QEQD 1PG7X 2FJGB 3GMLB 4JPVL 4UNVA 3D85D 3TPKA 1MI5D 3QIBB 1AO7E 4E41B 1BD2A 5FA4B 4IOFC 4L8CB 1IGIH 2NTSP 1DQQB 4JZOB 4MNQE 2ERJB 5I9QC 4KJPC 4R4FH 3W0WE 4MJ5B 4NQED 3BESR 1KPRB 3UYPA 3FRUB 4UILH 4GOSA 1XR9B 5GRJH 4YEEA 3LRSA 2HRPH 3DPBA 4HULB 3GBNH 4MMXC 4EVNA 3D9AL 4PGDA 3U9UA 3F12B 5JNYB 5HHQB 2GI7A 3OF6D 3HMWL 1XZ0A 1G9NC 2IANB 2LVEA 3VGBA 3GSQA 3RUGF 3F65A 5I1IL 1C16B 3VXQA 4MXWH 4J4PA 4X6BB 3RZCA 4ETQB 3ZSTA 2BNQE 2X89D 1P9MA 1JHKH 2NX5B 3GMRA 4GRWH 3GM8A 2X9YA 2FX8L 4G8GE 1BEYH 4ZO7A 3BKMH 3C6LC 3O6KL 4PY7B 1MWAH 1MCKA 4JFOA 4MXVE 4XXDA 3ULUH 2G2RB 4HK3J 1AKJB 5MP6L 2VXVL 2HT2D 4UOJA 4RIRA 2N7AA 2CRZA 1M7IA 2F15A 2XWBB 3PWUA 2EDOA 4S1DD 4NC0B 3UYOD 3AUVA 4L3EB 2EH7H 4PGBB 1TZHA 3VFRB 4KAQH 5FYLH 2YWZA 4OB5H 4AG4L 1CQYA 3T4YB 3ZDXF 2QQQA 2GK0B 2EDBA 3NCYS 1PSKL 4DVBB 3TP4A 5F9DC 3R0NA 4QF1B 4J3UA 3G6JF 3MRRA 3CDCA 3J8F7 4PIRF 1LO4L 4PS4H 1IAIM 3N1MC 5DS8A 4X7SL 2I07A 5E9DB 4LDOB 2DM4A 3H42H 1G7IB 4LSUH 3I02A 3AREB 3WIHA 4TSCL 2WUBL 2A38A 5HSFA 1FFRA 3QFDA 4FP8L 3FT4A 4ZUWA 2EICA 4U33A 5J6GB 2Z91B 3QDME 4Q6YA 2W0FA 5ERWA 4FQ2L 5JPNB 1SY6L 3M8OH 3MRKB 1NL0H 1WAAA 4OLZH 1B0RB 4IS6B 1ERNA 1T5WB 3MUHL 5DD3H 4HFUL 1TTUA 4P46B 1EEZA 4PP1C 1KN2H 4HUXB 5DJYA 4LU5H 2APVA 3OXSB 4KKCC 3CXDL 4J4PD 3U9PH 1OAKH 2AJZA 2VLKB 4LRIA 5I66A 3RZCD 1S5IL 1J8HD 4I48B 4DJMA 3T2NH 3BH9A 3NACL 2EDYA 4WW1B 1XF3A 4FZ8L 1MFAL 1HCFX 5D1ZA 4QHUB 2DQCH 5DJCA 4UZGA 3TIDB 2X9WA 2MCPH 4HH9B 3HI5L 4IRSB 1AO7A 3KLHC 4H8WH 2W92A 4RNRA 3WJJC 1JNNL 3V0AC 4YK4C 2UY7A 3WSQH 1LO2H 5D2LB 3D3VB 2F5AL 4HKZB 1YN6B 2W9DH 4MNQA 3S37X 3VXSB 3QPQD 4U7MA 2IADB 3TYFA 3W0WA 2RCSL 1YPZF 4OIIH 4ENED 1TLKA 3MV11 1JI2A 3EYQC 1HHGB 4YDIH 3UJJH 4ZS7H 2P49B 3QHFL 1MFCL 1RZGA 4ZNEE 3VGFA 3VFPA 1PZ5B 3RU8H 2VIRA 1A6PA 4WJ5B 1WITA 3EKCA 1F90L 2W9EL 3IF1B 5TQ0L 4LKCB 3WKML 3WS3B 4YXKH 4KPHL 1YEJL 1D5XB 4JO1H 4ZS6C 4YBQC 5F9WB 5BO1H 3LB6D 2VWEC 4KKLC 3L3IA 3O41A 3FT3A 4WO4A 3MODH 1NAMB 1X5FA 5I1DA 1H3PH 4BZ2H 4F80A 2Y1VA 4MLIA 1KC5L 1AQKL 2BNQA 5DDHA 5E5MB 2GY5A 1S9YA 1TZIB 1RD6A 4FQ1H 4UQ2A 2X1PA 5F8QC 3O9WD 3ZZ1A 2P4AB 4G8GA 4ZNCD 4U1SB 1L0XA 3QJHA 5DGQA 3U4BH 1OGAE 3QFJE 4B53A 2R29L 4LCCA 4YHPA 5ICYA 2NTFB 3IU3B 5FHAH 4X9IA 3P77A 5D7LB 3DX8B 1UWGH 4Z8FL 1U92B 2EYRB 1U8HA 4IMLA 4U49A 1RAMA 5MEQA 2YMXH 1QSFE 1JZ6A 3QO1B 4MD0B 5JUEL 3VXUD 4X9FA 1UB5A 2A9MH 3VWJC 25C8L 3TV3H 4X4ME 1AGFB 4LCWE 3INUL 5CILH 3ILPA 5C92A 1SBSH 3BH8A 3KLAB 4IRZH 2R56H 2FSEA 4LCUA 5EU6A 1Y0LA 3BJLA 3P73A 3HG1E 1H5BC 3BQUA 3HE7C 2NY0D 43C9A 4ZTOH 1KNOA 1QSVA 3OKMA 3QDMA 5FDWA 5TGBA 2OK0L 5I9QB 1PW3A 5J1TC 4OM1L 5J9PA 1B2WH 1S8DB 1SJXA 3OJ2C 1M05A 2Q86B 2X05A 2PTUA 4DQOH 4WY7H 3K2UH 3GI8H 4JG0H 4EI5D 1FFOA 2R4RL 3GEWB 4OCRH 2ZKHH 4WO4D 5DTFA 3MFFA 1T1XB 1VFMA 3RJQB 1CD9B 1T2QH 2BNQD 5C2UB 5HYQB 1ZVSA 3TIEB 4XNQB 1NCNA 4XMLL 1ZKAA 2XQYG 4GRLC 2VLJB 3SKNB 4KZDL 3ES6A 1KXTB 3BHBA 3SO3C 4RDQG 2BC4A 2AJYL 4MMZC 5EO0B 3ARBB 2B2XH 5IR1A 3LEXB 3PWPB 5GHWH 4S11A 4Q2ZB 3TVMA 5IVXA 3V5HB 1BFSA 4NHUE 2FEDC 4X6CF 3QI9C 3MRJB 3MREB 1JPGA 4HMCA 5EOQH 5BS0B 1XF4B 3UTOA 4PJAE 4H20L 3QWOB 4F58L 2DKSA 2ZOLA 4TRPH 1WICA 3BE1L 3RWGA 4AIZB 1IGFH 2F8VA 2HAZA 1JPTH 1CLOL 1YY9C 4IOIB 5I1LA 1W0WA 5F1IB 4U1MB 4JLRA 4OFIA 5JXEC 4A2MA 4GXVH 5T1DL 1HNGA 5B39B 5DJ2A 4XHJD 2UYLB 5E2TL 5GGSB 1F8TL 3C08L 1IC4L 3QNXA 5DFTA 5GS0D 3QQNA 4ZXBD 5KS9B 2NYYC 2K1MA 2XTJD 4MLSA 1MRDH 5D96B 3BKJH 3TF7C 4PBVC 4U1IA 4HIXH 5TFSL 4JO2H 1JRHH 1U2HA 2VXTL 4H26A 4ONHB 2EDHA 4OV5A 3IFLL 3MOBH 1G7JA 2ED7A 3QHTC 4PJHA 4K8RH 4LLYB 1U8QA 1F6LL 1CXLA 1YUHA 4UBDD 4MAUL 3CFCH 3MYZA 3C6LA 5TPWH 3AAZB 3FHQA 4JRXE 1LVEA 1PDKA 2IH1A 3P11H 1AQDA 1WZKA 1CFVH 3QBTB 2XXMB 3QFJA 2NXZC 3RIAK 4QHNB 1NCAL 3V2AR 4DOHE 4K7PH 3NFNB 1RVFL 1UACH 4HWBL 1LP9B 4XNZC 3S97C 4X6DF 5KVEH 4HS6B 2BOBA 2ZUSA 4G43B 3BWAA 3WNNA 1QSFA 2FIRT 4EKXA 2D31A 3FO9A 3KYMB 1DVFC 1MRFL 4CVUA 4Y0GA 3P0VL 1DR9A 4X4MA 3TA3C 1KJ2B 4R90H 1KTDA 3TVMD 3OXRB 4N1CA 5C0DB 3O3DA 2H2SD 3ROLB 5MEPA 4UOW0 5KVMC 1JI1A 1N6QH 3EYUL 2ARJA 3HG1A 1FDLH 1FVDB 3CZJA 5D6CB 3OAYK 2YD5A 1X4XA 2X1QA 4YK4B 5CGTA 3JVGC 2OMNA 1QLFB 5ALBL 1QBMH 5BVPH 1NCCH 1NEUA 2AV7B 3I75B 5E8DL 2P24B 2Z31A 4XP9H 1ZLWH 3JSSA 5JDSB 4XNYH 3BPOC 1JF1A 3AFLA 4G42B 4YHIA 1JJUA 1J8KA 1KTLA 1RUPL 1QR1A 1EHLL 1OPGL 2RHEA 2VDLL 3DVGA 1HHIA 3TM6A 1N7MH 4P9MH 2OSLA 1VGKB 3KJ4C 2A73B 1Y18B 1H15B 4W70A 2NW3A 1VFBB 4ODXA 3S96B 3PG2A 4ORGA 2X4NB 2EXWC 5H37G 5J13C 2Q76A 2CK0H 3DUHA 2GHWB 2C3VA 4DTGH 1OGAD 3QFJD 4NT6B 3RPIA 5DJXB 3WE6B 4NHUA 3REVA 4D9RD 2PW1A 2D7MA 2JB6A 4M7LL 3R06A 4K94C 3RWJB 4Y19E 3GSXA 4HCRA 4QRQA 1HXMB 1FIGH 4E9LA 2P44B 2J6EH 1YEEH 2BSRA 5LCVL 2MOVA 1G0YR 2W65A 3M17A 4JKPH 1IAIL 1EERB 1XGRA 5DRZB 2FX7H 3IU4H 4GG6B 4F7EA 3G6DH 5DMYA 5HDQH 5DO2D 5L8KB 1GCFA 1EEQA 4YHKL 4LSQL 4LCWD 1AH1A 3QUMH 4OQTH 1C5BL 4O00A 4E0RA 4POZD 4ZFOA 3QEHA 2EKJA 4JQVC 1UM6L 2MQ3A 4M8QA 2RR3A 3QG7L 2VZTA 3LS4L 4JFDE 5L7XL 1KSRA 1P7HL 4KVCL 3VFVA 3I6GA 4LLMB 2Y7QA 3HG1D 2ZSWA 4MA8H 3Q3GB 5IT2L 1N5AA 1ZHLA 3MBXH 4UNTA 4ODUB 5ELIA 3IJYB 3FFDB 3ZE2E 3FB7B 2XZCL 3HZKB 5CWSB 1X9QA 4BZ1H 5HPOA 1DUYB 1H5BB 2P43B 3SGEI 5IEHB 4JRXA 1O5DT 3HE7B 4QT5A 2Y07L 3IDIB 4XPTL 1IAII 3LVEA 4EQ2A 3ULUD 1PG7L 3UTSB 2BSTA 3CH8A 3QH3A 1BM3L 1LGVA 4FXLA 5FECB 1KIQA 1LK2B 5C9JA 3VI3F 4MSWB 2R1XA 5F88A 3OZ9H 1RJYB 2FL5B 3C5SB 2BVOA 3I6KB 5FYLD 3O4LE 3RTQC 2D0HA 4HIJB 1JHLL 5I15L 1D5ZA 3P4NB 4M03A 5ETUA 4LCIL 1G84A 1KLUA 3DI2B 3VWJA 2GT9A 1NH6A 3NGBC 3OGCB 3RX7A 5HHOB 4ETYA 2QHRL 2EZ0D 4EN3C 2BFVL 3EOAA 3SO3B 3QIUC 3L5WB 1TJHH 5JA9A 5HVGB 4J23A 4KI1A 5FUCC 1UQSA 2DQDH 2Y06L 4ZUUA 1D5MA 2IG2H 3O6MH 4RWYL 4OLVH 3SPVA 3THML 3IGAB 2WUCL 1Z0MA 3EO9L 4N1HB 2F54E 3QI9B 2NQCA 2Z9TA 3X14A 4FZEH 1U8KA 3VGDA 1BFTA 4PRAA 2DQHH 2EIZB 1UEYA 3F7VA 3EJJX 4OUOA 5C0GB 3ARFD 4DN4H 1EO8L 2AJUH 3LKSB 3OX8A 3HMXA 1K3ZA 5HY9B 2YXFA 3FAWA 5DC4B 3C5JA 4JO4L 2WIIA 2F53D 3HR5B 4X7SH 3LSOA 3S34H 4G6AD 2DLFL 1EUTA 2EE9A 3C5ZD 5I74B 3FO1B 5EBLB 5DHVB 5CBAB 5C0ND 3CFEB 3EOBA 5DUML 5C0BB 1JWUA 3MRPB 5LAXB 1ZWIB 1AP2B 4GRLA 4TSAH 4CL7A 3VG9C 4FQ2H 4QXUH 4XPHL 3QZWA 3DBXA 2VB5A 4PV9A 5EH1A 3RL2B 3T8XA 2GTZA 2QKIB 3HFMH 4JN1H 5J06A 5F6IC 1CLCA 4HFUH 4NM4H 4H1LH 4OLXL 3CSYA 2WNGA 4MXVF 4WENB 4PLKD 1MAJA 1RI8A 1UT9A 3QJFB 1F97A 4R26H 1S5IH 4Y5VA 2NXZB 2ZNXA 1OP5H 2Q8BH 3DECA 3RKPA 4HG4K 1S5HB 1W8NA 2CGRL 1RK0B 4LHJB 5C0EA 3OKDA 2I9LB 2JKXA 1BJ8A 5KAQG 2WWMD 5JXEA 2F74A 2VUYA 3RWDA 5J1SC 2VC2L 1RIUH 2C1PB 1DVFB 1KYOK 3T4AB 3DMMC 5FKPA 4APQB 1XGQA 1QFWM 3MXVL 3LKNA 3MSPA 3LKQA 4KJWD 4U3HA 2PCPA 3ERYA 4XVSL 4Y4FC 2GITA 1KJVA 4PJXF 3RP1A 3OQ3B 4JDVA 1XH3A 5BZDA 5FEBA 3SE3C 3O3BA 1KT2B 4P5TC 1UB6A 1INDH 3W39A 3DTXB 5IB4B 4WI5A 1MF2L 4BQ8A 5FK9A 3QNYB 2NXYD 4IMKA 4L5FL 3GKWH 4FQJL 5HI5D 3WEXB 2CO7B 5LWYH 5GIRB 5E8NA 1YYMH 1UCBL 4LVHC 4KKBD 3WV0A 1NGWA 1PVHA 4XBGA 3UC0L 3S37L 3BPOB 3BPNB 4Z9KB 1KC5H 1W0VA 5DRWB 4AT6B 4PJ8C 3STZA 1Q38A 5EORL 3N9GL 2OTWB 1U95B 1FGVH 3F7YB 5TDNB 4U4BA 3KJ4B 3OL2A 4F37K 3TA3A 1DL7L 4HHAB 3VFMB 5GZOD 4U6YB 3KYKH 4LSPL 5CSZB 5E5UB 4WUUE 1OT1A 4Y19D 2B1AL 2IPUK 4PD4J 1JPSH 3HZVA 4I3RH 5FF6A 4ELKB 1YEDA 5E99H 4P2CG 5FUCE 4Z8FH 1U3YA 1OT2A 4PRBA 2F54A 4FABL 5ENWA 3FT2B 1I1AC 5MEND 3PHQB 3MBEB 4O4YH 4G8EA 1C08A 5IB1A 5D5ME 2YA1A 5JHDB 3O2DA 2VLLB 3PQYB 3DV6A 3VXRD 1MFNA 3INUH 4P4KC 8FABA 3KPLA 4JFDD 5DD6A 4NRYB 4X7CC 1YY8A 1T1YB 1XGYH 2D03L 2R1YA 3KPSB 2VDQL 3L5HA 1UH4A 1X6LA 3QEGL 3UAJC 3WUWB 4FHBD 2XQBL 5C0FA 2Q7YB 4NBXB 1I4FA 4GKNB 5BV7B 4OGYL 3LIZL 4M6NL 4OM1H 4JY5H 1OP3K 4CN4A 4YR6A 4XVUD 3ZKNC 4NQVB 4NDMB 5FA3A 5AYUH 1Q9WB 4HKBA 5M94B 3GMPA 3X13A 3D69B 4J3SA 5FYKL 5A2LH 3PWLB 4F7CA 2VN7A 4RFEB 5ICXB 3MCKB 4MX7B 3V7MA 1VEPA 3O4LD 4EXPX 2ZG1A 3HNSL 1O0VA 4V3DB 3WS6C 3AC0A 4AH2B 5J6HA 4PFEA 2W9LA 4YPGB 3AROA 1P4IH 2KQMA 4KZDH 4CVZA 4FFWC 4NJAL 4U1JA 2XACC 1MJ7H 4Y2DD 1MIMH 3HAEB 2VNCA 4G7VH 3V9FA 3UTTB 2HJKB 1HNFA 5CHNA 5K9KA 3RVVC 1U8JA 2VZSA 4Z7OF 5HI4D 4HKXA 1QA9B 5A40E 4OLEA 1K8IB 1FYTE 1OAXH 3REWB 1FZKA 1AGCB 4YDVA 4K8RD 4AM0A 2H1PL 5C71A 1BZ7B 2AGJL 1JWMA 2YD7A 2KPNA 4GRWF 1PY4A 2DDQL 5D7JB 4MCYA 1OAZL 2AJ3B 2XA3A 1ZGLA 8CGTA 4BK4A 2HJFB 3C08H 1IC4H 3NABL 5DEGA 4RDQF 1KCSL 3ULUF 5ISZE 2JF1A 3ZKQD 3BEWB 3QUYB 5DJDA 1HZHL 3TT1H 1IAOB 3E6HA 1HXYA 5TFSH 4CADA 4NP4L 4PB9L 3RTQA 4RFOL 5KVGH 3GMQA 2QQLL 1HH6B 2XT1B 3BEVA 1HYSC 1X5LA 5DJ8B 4C4KT 3QUMA 1E28A 4YC2C 3TBVA 2IAMC 1OD7A 1IEAA 1KLFA 4XCEB 4H1LG 4BH7B 1U8MA 4WUUA 1ZGLP 4EN3A 3BOVA 5I16A 3P9MA 3QIUA 4DKEH 2BCKB 2BNRE 5IHUH 3WBDA 5GS3A 5F6IB 1RZ7H 1IZKA 2P5EE 2OJEB 3SCMC 4PJAF 1V8HA 3NIDE 1OSPL 3G08B 5C0RH 1MLBA 3BXNB 4XP5L 5D5MA 4P4RA 3WHXB 3MGAA 4M1CC 4TULL 4ELMF 5TF1L 1TDQA 2ATPA 3K74B 1RJLA 2Z8WC 3KPOA 5EFIB 1I1FB 1MCFA 1VPOL 3TJHA 3WNLA 4ZUTB 3HC0A 3V4PH 1I1CA 2HKHH 3GMOB 3MRNA 3KPRE 4URTB 2VAJA 1GGIL 2GAZA 2DLIA 3F6LA 3K4DA 4FQHA 2VQUA 5E8DH 1ES0A 2MMXA 4Y4FB 1UXSA 4HMDA 2VH5H 3PE9A 4Z77A 5KN5B 4W68A 1L7TL 2PXYA 1CTNA 4PJDE 1ACYL 4YHML 4LNRA 4YGVA 4P5TB 1B6DA 3OKEB 4OKVA 3FO0L 5JOPE 3UX9B 1QO3A 1RUPH 3U0PA 2VDLH 5HYSB 1RUAL 2PYEB 3UJIL 5GGRY 3FZUC 5B4MC 3V7AG 4K7FB 4LEOA 4P5KA 5LKNA 15C8H 4H0GA 2R2EB 4MJIB 3OSKA 2GJ6E 3LKOA 5E0QA 2EXYD 3KYOB 5F7YC 2EE6A 4UQ3B 3O3AA 1NAMH 4PJ8B 4IRJC 5FOJA 4DGYL 3SDAC 1KPVB 4KDTA 2F58L 3LV3B 4Y7MA 3HE6B 1FYTA 2FJHA 3DMMA 1ZA6B 3NCEB 2FZ3B 1R6VA 4GAYA 1HKLL 3NZHH 5GSVB 3PDOA 4BSWB 3JV6A 1LDSA 4X4XA 4DGIL 5JOEA 1IAIH 3EJYC 3O8XD 1YEIL 2LTQB 1UADC 4AEFA 1IQWH 4M61B 1F4HA 4LHUB 3C8HA 3JV4B 4C56E 5CZXC 2AQ2A 1JWSB 1SY6A 5KVFH 5INCA 2A6IB 4RAUA 5KSAA 2O61A 4HLZH 3UTZA 3BYTA 3QG7H 1MQ8A 4PG2C 3LS4H 5L7XH 3TJHD 3SJVD 1ACZA 5ISZA 2R0ZH 5CEXA 1F3JA 4UINH 3DURA 3X3FH 2XNAA 5F9JB 4P4KB 5JIKA 4QRTA 4RMWA 3SBWC 3C9NB 2IANE 5FGBC 3W2DH 4DUVA 4JPWH 1MFBL 1MHPL 4HPYL 2VR5A 2PXYD 3VFWB 5IIEB 4O2CA 3RVXD 3ALXA 4M5YH 1WBXB 4M6OH 4L4VE 5F7KC 2BNRA 5GISL 1OB1A 2X09A 1ZS8A 1X5XA 4X0KA 3GK8L 2X44D 2X4SA 1HINH 4BFGA 1I1AA 3MRBB 5I15H 1QFWL 5ABDE 4LDEB 1F2QA 3D2UB 4WU5A 5DRNA 3MLUH 4OKDA 1T04B 2Z4QB 2CSPA 4L3EE 1FNSH 1J18A 4K3DL 3QQ9D 4HEME 5B3NA 1MRCL 3MXWL 1XR8A 3LHPL 4J12A 1ZE3C 1BZ9B 4NZRH 3PP3H 4PJ9B 3L7FB 4K3EH 3MJ8A 1CVRA 4MCZB 1NGZA 4WV1C 3AM8A 1CD1B 3KPRA 5F7HA 4PGCB 2WUCH 3RFZC 1A3QA 3Q6FA 3FFCB 1V7ML 2E9WA 1A7RL 3FOLA 4XWGL 2JJSA 5AG8A 2Q20A 1M1SA 2BVUA 4NGHL 4OAWB 4Q74A 4I18B 1X7QB 2RB8A 1IQDB 1K4DB 3EBAA 2GW5A 2VQ1B 4P23C 3CLFL 1E4XL 3DSNA 5FGCB 1QFWI 4UTBL 1OAUL 1SYSA 3I2CL 4Y16D 4WFHE 4DW2H 4F9LA 4OT1L 3RKDD 4BSVB 2CPCA 5CEYA 4E5XB 4KRPC 2GJ6A 2YPKB 4OIBA 3WS6A 4JZNA 5DUMH 3B9KC 3JTTB 3OJVC 4Z7WE 3I50L 3V0WL 1KCVL 2DI8A 3MLXL 4XPHH 4CVXA 5IUSA 3WIIL 2H2PC 2VLKE 5FCUL 1G1CA 2ITCA 1KCRH 4YQXL 3ULVL 3MRFA 1Q9LA 4J3VA 4I8DA 4QWWC 2P5ED 4JM2D 1E4XI 5GGTH 2OXHA 3U1SL 1M4KA 3X3GH 2KUTA 3WDIA 1BIHA 2IJ0C 1CE1L 1HEZA 3F5WA 3MNZA 4C56A 1DCLA 2MQ0A 4TNVK 3G5YB 3SCMB 3PV7A 2EDDA 1MIEH 4HUNB 5HHNA 1C12A 1EAPA 1GZQA 3L5XH 1UGNA 4XVTH 4QCIB 4C83A 3HKFA 1U6AH 3C87A 2WQ8A 4NYLB 3KPRD 3S35L 5IM7B 4XNXH 4BQ6A 4Y4HB 4XVSH 4PLJD 5SWSE 4OCYL 4JHAH 1OF2A 2DQEH 1Y6KR 1SJHA 4HUKB 3OBAA 1A1NA 4PJIB 2R9HD 1J1OL 2XPGA 1JGDB 2ZUYA 3GIZL 4Z7UB 1BQUA 1WC7B 1DANU 1ND0B 5GGVY 3ABZA 4I1NB 4KVNH 1RJCA 5JW5A 3VFOA 1RJZA 2ZNWA 3VFNB 1QFUH 3T3ME 4JREC 4FTVB 4NBZB 2IAMA 5ID1B 4L4VA 4N5EC 1TPXC 3MRDB 4S1RL 5C07B 1ONQB 1P7QB 4G80B 1T21A 1UCBH 1IT9L 3UC0H 5KAQF 5HDOA 4LSVL 3DXAB 1X5IA 2X4TA 2VDPH 4JANB 2HN7A 5ITFA 1UWEL 2VXSH 2G60H 3KGRA 4WHCA 3LY6A 2EIEA 1DBAL 5DZLA 1V3KA 5EC2A 1NBYA 5EORH 4OI8A 1TETH 2CKNA 3QQ4A 1FV1A 2NY4B 3WL9B 1EX0A 1NCUA 5IJKC 2VLRA 4GW4A 4LEXL 3LRGA 3DX9A 1P1ZA 1XGTA 4QXTA 4N0UB 1KLGA 3SDCB 4ZAKB 1PX3A 5CLTA 5JQHC 1NCDL 4IRJB 4U6VH 3V0VB 3MGOA 2PTTA 5EDXA 3SDAB 4WGVB 3AY4C 1JGVH 5DRXA 1QBBA 3QIBD 4FABH 4E41D 1J9CT 1I85A 4F7PB 1GGYA 3FQRB 5A3IC 3HC3L 2LU3A 1WIOA 4Y4KA 3I84A 1FL5B 3DETC 5I8OL 4HLZG 4CU7A 4KXZH 2B4CL 2Y25A 4NCC2 5AYQA 5DJ6A 1NQBA 3BP7B 4LGSB 3L1OH 4OV6F 2AJVL 3QEGH 5C6TL 5JPNA 4C55A 1CCZA 4HWBA 3FONB 3O45A 4PY8I 5IW6B 4OF0A 1TZGL 4YHLL 2IAND 4Z7WA 4OGYH 4Y5XA 4ZD3H 2G5BA 5DFWH 3C60C 35C8H 1OTTD 2F8XC 4XCCL 3GSOA 4O9HH 4XVJL 1FG2A 2YPLB 4WWKB 4LVNC 1S7WA 3LDBC 4X98A 4YNYA 3MNVA 2XZQL 4U6TA 2DQUL 2B7DT 1CZ8H 1I3GH 1N59B 3CUPB 1D6VH 3EYOB 1CFTB 1WTLA 4HKJB 1AKJD 1T2XA 3L3KA 5CZVL 1X5GA 5J7CC 3SO5A 1IKFL 4KJYA 2X4QB 2Z0BA 1HDMA 4X6FA 2NR6C 4L3ED 4I13B 3H0TB 1JGEA 4P57B 2WANA 3GJEA 3SDDB 1CF8L 4PG2A 1FNGA 2Y6SD 3QB7C 2YD2A 1YMMB 5KOVC 5DSCB 5I19L 1UXWB 3CCHB 4MHHG 5EO1A 2CUIA 3QUKA 2MPAH 1K6QH 5SWSA 2OR8A 5DC0A 1U93A 1KJMA 4G6MH 1B3JA 3SBWA 5JA8B 3RWFB 5I1CL 5K9OA 5I2IB 4GMTL 2A74B 5E9DD 4Y4KD 4D0DA 5KVDH 1NMBH 1CFSA 1LMKA 4HWUA 3ARED 4EOWL 4I4WA 2AK4B 3U83A 4J3OC 1E4JA 5DZNA 3TO4B 1RIHL 4UIKL 4X7TA 1JFMA 1W0YT 2Q3ZA 3OWEA 4WFHD 1QQDA 2J8UE 3C2SA 1KCSH 3QDJB 1LD9A 4GKZA 1ZTXH 2X4RA 3DSFH 3HUJE 4EEEA 4KRNA 4P23B 2QLVB 3QXTA 5B39G 1NLDL 1BQLL 2UVEA 4G9FA 3ZKXC 1WBYA 4P46D 3FKUS 5F3BB 4OCXH 1QVOB 4EUPA 3SE9L 1A6UH 3H3BC 2FIKA 5I1AA 1VACA 4N8PA 3FL7A 1TVBA 2VLKD 4MD4B 4JHZA 3W9EB 3B9KB 5DHVH 2XKNA 1LP9E 1TJGL 3HNVL 4QY8A 2QADC 1R3JA 2HFFA 4KMLB 5IESL 1H3UA 1CQKA 4TTDC 5E94A 1ZT7A 1A9EB 3W81A 3PDDA 5IKCA 1JF6A 5ID0B 2VL5A 1U3HC 4WV1A 4AL8L 2XZZA 3PIQB 1Q9OB 4IRSD 5DVLA 1HHJA 5EZOH 3WFEL 1IGJB 1P4LA 4R3SB 5DGRA 5C08B 2QQKL 1PFCA 3MV7B 3QRGL 4OFDA 1QPPA 5CD3B 1F11A 5DMKB 3LKRA 3JWDL 4PRIB 1RZFH 3V79C 2DRUA 1RQ5A 2E8ZA 3OKOA 1CD8A 1MLCB 2FEEL 3NN8B 3MRQB 4JZJC 4FQQA 1QZ1A 1RFDH 1YJDL 2ADIA 3SOBL 4JFZL 3FB8B 4FA8A 3B3IB 4OLYH 3MV8E 2BMKA 2JCCB 3QO0A 3RA7L 3PDGA 3GRWL 5TE4L 1M6OB 1UH2A 3IDXL 3ECBA 4ZO6A 4MZ3A 1I9JH 4WHYH 4Z0BL 4FFZH 1I8LC 3UZEA 4R7DB 1LNUB 2YKLH 1FZJB 2DMBA 2ICWI 1HIMH 1EFXB 5CJOL 2OJZH 1QSEE 3DGGB 4PGZA 1H3GA 4JREB 5L0QC 1AXSA 3QCVL 4RAHA 5IVZA 1F4XH 2CD0A 2B39A 5IGXL 4JM2F 5GSRB 3NIDF 4NQTA 3B6SA 1JHTB 4JFPB 3PWVB 4KK6C 5D7LD 3SGDI 3BP5B 2NLJB 2B0SL 1ODAA 4OD2A 2F58H 1GOFA 5TDPA 3BN9C 1PX4A 1CYGA 3CPLA 1I9RH 3MRIB 4PJ5E 5FGSA 1VFAA 4KHTL 1NCBL 4NKDB 1K9TA 1A4KA 1QLEL 1CR9L 5E6IC 1YEIH 4GSDH 2P5WB 1JFQH 5EZJB 4Q6IC 5AUMA 4YX2L 4OCLC 3PV6B 3VW3H 5H8DA 4JCLA 3UBXI 3BPCB 3ZDYE 3KLDA 4KU1A 3PNWB 4WUKH 3BISA 1BAFL 3GI9L 3V6FA 2J8UA 2AEPH 4J7RA 4KJPD 5IMOA 4PJDF 2VMFA 3VRIB 2QSCL 2WMPA 5FYKE 3BVNB 3HUJA 3L3OA 1QACA 3RDTB 4FQXA 3WD5L 4R4BB 4YUEL 4ONGL 3LRHA 5GS1B 4MD5B 2ITDA 2LAGB 5A16A 2H8PB 4PTTB 4DK6A 1V7NH 1UM4H 4QRSB 4H5SB 5IMMA 1I7ZB 5IJKA 3O3UN 4DN3L 3W5MA 4PLOB 4WW2C 1RULH 1BP3B 3WIFB 2VLJD 5HVHB 1F6FB 5BV7H 1KB5L 2CLRB 3C60B 4CMMA 1UJTA 1FC2D 1R3HA 2W1NA 4M62H 3P2TA 4FQCH 3ARBD 2DQJH 5HHMB 3AY4A 3R1GH 3PWPD 3LDBB 1E6OH 3UPAA 2ATKB 4OZHB 3LPWA 1GGCL 5BS0D 5C0DA 3UPRB 1T0NB 3FQUA 1MCLA 4OLUL 3Q2CA 4IHOA 2IQ9H 1JN6B 3NH7L 3HLAB 5J12C 3CLEL 3WJLA 5EPMB 4NBYB 4OFKA 3LHPH 1EHNA 4M48H 1OTSC 1YYLL 1QLRA 2I26N 3S7GA 2V7NA 2IF7A 4IDJL 4NWUL 1T22A 3JXAA 4ODSH 4XWGH 1BGXL 1S7UB 5J1AB 2XN9A 4PTUB 3MV8A 2MHAB 3U46B 3LQZB 1C5CL 5K9QG 3CXHJ 4X9GA 3IJHB 1MAML 2A77L 1MH5A 4AIOA 4Z7VB 1KGCE 4GKOA 4UT9L 3JBG7 1JBJA 5GGSY 1OAUH 1IM9B 1QSEA 5HGDA 2AKRB 3UTQA 4LF3B 2GIYA 1DEEA 1AFVH 2HG5A 4HV8A 2NW2A 2X1OA 3H7BA 1FPTH 3MA9L 3HCVB 2JB5H 5EC1B 2APTA 3ARZA 3TYGH 3VXOB 3WIIH 3ARGB 4HXBL 4WI4A 3Q5TA 1KEGL 5DJZB 1Y6NR 2P42B 1V5JA 4YQXH 5IB3B 3C2AH 1X4ZA 3NFPB 4WDIB 1KOAA 1MNUL 1PYWA 3VGGA 2RIKA 1YDPB 1X5HA 4PJ5A 3QSKB 4A2LA 1BFOB 4PJBB 3HA0A 3MLZL 4XWOC 5I30H 3MLWH 5I8CA 5BXFB 3EYFA 3DLQR 4JPIA 3HC4L 2Z8RA 4G9DA 1FSKB 4JGUA 3N1FC 1IFHH 1U3HB 1VFUA 3KNBB 4HIHB 3F62A 1DUZA 3BWUC 4GG8A 4YXLL 3C8KB 3O6FA 1CWVA 1KIRB 2X4PB 3RHWK 1MCWW 2DJSA 3BIKA 3MJ7B 2DAVA 4CMHC 3B43A 5E2UL 1S7VB 3FFDA 3HI1B 2Y5TA 3S35H 1TQBC 3VFUA 5F93C 3QIWB 4QXGH 5EOTB 3IDIA 1D5BB 3S4SA 4RGNE 1AGEB 1GIGH 5EU3B 3DO3A 1HHHA 2QEJA 4JHWH 1FNHA 4QXWA 1EO5A 1MFDL 5DQDH 5C2BL 4JZJB 2VN4A 3CH1A 2ADJA 5H94B 3U4EB 4WHYG 5E1AA 1SM3L 1XCTB 3B2UD 2OX5A 2YC1B 1NFIA 3CAFA 4ZS6D 3ULVC 2IPTH 5C0JB 4KKLD 4TSBH 1DLHA 4W6WB 5FO7A 3L3JB 4XBEL 5D1XA 2AXGA 4UV4L 4JKLA 4JY6B 4R97C 2FD6H 3DX6A 2A2QT 1BVLB 3VD4A 4AMKL 1VADA 5F89A 5FAAA 5IVOA 3SGKC 3IRPX 1MUJB 4MWFB 2YEZB 1WCBB 1P4BH 1Z5LB 4LLAA 2IMNA 4TVPH 1FZMB 2DTMH 2VLME 4R4NC 3U7YL 1NC2B 4NSKB 4TYUA 4U1NB 5F3HB 1U8NB 1T80A 1MHEB 2Z35A 3IGAA 1MQKH 4LEXH 4S2SB 5D2LF 4P2QE 5GJTL 1ED3A 3L3DB 5JMOC 5DHYB 2AW2A 2UWEE 1P2CB 4Q9QL 2X9XA 2R23A 5DUPH 5CZKA 1NCDH 4MA7H 5BRZA 1R5VB 1IVLA 3FQWB 3PQYE 2A1WL 4P3DB 3FMGH 1TJIH 3NIFF 5F7UA 3O6FD 5D1QC 2Q6WA 5E6IB 3JV5A 2XRAL 4QHMA 2AEQH 4ZSOB 2W59A 3CFEA 1BX2B 4OZ4A 2JJWA 5DQ9B 4OZGB 3VWKC 3VJ6A 3SGJC 2GSIB 3HE7D 4PY8J 4RRPA 2FH6A 1GPOH 4P0DA 3UTSD 5DF0A 3T77B 4ZODA 4M6ML 1XT5A 3WUWG 1B4RA 4CW1B 1J1XL 2VABA 3QWRA 3CFKB 1NEZB 4PRHB 4E42A 3QA3B 3IFPB 1MJUL 3O6LH 4LRNL 3OV6A 4RFNB 5IHLB 2XZQH 4OFVA 3PJSB 3IETB 4LSTH 3U2SA 2Z93B 4L1DA 1AGDA 1ZEAL 5HHOD 1CDCA 3QUZA 1DN0B 1Q72L 4G6KL 5DMGC 6FABH 2IGFL 3B2VH 3FQTA 1WFTA 5EO9B 4XT1C 4Q6IA 4MQ7A 1IAKB 5JOFB 1GAFH 3VXNA 3MR9B 4GW1A 4UT6H 3ETBF 1JYXA 1V3JA 2B4CC 5LBSL 1W8OA 1D5IH 4BQ9A 1A3RL 5I19H 4LMQI 5GRVL 3S8WA 3C8DA 3VXME 4NUGL 3DWTA 1XF2B 4OFYA 4P59L 4WFFD 1P5VA 5T5FL 3VD3A 1FO0L 3MZTA 5DT1L 1WLHA 5I1CH 2CMRL 2HTLD 2D2OA 1OM3H 4GH7B 2BVQA 2IBZX 3V95A 2X42A 5DFVC 3OHXB 4BFIA 3GM0A 5BW7C 3IXTB 2V2XB 1S7QA 4PD4K 2CIKA 4ZPVA 5C0BD 4WW2A 5F7WC 3MACL 3MROB 3TZVA 3KR3H 3V6ZB 2NYYD 3MRMA 1QSZA 1AE6H 4PBWD 3TBYB 1PQZA 2OTWA 5EZIL 5C0AB 4WEBH 3VRLF 5B8CC 5T3ZH 1A6ZA 1CGVA 1LQSR 4HHAA 3HRZB 4MDJA 2ZWLT 1LO5B 5E8OB 4MJ4A 4KKNA 1VDGA 1UCTA 4JFXB 3VD5A 3EIFA 4HUMB 3K4AA 1R0AH 3VFSB 2V5TA 1Z9MA 3QWRD 1N4XH 4N0CC 3WXWL 3C6SA 1TJGH 4G5ZL 4P2QA 5B22A 5I6XB 4RISH 4NO0B 4I0PA 2UWEA 4MQXC 4R0LA 2AJSH 5DWUL 3ALWA 3RY5A 5JLZB 2PF6A 4JPKL 1INEH 5K33A 3OJDB 2VISB 2ZZUT 4DKFL 4PR5B 5A43C 5C0IA 2DB8A 4AL8H 1SYVB 2C3WA 2FGWL 4KY1L 4ONFL 4HS8H 5EUOB 4X6EA 3GJFB 1HHKB 2E6JA 1LE9A 1G6VK 5HXMA 1H8OA 4APQD 5JPMB 4O5LL 2QQKH 2VAAB 2I5YH 2C1OA 4QLRA 2NY7L 3L3GA 2FWOB 2J5LC 5HGAB 3UROR 3WUWA 3PWNB 2EKSA 1GZPA 4GAGL 2GUOB 5CGMA 5KS9F 3U48A 2IFGA 2EDWA 4LLUA 3VH8A 2K9UA 3MPCA 1M71B 3VG0H 2J8UF 3BPLC 4MS8C 3RWCA 4LIQL 43CAA 1CDGA 1HQ4A 1IJ9A 3SDXB 1T20B 2IFFL 2O5YL 2P1YA 3MRCA 4F33A 2ZOKA 2VITA 1TQBB 3GSNL 3RA7H 3OKNA 2ZUXA 3RBSA 2DD8L 2PYEE 4MDIB 5GS2H 1KCUL 5I8EA 1F00I 4PJGB 1RURL 4EI6B 4YPGA 5J8OA 2ICWJ 1LP9F 5CIPB 4CVWA 5IBLC 5T33L 4LPXA 5JO5B 3DHJA 4OCWL 5CJBA 3UYRL 2MKLC 5T1MA 2H6PB 2R39A 1CFNA 1O7SA 3STLA 1ORQA 2VLMD 4MAYA 4XHQA 1A1MB 3TH3T 1G7LA 2RJMA 3T09A 4IJ3C 4U1HB 1WF5A 5I1HL 3JWDC 5BZWB 4NNPH 3MBED 3P4OB 3VXMA 4LCYA 3RIFK 3PHOB 1OL0A 3VCLA 1CBVL 5JHDD 3V5KB 3RY4A 4YDKH 4V1DA 1BJ1H 3PQYD 3K7UA 5IMLA 2PYFA 1NCBH 2BXZA 5IVNA 5IV2A 1HILB 2V2TB 4NUJA 1YJDC 1CR9H 2VSDA 5AAMA 3H3PL 2ED8A 4YHOL 3T2QA 1ZT1A 3KPSD 3CDGA 3K3QA 2LVCA 4J6RL 1JCKA 1ROWA 3E8UL 1G9MH 2VQTA 1NFDE 2W60B 1DQDH 5AWNH 2A9NL 1EFQA 5EN2B 4NJ9L 4LHUG 4N8VA 3RL1B 1CXIA 5SX4I 3KHOA 2J1KA 1KIPB 5D1QB 3VD7A 1OY3B 2P8MB 1K4CA 2H3NA 4L9DA 1W2KT 5TE6L 1FGNH 4UT7H 1B4JH 5AD0B 1OQXA 5F7EL 2E6PA 3VWKB 4LPYA 5K59E 1Z3GL 3Q1SH 2ADGB 4GAJH 2XWJB 4JAMB 4ZFZB 1DJSA 2FYYA 1NGPL 1MEXH 2OJEA 3QEUA 3WXVH 3DRQA 3GSVA 4M00A 5F21B 5EBMB 3TJEL 5T1LA 3BD4A 4P99A 3C09B 3VXTA 3MTRA 3UTTD 4GG6F 1HSAA 1C1EH 3CSBA 1RUQL 2DL2A 1GGCH 2VSCA 1NC4B 3IKCA 4MGXA 3U6RA 1YEGL 4ONOA 3ZE1F 5DI8B 2P8LB 1DSFL 4C58B 4EDWL 5D4QA 5I1JH 2FJFA 4ACPA 5C70A 5JW4M 3G5VA 1D9KC 4OBSA 4P2OC 4WNQB 1N5YL 4N9GA 3ZDYF 4UDUB 1XMWA 2GFBB 3L5IA 1YYLH 3LCYA 5D71H 4R9HA 1B90A 3GO1L 3RX8A 2DQTH 4TUOB 1IGYB 5D7JD 1PLGL 2VDRH 4G8FB 5FGRA 2D7TH 2FO4B 4ODVH 5EBWA 1BGXH 3LOWA 2XA8H 1N26A 3SE8H 4WCYH 1A2YA 3IDJA 3U7WH 3QUYD 3RWHB 1SMOA 1MAMH 5IW1B 4LARL 3T0EB 4DGVH 5EU4B 4KDVA 4JFEE 4RZCA 4UT9H 5MERA 3IB4A 4OSUL 5T3XH 5JHLL 1NFKA 5BJTA 5DK0B 5I76A 2R1WB 3HPJB 4OLWL 4M02A 2F9BT 3M1BA 2E9BA 4G3YH 4KHXH 1KULA 4Z76A 2ADFL 4K3JL 3MA9H 4JFQA 4F57H 1QBLL 2BXYA 5KSBE 2AP2A 5B8CB 1R3IH 2AK1L 4K7PX 1ETZA 4Y8DC 1E0OB 4HWZB 2NY3C 3D87B 1DBBH 4XZUA 5AZ2L 3QXDA 3GSRB 1JZ4A 3EDEA 4P2RE 4UTAH 1CE6A 4QOKE 1FVEB 3IVKA 5ACMA 5E4IA 1YMHA 5HBBA 4K3GA 4NQCE 1HOCA 2R8SL 2BY1A 3LQAL 4HX1B 5IG7A 2XFXA 3FRPG 1F58L 1C5DB 4M8VA 2JJTA 4ZYKB 5GS0L 2YBRB 2VERN 5BW7A 1NFDA 4IOSD 5D7IB 3A6BH 3WFBH 1D6EA 3H9SE 2RFXB 3KPQA 5HVFB 5E70A 3LPFA 4PJIE 4F9PC 2N56A 3LN5A 4RX4D 1UZ6E 3RGVB 2J5LB 3W11C 2YR3A 1U8IA 1F4WL 5ESQB 3VFWA 4YDJA 3SKMB 4DWHA 4RQQA 5ACZB 4XAKE 3OKLB 4WI9A 2BOCB 4TVPD 5B38G 1IM3A 2PYED 1AY1L 3VU2A 3IDMB 4ODWB 2AV1B 2WP3O 4L8SC 4MJID 1RUKH 3IFOA 1FCGA 5A2KH 5FIEA 2VZ3A 1ZHKB 1QFOA 3OAZH 4RBPH 1CDHA 5FFLA 2CO6B 3O3EA 4D3CL 3CD4A 4UV4H 4KK8C 4M5ZL 2IALA 2CRMA 3DARA 1VSCA 2CDEB 5JR1H 4WI3A 1NCWH 1S9WA 1K8DA 1IKNA 3UBXG 3BSZL 4QRRA 5IJVB 3GMMB 4F7MA 3HE6D 3AXLB 3K0WA 32C2B 2CKBL 1GXEA 3UXFA 4XBPA 2BHZA 4WI7A 4X5WB 3IXAA 4QRUB 1I1YA 1II4E 5SWZB 1FFPA 3WNKA 1NKRA 3O4OC 4XCFL 3ZHKA 4LHUD 3ARDC 7FABL 4IJ3B 2ARJQ 1XIWA 3O2VH 4NKOB 3PGFH 3BP4A 4KJQD 3S3SA 4WU7A 1M7DA 4NZJA 2I27N 3RWIA 4HGWA 4XP1L 2CQVA 5TDOA 3RUGE 3VGAB 1IE5A 3DHMA 3NPSC 3KPPA 4N0FB 1FL3A 1GGTA 3IRZA 2NY2B 4JFEA 1JUFB 1DQJB 2JE8A 3G6AB 3TPUA 1W72L 1RZJC 3CX5J 3UAJD 2NY6C 5LGHL 2PO6A 4KROB 4OD3H 2M2DA 3FQNA 5L6YH 1EMTL 1P7KB 2PR4H 3S98A 3DROB 3FB5A 2HLAA 3T65B 4HJGB 4FFEX 1Z9SA 4WRLA 4LKXB 4QYOB 5GXBB 5I0ZA 5KSBA 1S7TB 4PJCE 3ZKND 4PP2B 1IGIL 1ZT4B 2ICWA 4JFFB 3MZGB 4NRXB 5C7XH 3FRPA 3ZLQC 3DX7A 3U36A 1TMCA 4P2RA 3M45A 3WN5B 3ZDXE 4QOKA 4U1KA 2H26A 4XP6H 2A83B 5GRJL 3HPLA 4FG6C 3D2UD 4FMKA 2IQAA 2UWEF 4OF6A 1UZ8A 4NIKB 4QHLA 1NAKL 4XCNB 1ZEAH 2HRPL 3GBNL 3G6JE 4HZLB 4M7LT 4NQCA 4G6KH 4MQSB 1ITCA 4D9QD 3VI4F 2GKIA 3TBTB 4EDXB 3FQXA 3N85H 4PJ9D 4PJ7B 2ZUQB 3MRLB 4ZTPL 1FFNB 3CVHH 5C8JA 2KZWA 1K85A 3GRWA 3BW9B 4U6XA 5B38A 3FFCD 4ZMAT 3OKKA 1VHPA 1A6WH 3H9SA 3ILQC 1FL6A 3P4MB 4PJIA 2D0FA 3DO7A 4MA3B 3EO0B 3RVTD 1FNEB 5T3XE 4GRMB 1OAQH 5F9OH 4U1GC 1BEYL 1ZA3B 1WV7T 4P2OB 3BKML 5T3ZD 2AK4E 4GBXA 1EEYA 1FO0H 1MWAL 1QHOA 3SKOA 3UBXA 1I7UB 3ULUL 4PJFB 5EU5A 3UEZA 1FC1A 1QRNA 1ZSDA 1CG9B 3QDJE 4U7SA 4Y1AB 2F5BH 4ZQKB 5C1MB 3GSUA 5A1AA 2EH7L 1T1ZB 5CBEA 1PEWA 2RGSA 1CICA 4KAQL 1FN4A 2C7UB 4JN2B 4NO5B 5FYLL 2X40A 3BYYA 4FFVD 4OB5L 4DCQA 5CD5C 1U3JA 1Q9KB 2AABH 3L3HA 2MTPA 1S7SA 2YSSA 1FZOB 1G6RB 2JELH 5SV3A 3B5HA 3QDGE 4F7TB 4CN1A 4F3FA 3N06B 3GGWB 2CUHA 4PS4L 4NNYB 1K5NB 4LPUA 1CDUA 1J05A 4Y88A 4LSUL 4P2RD 4WHDA 1D9KA 1YNTA 5DA4A 1U8PB 3FQRA 3IDNA 4JGMA 3SCMD 5C08E 1FVCA 1EZVX 4MB3A 3MO1B 4X8JA 3M8OL 3LQMA 4NO3A 5EU7C 1NL0L 4OLZL 4ODTL 3RUGA 2NY1B 1QD0A 5DD3L 5CP3A 3LEVH 4FXKA 2OI9C 3NAAH 5CP7A 1GGBH 2UZXB 4Y4HD 1GSMA 3IDYC 3NZ8B 4LU5L 2E6QA 3Q5YA 3U9PL 1CFQB 1ZK9A 1DP0A 2WBWB 2OXGA 4KZEH 2DYPB 5JDJA 1RHHA 3G04B 1RU9H 1KB5A 2M1KA 2X4OA 3EGSB 4HBQA 3T3PF 5LGJA 3JWOH 2DQCL 4GBXD 4FTVD 3WDJA 4DK3A 1OARH 3CFJA 1MREH 4W4NA 2O5YH 2MCPL 3VFTA 5C07D 1IL1B 1P7QD 4JRYE 4L9LC 4PJCA 2D0GA 1R24A 2IWGA 3E6FB 2HT2C 3WLBA 1LO2L 3WSQL 2W9DL 3CUPA 5E2JA 4MA1B 2DWEA 4S1DC 4OIIL 2APBA 2DBLH 1CICD 2UZIH 3B8YA 3BFOA 3ROOB 5T33H 4L29B 4YDIL 3UJJL 4ZS7L 5B4MD 2NY4D 2EYSA 4R96A 2VXQH 1PKQB 1I7RA 4OCWH 4OUUA 4L8SB 5CJQH 3G6JA 4LVEA 3HB3D 3OJMB 3KPTA 3RU8L 3RVUC 2ARWA 2V7HA 3CZFA 1IBGH 4XTRC 3SDDA 3RZWA 4Y5YC 2G75B 3SDCD 4ZAKD 3CCHA 4YXKL 4JO1L 3L6FA 5BO1L 5GGRB 3SDAD 1SVCP 1NDGA 3DJ9A 3MODL 1HK6A 1H3PL 1S9VA 4BZ2L 3DRTA 2QQNL 2X70B 5L2KA 4F9PA 1CBVH 4LGRB 5C3LD 2YUVA 4PRPA 2AK4A 5FB8B 1WFOA 4IEFB 4RCAA 3O4OB 3H3PH 4YHOH 3ARDB 2LU4A 4LAQL 3P4LA 1A4JA 3PUCA 1CT8A 4D0CA 4HFWB 1U8OA 3TN0A 3UJTH 3TCLA 5D70H 4LMQE 5FHAL 4J4PC 4TUJB 3BMWA 2H45A 2DICA 1UWGL 3RWEA 4PGJA 3RZCC 1AD0A 5T1KB 1OGTA 1XF5A 1R5WA 2XKSA 4L8BA 2YMXL 3H9HB 5JORB 4G6FB 2DQIH 2HT4D 4NQDB 4ORZC 2ESVE 3F7QA 5C0CB 2A9ML 4ZFGH 2K7PA 4WWKD 2CIIA 3CMOH 3QDGA 3TV3L 3OB0K 1Z3GH 3TH2T 5HPMB 1TVHA 1AIFB 5ID0A 1N8ZA 4IRZL 2R56L 3V8OA 1EXUB 1NLBH 3H6JA 4ISVA 4U1LA 5IB2A 2V2WB 3U7AA 2CLVB 2DM3A 4ENEC 4P9HH 4PB0H 3TJEH 4NO2A 4ZTOL 4OZHE 2DF3A 5BCAA 1J0HA 5HHVH 2R0WH 4NCDA 2FNBA 2CLZA 1B2WL 3SDDD 1NPUA 1XGUA 1YEGH 3F6IA 2E9JA 1FP5A 3PABB 1JIBA 1DSFH 2I60H 4O2EB 4WY7L 3JTSA 3GI8L 3K2UL 4JG0L 5EZLB 4OCRL 5DJAA 2ZKHL 1BQHB 4YIQB 2R69L 5IQ9A 2DMKA 5EUKA 1T2QL 1OQOA 3G9AB 5T3XD 5E2VL 4XX1E 3BGMA 4HWEH 3O9WC 2AK4D 5JMRA 3S88H 2MFNA 3TO4D 4JRYA 2B2XL 4JG1H 2GTWB 2NMSA 3MV9A 4K9EH 3TN0D 3QDJD 3R4DA 3CC5A 4LLVB 4X6DE 4HD9A 4L4TB 4P23D 5EOQL 3SY0B 5FCSH 5FO9A 4I5BA 4LRIC 5KSUB 4TRPL 1GC1H 4QRPA 3ZL4H 3SQOH 2WBJA 1IGFL 4H25A 4PV8B 1ZHNA 3G5XA 5D1ZC 1JPTL 2FO1A 3CU7A 3B9KD 2NNAA 1IILE 3ULSA 3GUTA 3QDGD 1SVZA 2CH8A 4XNMA 3ZMRA 5F7DA 4HIIB 2F19L 5LXGL 4D8PB 2H2PD 2A6DA 2AK1H 3KXFB 1ADQH 5F96H 4UIMA 1MRDL 3QEQB 1WQVT 1N0LA 3NA9H 4QTHB 4HIXL 1I9IH 1ZLUH 1JRHL 3D0VA 5C08D 4LLDB 3MOBL 3MV7D 3QXAB 4K8RL 1SJEA 4NZTH 5ESAA 1MJJA 3BPCA 1LEGA 3CFCL 4NQEB 4OGXH 5D8JH 5DXWA 5TPWL 4M6AA 5ITBL 3QAZC 4LIQE 1P5UA 3P11L 3D0LA 4ZUVB 1CFVL 2H9GB 3QQ3A 3FO2B 4LASL 4RAVA 2E7LC 1RZKC 5HYEA 3L95B 4EI5C 3PL6A 3NCYP 3RI5F 4ZPTA 3VRJB 4WO4C 3DGCR 2HVKB 4K7PL 5CMAA 4ZG1A 2ZSVA 1UACL 1WZ1H 4N90D 2HRLA 4HUUB 2GK2A 3T08A 5KVEL 2E27H 2A6KB 2APXA 2OI9B 3TT3H 3D39B 3B9EA 3DNKA 5EULV 1UWXH 5CAYB 5DEFA 1OSZA 2ESVA 5E2WH 5ICZA 4NKQB 3S3PA 5DUBA 1KG0A 1QEWB 2CDGB 1L7IL 4S1QH 4X6CA 4GUPB 4R90L 2SEBA 1S9XA 4XMKH 1N0XL 3D85A 4UUJA 3AU1A 1MI5A 4TUKH 1H0DB 4LCCC 3Q0HA 3CVHA 4HGKC 4HF5H 5F7LB 5E95B 4N5ED 5KSBF 1FDLL 2CRYA 1YZZA 4L9LB 2WBJD 5JIIA 1K2DB 5BVJB 3DVNB 5E00B 1GL4B 1QBML 5BVPL 5IMKA 1T0NA 1NCCL 1LDPH 5TQ2H 3QG6B 5K9JH 4XP9L 4OZFB 1RHFA 1FO0A 5IOPA 3TBSA 2FGZA 4JY4A 4XNYL 5CIPH 5EPMA 1S7XB 4NRZB 1QNZH 3BRGC 3LQAC 3CXHK 3CX2A 4XHJC 2CKBH 3W9DA 4PREB 5D2NE 1H8SA 1CIUA 3I3DA 3UDWA 3PHSA 2XTJC 12E8L 1N7ML 3HZYA 4P9ML 1WBZA 1BD2B 2O5ZH 3GJFK 2X89A 4PRDA 1WWCA 4EBQH 2CDFB 4PJIF 5JW4N 2CK0L 4Z7UF 4FQLH 3ZT5A 4DTGL 5I75C 1BJMA 4TNWF 3LRSB 2DLEA 3VI3E 4X6DA 4EVNB 4OZGE 4PGDB 3RDTD 4HUVA 3U9UB 1XZ0B 1FIGL 2J6EL 2QJDA 1YEEL 3V4VH 4CKVX 5JQ6H 3Q6GL 3GSQB 3DUUB 5HYJB 4O58H 4JKPL 2ESVD 1T1WA 3IU4L 2ZCHL 3VXQB 3G6DL 5HDQL 1V05A 1EMTH 3E2HC 3RZCB 3VXUE 1WIPA 4PRHE 3QUML 4HIEA 4OQTL 3WNOA 3GMRB 4PG9A 3TVMC 3C60D 4Y5YA 2F8OA 1Z9OA 1X5YA 4WI6A 2BVYA 2IPKA 2H2SC 5ILTH 4JFOB 4XXDB 5HHMD 4CNIA 4MA8L 1KENH 3WFHA 3MBXL 4RIRB 1BF8A 4XC1H 3PWUB 1IZJA 3MYJA 1NEZG 2OZ4H 1NAKH 1HI6B 1TZHB 4BZ1L 1NBZA 4KK5C 5D93C 4H88L 4U2YA 4BSJA 5JW3H 1VA9A 4ZTPH 3GSNA 1YQVH 4LL9A 4CU6A 3EAKA 2E7LE 5IB5A 1CK0H 1LO0L 5H35A 5EOTA 3MRRB 2Q8AL 3OZ9L 4BH8A 3S36H 1J8HA 2RQ8A 5DS8B 2I07B 4RMVA 3I02B 1JYNA 1BBDH 1A14H 3QFDB 3FT4B 4ZUWB 2W0FB 5ERWB 1OLZA 5JW4R 4WTZA 4ZDHA 1TJHL 2OLDA 2DQDL 4PJCF 2LFGA 1T2JA 2IG2L 3O6ML 3OAUH 4OLVL 1L9MA 4J3WA 1EEZB 5I17A 5GRYA 5DJYB 1QRKA 5LQBH 2AJZB 2YA2A 4FZEL 3ARGD 2EDEA 2DQHL 5I66B 2VXUH 1OLLA 4DN4L 1AGBB 3BH9B 4UV7H 2AJUL 5KTEL 1A64A 2HA1A 5D1ZB 1P2CA 5D2NA 5DJCB 3DUSA 3MRGA 3LZFH 3S34L 2ICEA 1AO7B 1U41A 1MFEL 4PJXE 5B3JE 2XTJE 4RNRB 5EUOE 4ODBD 3EUUA 2L4OA 1U3HD 4MNQB 3GBMH 1CXFA 2ZCLH 4TSAL 3TYFB 3W0WB 2HTKD 3OGOE 3KDMA 1D7FA 3O9WA 3BZFA 3WYRA 2Z31C 4QXUL 4GXUN 4IBLT 5DMIH 4XH2A 4ODTH 1NGQL 4X7FC 3HFML 3FB6A 4JN1L 4Q9RH 1RZGB 4NM4L 3VFPB 4B41A 2VIRB 2YD4A 3V6OE 3QIWD 1MCEA 3QAZB 4O51A 4R26L 2FB4H 1T3FA 2Q8BL 1JTOA 1H9VA 3L3IB 1I3RA 3O41B 3FT3B 4WO4B 3BRFA 1IAMA 1DE4A 3PWJA 5I1DB 3VXUA 2ZUTA 5DDHB 1S9YB 5GRXG 1NGYA 4UQ2B 1RIUL 4G8GB 2EZ0C 5IFAL 2XIDA 1H3XA 2OP4L 4UDTA 1L9NA 3QJHB 1CFBA 2NZ9D 5DD1L 1JPFA 1DN0A 2MJWA 2VZOA 1YA5A 5F1NA 3E1F1 4LCCB 2VDMH 4NPYA 4YHPB 3TBWA 5ICYB 2W0LA 3TNMA 5AG9A 3P77B 3QDHA 4OI9A 1INDL 1U8HB 4IMLB 3ARFC 4HS3A 2FHCA 1UC6A 2OL3H 2QL1A 5MEQB 4BKLA 3RNQA 4S10A 3I3BA 2HJLA 3GKWL 1UB5B 2E7LA 1NJ9A 4I3SL 5LWYL 4EI5A 3NCJH 1YYML 1CLYH 4G6AC 2H32H 1F3DH 1YNLH 3ILPB 2VE6A 4JJ5A 2QQNH 5C0NC 4X7EC 2FSEB 4LCUB 5EU6B 2B8OT 1Y0LB 3P73B 2E9IA 4KC3B 5H37H 3BQUB 2LV4A 1FGVL 43C9B 1KNOB 2IBBA 4K3HA 4F2MB 4R2GB 4LAQH 3P3YA 3OKMB 3MROA 3QDMB 5FDWB 3RRQA 5TGBB 3KYKL 4H8WC 3DVIA 3MQIA 5J9PB 1ZXQA 1JPSL 4I3RL 4D9RE 2J3SA 4PLKC 1M05B 4K07A 3BKYH 5E99L 2EIBA 2COQA 3QUXA 3MUZ1 4XMPH 1FFOB 5GZND 5DTFB 3MFFB 4O4YL 4PBXA 1IC7H 4PRHD 1ZVSB 2WWMC 4GT7A 4Z7OE 4V2BA 3BP6A 3EJZD 5H2BA 1MCQA 3ES6B 4M7ZB 3BHBB 3G5ZA 4RMTA 5FYJH 3V5DA 4CBPA 2BC4B 1XGYL 1RZ8A 5DEZA 5FHBH 4AEEA 5ESVA 3NCBB 4ZXBA 4PJXA 3IS1X 4KJWC 4AQ1B 5IR1B 1UG9A 1MY7A 2E5EA 3TVMB 5IVXB 1JPGB 5MHSE 1UJ3A 2ZOLB 4GRWE 2R2HA 4JY5L 5EG6C 3RWGB 3WFDH 4HXAL 2BDNH 2PN5A 5AYUL 3B8SA 2NXYC 3ULUE 5I1LB 1W0WB 2R2BA 3V6OA 4X4ZA 2QR0A 5SWQA 4JLRB 2R69H 4KKBC 5DJ2B 1LEKA 5IBTH 2VDNH 5E2VH 3VE0A 1UVQA 3EO1A 3QNXB 1A7NH 5FYLE 1P4IL 4XCYA 4U1IB 1NUDA 1VKXB 1MJ7L 4Q0XL 3E2HA 1MIML 2YK1H 4H26B 4OV5B 4G7VL 2DKUA 5CEZH 1G7JB 4MJ6A 4PJHB 2L0DA 1CGYA 1U8QB 5EIIA 1BVKA 5JO5A 2CKBA 1YUHB 3GMNA 3C6LB 5D7KE 2IH1B 1AQDB 3QUXD 4Y5VC 3QFJB 1OAXL 4JE4B 1QFHA 1G7QA 2BRRH 1X3DA 4ELME 4ZNEA 2HT3D 3RGHA 1KTKE 4OZHF 2BOBB 3JTCA 1XCQA 3BWAB 3T2OA 4NO0D 1QSFB 2ICES 2D31B 1T4KA 2F19H 3FO9B 4FQIH 5LXGH 4WIQA 4XB8A 3RNKB 1NUNB 3OAYH 4XPAH 2X7LA 4K2UH 1G6RH 2F53E 1R3KA 1I9EA 1KTDB 3DI3B 3TT1L 3NBNA 1W72A 4GS7C 1NBVH 3HTLX 3O3DB 4W6YB 4AENA 5MEPB 5KVGL 4JQIH 2ARJB 3HG1B 1DLFH 1DQMH 4XI5D 4MVBD 4XVUC 4Z5RA 4PJEB 5ITBH 4IMKC 3MLYH 3TNNA 1OGAA 4LASH 1AHWA 1VB9A 4Z7NE 5I0DA 3T0BA 2Z31B 4DKEL 4ZUSA 4Z7VF 4M7KH 5KW9H 5IHUL 2BSSA 4C4KO 1CLZH 1JF1B 5FOBA 1TNMA 1RZ7L 3BKCL 1KPUA 5C0RL 1KTLB 1U91A 1QR1B 3DVGB 4OM0L 1HHIB 1G0DA 4KDWA 2OSLB 2MSPA 1L7IH 4LCWA 1Q0XH 5D9SA 1QTYT 2NW3B 2XY2A 4ODXB 4ORGB 1N0XH 1TCRA 3EZ8A 2Q76B 5HI4C 1WZLA 3BZ4B 1DQTA 4KTEH 4CJ1A 2C3VB 4MXQA 3V4PL 3RPIB 1S78C 2HKHL 1FAIL 4PJBF 4NHUB 3REVB 1MVUA 3VGHA 2PW1B 2JB6B 2DI7A 3R06B 5HHPA 3EOTH 3SDYH 5I18H 4QRQB 5I1GH 4K8RC 1Z9LA 1UYWH 1J0IA 4LDLB 2BVPA 3EW3B 2W65B 2VH5L 3M17B 4JDZA 4LSSH 1JNHA 1MWAA 1XGRB 4JM4H 4OF3A 1DBKH 4I0CC 3BZEA 3SKJH 4X9BA 7CGTA 4E0RB 2I9TA 2OR7A 5T5NG 4ZFOB 12E8H 3QEHB 2FO4A 4A6YH 4GO6B 4B7LA 1Z0NA 4M8QB 5I8KH 15C8L 1A9BA 1WT5C 3VFVB 3QPXH 4RGMC 3I6GB 4YBLC 1OTUD 2Y7QB 4M43H 2ZSWB 1TIUA 3HZMA 2GY7B 4P3CH 1N5AB 3MA7B 1I8MA 1ZHLB 1I8IA 4OBRA 4AEIH 4G6JH 4QNPE 1NAML 3FOMA 1FYHB 4DAGL 5LGKA 5KSVA 3HNTH 3NCMA 1JNLH 3H8NA 5D1QD 1AJ7L 3MNWA 1ORSA 3AS0A 4PJAA 4JRXB 4QT5B 3U0WH 4M7JL 5HGBA 4Q9BA 3NZHL 3QH3B 3HI6H 3KPMA 1F6AA 4DOHB 3Q6GH 3QISA 1KIQB 4ELMA 5C9JB 1Q0YH 2ZCHH 2R1XB 5F88B 3UZQA 1IQWL 5MENE 2E7BA 3P9LA 4PGEA 2BVOB 3F58L 1G7PB 4JFFE 5KVFL 3ARFA 1EA9C 4FFYH 2H41A 4GW5A 3VXRE 1D5ZB 2P8PA 5ETUB 1KLUB 1ZHBA 3VWJB 4MXQD 2GT9B 2R0ZL 3QXVA 2F53A 4UINL 3X3FL 1OW0A 3P30H 1BREA 3K8MA 3C5ZA 3EOAB 4XC3L 5CFHA 5MHSD 4LHQB