3MRLA

Crystal structure of mhc class i hla-a2 molecule complexed with hcv ns3-1073-1081 nonapeptide c6v variant
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Analysis of Relationships between Peptide/MHC Structural Features and Naive T Cell Frequency in Humans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 80
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mrlA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mrlA01
3G6DH 1BGXH 4NHCL 5GRUH 1Q0XL 1HSAA 2RCSH 3O4LD 1RZJH 4DUVA 5J13B 5BJTA 2P8MB 2NY2D 5K9OB 2J6EL 1CT8A 2W60A 1NEZB 1QYGL 1YEFH 4PJDA 3KLDA 1U95B 3QH3B 1T22A 2DQFB 4QRPA 1PG7X 2HFFA 2BXZA 5C0EB 1R0AL 5KS9B 3N1MC 1KBGH 5E1AA 1P9MC 2XXCB 3OKOB 3I75A 4ZFFB 1SVZA 1UA6H 1SJXA 2PYEE 2VMFA 2YMXL 3GSVB 1KG0B 2XKUA 4UU9A 1BF8A 4I48A 1FO0H 4L3ED 1TDQA 1VACA 5JIHA 4KGJA 1IRAY 1HHJA 3GSUB 3QG6A 4MNGB 4WNQA 3RWFA 4WFHD 5DA4A 5KVGH 3QCTH 2NLJA 3JVGC 3KPLB 3VJ6B 3OAYH 2O26U 4JN2B 5DHYA 2NTFB 1UH3A 5F6HJ 3QUXC 3H9SA 4I2XA 2YUVA 3K0WA 2EO1A 4M1CC 5EBMA 3W11D 5J7CC 5HPOA 3OB0K 2V2WA 4P46D 3HN3A 1G9ML 5IFHH 5DEFA 2CIKA 1DQLL 4UUJA 4UDTA 3QDHA 1ES0B 3ERYA 3QFDB 4BK4A 3MTRA 3P4LA 5K93A 4KRPD 5BRZA 4IJ3B 5IJKA 4XHJD 1T89C 2MJWA 1HIML 3SCMD 5DDHB 3I9GL 1BBJB 5E2TH 4RIRA 4WJ5B 3BDBA 3B9KB 2DDQL 5ESVA 5DD5H 4XCFL 1KULA 4R6UA 3CUPB 1GC1L 3QQ3B 3MJ7A 1FIGH 4P2OD 3KPPB 3IVKA 2X10A 4YDIH 1BP3B 2VUOA 4YX2L 2Z35A 3MCKB 3NCBB 4HULB 1FGVL 4HD9A 3S3PA 3DO3A 3QEHA 4XPGL 2ZUWA 5D5MF 1H8SA 1LO5A 1FORL 4XPTL 1D3CA 1LWRA 1QR4A 1NAML 5E2UL 3UYRH 5ACZA 3CC5B 5J8OA 5GGSA 4DKFH 1QEWB 1MHHA 4NO0A 5DQJA 3ARBB 4RAHA 4LPVA 4ZAKD 5E8PB 4OLXH 4LPTA 1A2YA 1KELH 1OGAD 3GSQB 3ORJA 1B4JH 3HPJA 3PHQB 2FATL 3GSOB 2GSIB 3FMGH 3SQOL 3MRIB 4U7KA 3QHFL 3I02A 3QBTB 5KW9H 3GSNH 1RJYA 2XQYG 5FAAA 4XCNB 5ID0B 1AHWA 5D2LB 4UV7L 3S88H 2H9GA 4JRYD 2H26B 4D8PA 4O5LH 3MRBB 5D93C 3QIUA 1MNUH 2H2SD 4FQ1L 1MI5E 1LK2A 5HGDA 1P7QD 4KQ3L 4HXAH 3VXRB 2RB8A 3KR3H 2DD8H 5DRZB 4WCYH 4OZIF 3BIBX 4PRDB 3QA3B 2V7NB 1FZMB 5HYSG 3VFSB 3T8XA 5DK0A 3UBXI 5JHDA 4APQA 3R1GL 1UM6L 4GG8B 4HUWA 1MCWM 5DRNB 3VCLA 3CCHB 4XPAL 5KN5B 4PRNA 3GKWL 1A6WH 1IGCH 5LBSH 1LO4L 1UB6A 4TOYL 2VC2L 2VZTA 3AB0C 4YFDB 3ROLA 5IB2A 1YEHH 1S9WA 3SGDI 4FFEX 3CX5J 1UZ6F 4KXZH 5EN2B 5IBTH 3IJHA 2FBJL 4JM2D 5I15L 2ADIA 2YA1A 2OR8A 3DUUA 4QHLB 1OTSC 1BEYL 5DS8A 2WAHA 4NN7B 1YEIL 1FVCB 1SEBA 4S1SL 3LD8C 1G7PA 3VE0B 3MQIA 1KCLA 1OF2B 3B3IB 4XX1G 4ELMB 1A02N 4PJIF 4GQPH 4NRYB 1QBAA 1TPXC 4X6CA 3OTTA 3C5JB 3MLXH 3R06A 1A3LH 1MRCH 1OSPL 2HWZL 4LBEB 5IHUH 3P30H 1UYWH 2I07A 1MH5A 3M45A 4ZO7A 1VGKB 1J86A 1KB5B 5I1GL 2R69H 5HYJE 4HKJB 4K7PX 5FO7B 5C0AB 4GG6F 3GB7A 4O9HH 4ZOEA 1ZS8A 4Y2DC 2GFBB 3O0RH 4XAKD 3WHXA 2V5YA 1EJ6A 1AKJA 2QR0A 4NQDB 4ODVL 3L3GA 3G6DL 2YD4A 1BGXL 3PUCA 1J05B 2X42A 5GRUL 2L0DA 2RCSL 4QCIA 1RZJL 1LP9E 1T1ZA 4RISH 4JY6B 4L8DA 1A6TB 1P6FA 2F8VA 1G7IA 2NCMA 5CGYD 1YEFL 2CXGA 4O2EA 5JDSA 3PGDA 4LOUD 4HT1H 3SDDD 2EKSB 1CDCA 1KBGL 5DR5H 3X13A 4P2QE 4DTGH 2CH8A 5BZDB 4NQEA 4Y16D 1UA6L 5CHNB 3QDMB 2KZ1B 1FO0L 5E9DA 1HHIB 2M1KA 3IFPB 4LKXA 1RI8A 1I7UB 4IBLT 2PO6A 1FN4B 2ZP0T 2J5LC 2ZJSH 2R23A 5KVGL 3LRSB 4BFBD 3QCTL 5EU6A 1K8IA 1ZWIA 1BD2B 1TXKA 2OMBA 1H9VA 1YYMH 2I9LA 4UDUB 4WU5A 3FAWA 4OLEA 4QLRA 4RX4D 4POYA 1K4CB 1MRFH 4FQQA 4EI5B 1ZHNA 3UAJD 4QRRA 1CLOH 1DEEA 2FLBT 3TBSB 2VZSA 3RNQB 2V9RA 3VFRA 5IFHL 1Z5LB 2HFTA 3C2SA 4BJLA 2X4PB 5HHPA 1IJ9A 1Z0MA 3KPRD 1YNTA 1KLUA 1IEBA 1J11A 8CGTA 1IM9B 3QUZB 5ESQB 3QNZA 3FT4B 4MA3A 1MAMH 3NFNB 1GGYA 5E4IA 4QRTB 3RTQC 5IUSA 1X5XA 3BN3B 5E2TL 3EYQC 1WIOA 4E5XA 1JZ7A 1FNLA 2FGZA 2Y9RT 3ARZA 5B38B 3LKRB 5IK3A 1QD0A 5DD5L 1GPOH 1R3LB 3HZKA 2ZG3A 3O4LA 1FIGL 2X4SB 2YD9A 3QPQD 3FB6A 4JDTH 5FYKH 4Z0BH 3O8XB 2J8UF 2CLVA 3DIFA 3OKNA 4YDIL 5GGUA 4X0KB 3RQ3A 3CFDB 5D7KE 5HDQH 1YN7B 3ZDZF 4GRLC 4OD2A 1F6FB 2BXYA 5FO8B 2WBWB 4J3OC 4K7FA 3VXNB 4TUOB 1J87A 1INQB 1EGJH 1KCKA 3BISA 5JW4N 43CAA 4JRXE 4R7DB 5AEAA 3L6FB 3UYRL 3GGWA 4NKMB 4DKFL 4LLVA 5ICZA 2GCYB 4OLXL 5HVHC 2WANA 1T03H 43C9A 2W9EH 1KELL 2GAZA 1GGUA 1RQ5A 1WBZA 4K3HA 1NDMA 1B4JL 5EU3A 4M6NH 4U1GC 4P48A 3ZE1F 3FMGL 5CZXC 3U9UB 2R4SH 35C8H 3BGAA 4AENB 1GIGH 4LNRB 4AEEA 4D3CH 4PBXA 4XNQA 1WTLA 5KW9L 3GSNL 3ME0A 4C55A 4OSUL 5IESH 3B2UC 3S88L 5IW6B 4NNXA 4RFNC 2NZ9C 4O5LL 1IMHC 3H2WA 4N0CD 5EO9B 3MLUH 3TBWB 3MZGB 4UQ3B 3EJYC 1MNUL 5K9QG 2DJUA 5MENE 4HXAL 5I8CB 4U6TA 5I1JH 3KR3L 4Y0GA 2JJTC 3STZB 2DD8L 4WCYL 3V7AE 5DJYA 3WNMA 5CEZE 3VWKC 2BY1A 1K5NB 2NR6C 3T0AA 3RVXC 3GMPA 3OPZH 1LHZA 1SJVA 5LBSL 1ULVA 3BIAX 2C1OB 3OKKB 1FSKB 1UJTA 5AWNH 4EN3D 2QQLL 1YEHL 4HWZA 1R6VA 2C4XA 3TIDA 3HAEB 2VR4A 2ZCHH 3S36H 5I71C 4FFVD 5IBTL 2DBLH 3C60D 3MUGA 4YR6B 3VFPB 1WZMA 1MHCA 3QUYC 1T83A 4GRMA 4XPHH 4FS0A 2ZUYA 2DYPA 4ONHA 1RZJC 4ELMF 4MCYB 4I0PA 3ULVC 3MBXH 2GI7A 3BKJH 3VXMD 4RGNC 3VXOA 2ZUQB 3LOWA 2EDHA 3ARDB 1G6RB 4OCYH 1YY8B 5DMGC 1CE6A 3MLXL 4HJGB 3PWJA 1JZ2A 2Y7QB 3RU8L 5C0GA 1A3LL 1MRCL 3TPUB 1T5WB 5C0DB 2L4OA 1NBVH 3VXPB 5IHUL 3P30L 1BZ9A 2MCG1 1UYWL 3I84A 1S7TB 2H32H 2R69L 5IWLA 5E8OA 4U1NB 4GKSA 2CUHA 2XQBH 3E3QE 1VEPA 5CGMA 4O9HL 2V7HA 1VB9A 4IHOB 4ZUUB 3O0RL 3SPVB 5JO5B 3FFCD 3V52L 5D7LE 5IF0A 1NC2B 4PJ8A 5F97E 3LV3A 3HRZA 1P7QA 5I1LB 4FQPA 1XR8B 1I7RA 2CLZB 3HE7C 1D6EB 5B22A 5GGQH 1M1SA 1ZT4B 4PREB 2Q8AH 4MCZB 4M4PA 4RISL 3FN3A 4JREC 3VXSE 3CGTA 1LNUA 2YN5A 3LKPB 3NVQA 1FG9C 2NY6B 4HT1L 4KKCD 5HHNA 1FFPB 2Q7YB 5JPNB 3RL1B 5DR5L 4DTGL 3BE1H 1NUFA 3QXTA 3HZYB 5EZIH 4L4TA 5KG9B 4Z78A 1ZLSH 4S0TD 4HGKC 2QQNL 5HSFA 5DTFA 3ZKMC 3I85A 3LKNB 1MWAB 5GJSH 3IAQA 4PDCE 1C12A 2ZJSL 4JFQB 5GS1C 5BW7A 1UJ3A 4J3SA 1B90A 1G9NH 1YYML 1LEKB 3D2UA 4OFIA 3QUKA 2JIXB 2ZSVB 2HFEA 2XN9B 1MRFL 4FQJH 3T4YA 3ESVF 3D25B 4QHKI 1EHXA 1CLOL 2EEDA 1T1XB 4P9MH 2YPLA 3BD4A 3K2UH 3OWEA 1OHQA 5EOCH 4D0DA 4WFED 4OFDA 4JZOB 3TO4C 4WI3A 1AO7B 1EEZB 3QEGH 1WZ1H 2ICWB 4EQ3A 3TFKD 3D39B 4YFLI 3T3MF 5FF6B 5I74B 4KKAD 2IC2A 3L3DB 2X9XA 1MAML 3CZJA 3BP7A 2IBZY 4DQOH 5KSBE 1YUHB 5INCA 4M1DH 5FUOH 5E6ID 4YFEA 5EZLB 2J88H 4MJ2A 3GMOA 4LHUG 3WIIH 1QPPA 4L3EB 4S10A 4TULH 1U93A 4ZO9A 3UTPD 1GPOL 4K94H 1IGJB 5MEPA 5I9QC 1U8IA 2E7LC 1ZLVK 4JDTL 5FYKL 4Z0BL 5D2NE 1CVRA 1PQZB 1J8HE 1I3RB 2GITA 5HDQL 4OFYD 1JGVL 5C09D 1WF5A 3TM6A 4PJ9B 5JZ7C 4YBLB 3SDDA 4P46B 1P4LB 3WUWG 5I0DA 4NJAH 4YHZH 4MD5B 1EGJL 2C26A 2DWDA 2AEPH 2NNAA 4PUBH 3O2WH 5IJVB 5C0JB 3K80A 3DX7B 3H9ZA 2W9EL 2Z31D 4E0RA 4L8BA 1OSZA 5C0IB 1F4XH 2F54E 4M6NL 4XCEB 5EO1B 4HW6A 3ARSA 4E9LA 4M93C 35C8L 1YN6B 2R4SL 1X6LA 4J8RA 1H3PH 1XCQB 1GIGL 4PJBF 4JDVA 3BH8A 3MROB 4D3CL 1EERB 3OJDB 3Q5YA 4LGPB 3FO9B 1PAMA 5FB8A 1BFOA 5IESL 4OLVH 5F1NB 2D31B 5T5NF 1BZ7B 1D7FA 4LVEA 2UWEE 3MLUL 4KVCH 2XFXA 1GOGA 1KIQB 2GK0A 2X5PA 1KOAA 4FQCH 1OVZA 1R24A 4A6YH 1TVHA 1T5XB 3LS5H 4PV9A 5I1JL 1R3HA 4BSWA 4YDLB 5I73C 4PRBA 1CD9B 4TSCH 4XP4H 5L0QC 3LIZH 4HFWA 2AJSH 5F9WC 3OPZL 3VI4F 4LEXH 1DVFB 2ARJA 2P24A 4ZAKB 2FGWL 4HGWA 5SX4I 2AXGB 2EXWC 4L29A 1XGRB 1OGAB 5D1QB 4O2CA 4U4BA 5AWNL 3U9PL 1R3JB 3JTCA 1OAYH 2VIRB 4V2BA 3QR2A 2YD5A 2AERT 3S36L 2ZCHL 2A6DA 1XGUB 4G59A 1FNAA 2DBJA 3WLWD 3S97C 3MV7D 3EO1A 1NGZB 4ZUTA 5SX5H 1FFQA 1WAAE 2D9CA 1CXHA 2BMKB 2QADD 3P9MB 4MD0B 5IEKA 5HYEA 3K4ZA 5GHWH 1NAMB 5F71A 2R2HB 4N90E 3MBXL 4PJXB 5IBUG 3BKJL 4XNUH 1INDH 32C2A 3ARFD 5D1XC 1VKXA 4OCYL 4OFPA 4PJHF 2EYRA 3GO1H 3NCMA 3TP4A 4K8RH 5T1KB 5D5MA 1H5BB 1I7TB 3WIHH 1NBVL 4IRJD 4YEEA 5C3LD 4ZOAA 3TA3D 2RFXA 3NN8B 4PBVC 1F2XK 1WBXA 1XR9B 2X70A 4C56D 5HHQA 4LU5H 2XQBL 4HAGA 4MLSA 4AIZA 3TIEB 5FM5O 5EUOF 3KHQA 4N0CA 4NC1C 3FT3A 3FRPA 4I0CC 5H94A 3VD3A 3GUTA 4JM2B 2GY5A 4ZO8A 2FH6A 1A1MB 3QJHB 3S8WA 5GGQL 2Q8AL 2FO4B 4CJ0A 3AVEA 3HC0B 3K74B 2YN3A 4LQ1A 2J3SA 2UUDH 1QBBA 2HJFA 4AY0A 2BDNH 1WBYB 4X9FA 5DSCB 4U1GB 1MCFA 3MA7A 2GTWB 2ZG2A 3BE1L 5EZIL 1I3VA 1I1AC 1ZLSL 4EN3A 1LO3H 3C8KA 3E2HC 4OZIA 2F53B 2XRAH 1AR1C 4PJ5D 3RVWD 3M17A 4LHQB 3F7VA 1QR1B 4KJPC 4JO2L 2QHRH 5J12B 5GJSL 4PJFB 3TN0A 1T4KA 5IV2A 2XYCA 1D5BA 4JQVC 5C9KA 3MO1A 1G6VK 1G9NL 2BVPA 1FC2D 1RK1B 2Z4QB 1F4YH 1CWVA 4N5EA 4PTTA 1G7QA 5C07A 3I3DA 4FQJL 3IJSB 5C3TA 4P9ML 5EOCL 3K2UL 4ZYKB 5D7IF 3RUGF 4ZS7H 1B4RA 2VLRD 4CU7A 5HYQA 2GTZA 1NEZG 3QEGL 4UILH 1WZ1L 3ZDYF 4XVJH 4F7CA 3TPKA 2BVTA 3E3QC 1OAXH 1EMTH 4JFOB 1U8OA 2OTPA 3O9WD 4DQOL 4M1DL 4LVOB 4Y16B 5FUOL 3PABB 4DCQA 2J88L 4M62H 3CXHK 3WIIL 3UTSE 4TULL 3FFCA 4PJ7F 3AY4C 4RDQF 4JR9H 4RMVA 3D18B 4K94L 1JRHH 1JIBA 2XNAB 1JPGA 1RU9L 4AT6A 4OLUH 5TFSH 2P4AB 5JOPD 2CDGA 5JW5B 4WENB 3JV5A 4K7PY 1NJ9B 4GG6A 3UTTE 4DKEH 3DX8B 4YDJA 3IAGC 5BCAA 2PXYC 1RK0B 2E5EA 4X5WB 4NJAL 3ZHKA 4ZSOA 4YHZL 1I1FA 1A7NH 2WWKO 3OKMB 4GW5A 2AEPL 3OR6A 4XRCB 4PUBL 2ZNWA 4G8FB 3O2WL 4KK6D 5DO2D 3TEUA 3KPRB 1FO0B 4JE4B 2NX5D 3OAUH 4YHNA 5E6ZA 3QDJE 4UTAH 4RAUB 3MRJA 1OP3K 4YBHA 2DS4A 2X1OA 3ALWA 1AGCB 5DWUL 4BQ9A 4FQHB 1F4XL 2QSTA 4G43A 4KROD 2D4FA 3KXFB 5C92A 4QOKD 1TFHA 4PRAA 4O51A 1H3PL 3ARGC 4U1SB 4LPUA 5IMKA 4EUPA 4ONGH 4JREB 2OL3H 3HCVB 4OLVL 1GZPB 4O4YH 3VI3F 1MHEB 1HI6B 3V9FA 3KPLA 3QWOB 1ZT7B 3RWHB 1FL6B 1WCBA 1ZSDA 4KVCL 4PY7B 5C0RH 1NGXA 5HDOA 4FQCL 5CBAB 3MJ8A 4A6YL 3LS5L 4G9FE 2KL6A 2FJFA 4PJCF 4XP4L 3BZ4B 2EDRA 3LIZL 5GISH 2AJSL 4KJYA 5E6IA 1CL7I 1FNGB 5C0FB 4LEXL 2OK0H 1QHOA 1DQQB 4K9EH 1QFWM 2FHCA 3QDGB 2ZOKB 5EPMA 2NY1D 5IFJB 1OAYL 2E8ZA 4OCNC 3D85A 3WJLA 1Q9LA 2B2XH 4OFYA 5C09A 5EBWA 1X5GA 5HHOD 2DQGL 3O3BA 3C9NB 1ADQL 1F3JB 2LAGB 4L4VE 1KXVC 2JJSC 3F5WA 1IC1A 4M1CD 4ZOBA 5GHWL 4F7TA 4YPGB 3K7UA 4XNUL 2J8UA 1INDL 4FN0A 3T1FB 4UINL 5DJ2B 3U36A 4WWKC 5DHXB 3DX9A 5I76B 1XIWD 2BNQA 1QFWI 3GO1L 3LKQB 2Z31A 4N5UA 1N2RA 4K8RL 3L95B 1L0YA 4QO1A 3WIHL 4PRHB 3D69B 3TJHC 1QEWA 3CFJA 3IXAA 4LU5L 4WI4A 1JGUH 1A6VL 3ILQD 1OLLA 5CBEB 3PHQA 3BT2L 3GSOA 1MQKH 4MB5A 3KNBB 1UC6A 3GM8A 3H0TA 3C60B 3DETC 3KJ6H 1IC4H 5IB5B 1UG9A 1E27B 1UWEH 2Q76A 4JY5H 4BM7A 1LE9A 5C08B 2CKBH 1WFUA 1JZ5A 2DICA 2H26A 3PWNA 5F7DA 4FXKA 3SKOB 4CAGA 3MRBA 5KBNC 3FB7A 3VXMB 1NH6A 2BDNL 4I9WD 3VD5A 5I66A 5LAXA 1X7QA 5DRZA 4LKCB 5JXEC 3QA3A 1FZMA 4EOWH 5DJAA 5FYLE 1LO3L 2R0ZH 4ZTPH 2XRAL 1U8LB 3EYVA 4PJFF 4CVZA 3EJJX 4TUJA 2QHRL 3GNMH 3QIWB 3EYOB 5I2IA 5A2JH 3MR9B 4X6DE 4O00A 1CLYL 4KHXH 1GCFA 4K94C 1NUGA 4MDIB 3FQUA 1DZBA 2P48B 2Q3AA 3NFPA 1I9JH 2J8HA 1AP2A 1F4YL 4GKZA 5ANMA 1FNEB 1WWAX 2HTLD 1P6AB 5BOZG 3WNLA 3B9EA 3KPMB 3QFJB 3SDXF 3IS0X 4ZS7L 4XPBL 4UILL 4XVJL 3B2VH 4HMDA 3ZYZA 3TA3A 4JFDE 8FABA 2OMNA 1QSFE 4ELMA 4S1QH 4C56A 5CD5C 1OAXL 5D6DC 1EMTL 4LLMB 5JMOC 4X9HA 4WGVB 1BVLB 4R8WH 5EC1A 5MEQA 1SQ2N 3WO4C 1T7VA 4M7JH 5CP7B 4JR9L 2BY3A 3FQXA 3NZ8A 1JRHL 4YE4H 5BS0E 4HKJA 3ULVF 5C0AA 2VLKE 2ICWJ 2NYYD 4N1CA 1Y6MR 4OLUL 4YFLF 5L8JB 4RGOL 2AK4B 3L7EB 3VXUA 5C9JA 1X5KA 2HMIC 5EU7E 3BRDA 1RJCA 4DKEL 1OTSD 1TVBB 4RZCB 1OTUC 4B5EA 1MCOH 4I18A 3SO3C 5L2KB 1J05A 1PZUB 3MACH 1G7LA 3AUVA 1A6AA 1KACB 3NAAH 4CMMB 1A7NL 3GMQB 2NY3D 5DJDA 1JHLH 5SV4A 4NKQB 2VZOA 1A6TA 1U8HB 1G1YA 1I7ZB 1OPGL 3QHTC 4KK5C 1X44A 3OAUL 2HKFH 4D9RD 5DLMH 1PFCA 5DMJB 4PG9A 4WO4B 5MERB 3TH2T 3TO2B 4UTAL 4PP1C 4NJ9H 2EE6A 1ZVYA 3Q6FB 3BI9X 3C2AL 4KKBC 1QO3B 2VDOH 1U2CA 3W9EB 1K4DA 5E24E 4E42B 4XBPA 3WDJA 4HK0A 5IT2H 3VXTA 5B38G 2UYLB 3WFBH 5HI4C 4EVNA 5ITFA 1M7DA 4HGMA 1CGXA 4ONGL 2EDQA 1HWGB 5T1LD 5SWQA 3B6SB 4FTVB 3V4VH 2OL3L 4K23H 4O4YL 5ISZB 3I50H 3L3JA 4PJDE 1DANU 4PG2C 3PQYD 5FDWA 5FO9B 2J12B 5C0RL 4Z7OE 3I2CH 3L5IA 5KSUB 4Y4KD 3HKFA 4I3SH 4PY8I 1UENA 3L3OA 3IKCA 1BF2A 3GHEH 1ZA6A 3O9WA 5GISL 1TZHA 3DUSB 4I77L 4XXDB 1Q72H 2IFFH 4K8RC 2OK0L 1ZLUK 1V7NH 4K9EL 1XMWA 1QLEH 5EU4B 1MCNA 1I8MA 3NPSC 4DZ8A 3BP4A 1AD0B 3H9SE 4TNWK 4QRQA 4OZHB 1KV3A 1PKQA 2AABH 4P2RA 4J3WA 3MXWH 2X4OA 1PBYA 2XOTA 2B2XL 3D3VB 4D2NA 2D4DA 3RKDD 4R26H 3DWTA 3I6GB 5JR1H 2BVOB 2OZ4H 3H3KA 1ROWA 1A5FH 2BVQB 2KH2B 3U7AA 1NAKH 3L9RB 3TNNB 3EYUH 1F11B 5ETUB 3MGOB 4NM8H 3BESR 1RV6X 3ARRA 3SQBA 2NX5A 4I1NB 5GGRY 5BRZE 1NSNH 5GXBB 3BMWA 3DYOA 5EZJA 4IRSC 1HQ4B 2X4TA 4NP4H 3KWWA 3OKLB 3L6FA 2IANB 5GS2D 4FMFA 1JFQH 1UKSA 5GS0C 1KTLB 5J9PB 1JGUL 4X7CC 3MGTB 1U3HC 3RTQD 5TE4H 3SY0B 2R2EB 1DUZB 4MAYA 4NDMB 1MQKL 5E5UB 1X5IA 2FNBA 3KJ6L 1IC4L 4X6FA 1EXUA 1UWEL 4JY5L 4PJBA 5TQ2H 4BQCA 4DVBA 4MS8C 4Y8DC 1NBYB 2FSEB 1A22B 5ENWB 2XPGA 2ITCB 4OQTA 4LMQI 4QNPE 4G6KH 3ARFB 3G6AB 4MX7A 4OIIH 1P9MA 3RWDB 3RWIA 1ZA3B 5I8CA 5E99H 4NWTH 5A2FA 2FB4H 1IC5H 4LSSH 3STZA 3KVQA 4U1IB 1HNFA 4EOWL 1SHMA 4B7IA 2R0ZL 2VL5A 4IRJB 4ZTPL 3KG5A 4X7FC 4UBDD 2F8XC 1JK8B 2CRMA 3GNML 2EDXA 4KI5E 4OGYH 3RKPA 3ARTA 3BH9B 3JVGA 3IXTB 4X7SH 5HHOA 4OZ4A 3DURB 3VWJB 4KHXL 4Y4HC 1XF4A 3QUXA 4OLWL 4Q6IB 1QKZH 2CR3A 1HDMB 3AROA 1I9JL 3HAEA 3JZ7A 1GXEA 4FG6D 2QEJA 1FZKB 3VRLF 3BHBA 4KMLB 2NZ9D 4HQQH 1P2CA 5JHLH 5JHDE 3GBNH 4PP2B 4Z8FH 3IF1B 1ZHKA 4M43H 3EJYD 5DEGB 3WE6A 1ZGLM 4LLDA 2NPLX 1CGYA 4G7YH 1OOAA 3B2VL 3H9HA 4N0RA 4MCYA 2R2BB 1I3UA 3BRFA 1B0GA 3VFMA 5IIEA 2MKLC 4F9PC 2Q86B 3RGVC 4RWYH 2C3VB 2H32B 1RZ8A 1SJHB 1P84K 1NCCH 3OKEA 4S1QL 5B21A 3VWKD 3PP4H 3GSWB 3BGFC 3CVHH 3RVXD 5H2BA 1G6RA 1T89A 1A6ZB 3QQ9C 4KRNA 4BELD 3OAZH 1R3IH 2RR3A 2VLMD 3C6LC 4R8WL 4PJ5B 4PJHA 2NXYD 2MSPA 3ZDXF 4GXVH 4OLYH 4M7JL 2DOCA 1QQDA 4C57C 4ZFZB 4YE4L 1PZ5A 4YBQC 3NMEA 4QHNA 5F7LB 4B0MM 5GPRA 3NCJH 1T6VN 2ZPKH 4JO4H 4F9LC 2EEAA 1XFPA 2P5WE 2HA1A 4OFVA 1MCOL 3QUYD 5EUOA 4X6CE 4KK9D 2GK2A 3MACL 1XGTB 4YK4B 1EJOH 5C0CB 1TTFA 3ULVD 1JHLL 1Q9KA 1FLTX 1U6AH 4OAWB 4MCZA 5CD3B 2VO5A 5DXWA 4RGND 1Z9OA 3CH1A 2EC9T 5SWZD 1PY4A 1EAJA 4QHMB 2HKFL 5DLML 4XWOC 2XACC 4F57H 1MCQA 1JPFB 4NJ9L 3VG9C 1MY5A 2CDFA 3IDGA 2IAMC 5KG9A 2VDOL 1U91A 2BSTB 5IT2L 2P5EB 1XCTA 4OQ1A 5E1HB 3WFBL 1X6NA 3ZT5A 5AAMA 3V4VL 1JGLH 4G6MH 4EDXA 1U8JA 4K23L 3DECA 3I50L 4K71B 1MLCA 5E7BA 5B8CB 3ILPB 1SJEA 4HKZA 4G80B 3QJFA 4YHIA 4HC1H 1T04B 4V3DB 1A4JB 4I3SL 4WUUB 4NQEE 1MJJB 4OI9A 1TCRA 4JZOA 3TCLB 3GHEL 4L8CA 3BIKB 4QXWA 1AO7A 2G5BB 4P2YA 5D7IA 1Q72L 3FTGA 3RUGA 2IFFL 5GIRB 1Y0LB 1V7NL 3REVB 5EU6E 4Q2ZA 3NCEB 1JGEA 3OX8B 2F8OA 1V3KA 3ZKMD 3NIFE 3ULUE 4KROB 4QXTB 4MWFB 2AABL 5EU7C 1UH2A 4QOKB 1C16A 4QRRE 1XF5B 3MXWL 2X4NA 4CVXB 4WRLA 3UJJH 5HHME 2DQCH 2DTMH 1J0ZA 4ZXBD 2YD2A 4JGUA 5J3HC 3HNTH 2APTA 4R26L 5E2WH 4JDZA 4N8VB 5JR1L 1YC8A 3OXRB 1M6OB 1MAJA 4PJ7A 2OZ4L 3KPTA 5D7SH 1A5FL 1BBDH 4U1KA 1NAKL 4TVPE 3RZCC 3PWLB 1A9EA 3EYUL 3U48A 1NANH 3MRMA 2APBA 4NM8L 4F15B 4PJ9A 4PJAA 2CK2A 3UTQB 2VZVA 1NSNL 1ONQB 2F19L 4HKXA 1VFAA 2RBLA 2OTWA 2EDLA 3WN5C 3QXDB 3QXAB 4NP4L 2IALA 2VLJE 4CADA 1JFQL 4LSTH 1XF2B 1CXFA 3O4LE 3GMRB 1MIMH 1A6UH 1MIEL 3QZWA 2PN5A 3GMMB 3DX7A 1Q0YH 4Y2DA 3UPRB 5T1LA 1RURH 5B39A 3MRQA 2PCPA 2OI9C 2NY1B 5TE4L 4GAYA 5IVXA 4X6BB 5EFIA 5KTEH 4MA1C 3K46A 4XCEA 5L8KB 4X8JB 3ES6B 1RY7B 4ORGA 2XTJE 5TQ2L 3V7MA 3KS0J 3EJZD 1GVIA 5F1NA 3QXWA 4Y1AD 3ZE0F 3GFUA 5EUKB 3L3KB 3X14B 1S7SA 1DR9A 5AD0B 4P2QD 3ZE2E 1UXSB 4JY4A 4G6KL 4OIIL 1I8IB 3CK0H 3EOBB 5E99L 1XIWB 4NWTL 2FB4L 3UBXB 1IC5L 4LSSL 2Y6SC 4Q0XH 4FMKA 4GS7C 1LVEA 2DQIH 3EO0A 4PJGE 1A4KA 4LCWD 4N9GB 2JJUA 4PJCA 3MNVA 5D71H 5T1MB 3TBVB 4OGYL 2FR4A 5F7YC 4X7SL 5C0BA 4V2CB 5IG7A 1F3RB 1QSZA 1D5MA 4X7TB 1C5DB 4BKLB 1R3JA 2BSSA 1QKZL 3RX5A 4NO5A 3F7PC 1QLRB 3TBYB 3MOQA 2JCCB 4D9LH 1JN6B 3GJFK 1HCFX 2WIMA 4G42B 2NZIA 4HQQL 2N7AA 3GBNL 4OZFA 4Z8FL 4OBSA 5H35B 4M43L 2BMKA 1MJ7H 3LN4A 4G7YL 4IRZL 2FJGA 4RWYL 3EFDH 2FECI 5CKAA 4G8EB 1NCCL 1HHKA 3PP4L 1PJ9A 3CVHL 1CFQA 3RTQA 4AJ0A 4XNZB 5AZ2H 1R3IL 4POZC 1KT2B 4KZEH 1YJDH 1SYVA 1AIFB 2EXWD 4GXVL 4OLYL 4GKOA 2AXFA 4HJ0C 5J1TC 1E28A 5GS3A 3C5SB 2E7BA 2CUIA 3HLAB 3NCJL 5D7KD 4TNWF 2ZPKL 3RBGA 1M7XA 4GRLA 1U92A 1PDKA 3QIBC 1YMHB 4D0CA 2ARWA 3H6JA 4ZDHB 5HY9A 5BMFH 4OD3H 4JRXD 3V95A 3QJHA 4Y5YB 1EJOL 4NKDA 2JF1A 3KPNA 1IAKB 3G5VB 1U6AL 5IP4A 1TQBB 1U3HB 4Y19B 4KI5C 4HUMB 3O3EA 2ESVA 1WBYA 2ORBH 4U0RB 2H8PB 4S1DD 2WMPA 4F57L 4YHYB 4X6EA 4I5BA 4YNYA 4F80A 1MCHA 1M71A 5DURB 3WO3B 2P46B 5CKGA 4WTWA 5TJWK 4M48H 4P23B 3KPSB 4YDVA 4KRLB 1C5CH 4Z77B 1W2KT 3HZMB 3HUJE 1GGIH 1JGLL 4G6ML 4N0UB 3QNYB 1L7TH 3LQZA 1OL0A 2AJ3A 5E4EB 5ICYB 3CZFA 5MEND 3O41A 3V8CA 1NMCB 3RDTC 4HC1L 3WS3A 2JJTA 5CEZD 4RCAA 5CUSH 1L9NA 3CAFA 2L7JA 3EKCA 4PRPE 4L4TE 3CDFA 4ZQKA 3VWKA 3C08H 3KLAA 4H26B 2VKXA 4BFGA 2FLRT 1YNLL 2NY3B 1S7WB 2AV7A 3DX6B 1DL7H 2A6IB 3O3DA 3IDJA 5IOPB 1WLHA 3SDXA 1FL3A 3KYMA 4R9HA 1RJZA 1UB5A 4PRID 1I1AD 2PW2B 1IZKA 3K3QA 4HUVA 1AR1D 4JZNA 4KJPD 3P73B 5L8LB 4GRWB 3RY5A 1JYNA 1U8PB 3ZKXC 3UJJL 2YPLE 1KJ2H 2DQCL 3QSKB 2EDNA 2DTML 5F93C 4FXGA 3BKMH 3QUYA 3HNTL 2IPUK 5E2WL 5EORH 3MRRB 3IDYB 4ETQB 1JL8A 4IIQC 5D7SL 4YO0A 1NGYB 2YRPA 3BWAB 4P5MA 4GW4B 2W0KA 3SGEI 3TYFB 1CVSC 3PQYB 1BIIA 1P5VA 1ZT1B 2OTUB 1ZXQA 1CDJA 4Y4KB 5SWZA 1BQUA 3S96A 3CNKA 3ECBA 1F4HA 3WIFA 4HEPG 4RRPA 5GRVL 1NGQH 1T20A 2RQ8A 2VWEC 4N8CH 1BWMA 5F7NC 1U41A 3C6SA 4WDIA 1QACA 4KTDL 1A1OB 1D5IH 1HQRB 4LSTL 5CEYB 4I0KA 1MIML 1CTNA 1A6UL 3PL6B 1Q0YL 1RURL 5DD1H 2GHWB 3DJ9A 2OL3B 4RAUA 4F58H 5D7LD 2V2XA 1JNHA 1II4E 4R2GC 5KTEL 2X7LA 4M8VA 3CD4A 5D1ZC 2M26A 5CS7A 1J0HA 1FYTB 3LKSA 5F7KC 3HE7A 1RHHB 2R0LH 1U58B 3U7YH 3HS0B 3VXSD 2RAMA 1SM3H 5ICXB 1QVOA 1IKFH 5JNYB 3L5WA 4OCLC 3RY6C 9CGTA 1OB1A 4ODHH 4PY7A 1V05A 5F21B 3I6KB 1OCWH 1Z0NA 3DTXA 1Q9WB 4LASH 1F5WA 3FONB 1VGEH 4NSKA 4Q0XL 2H6PA 4AL8L 1KJMA 1URLA 3RIFF 2HAZA 5HHXH 5D71L 5C0FA 1ZHBB 4P5KA 3T4AA 5D6CA 1EAPA 3U2SB 1CXIA 5GS1A 3MGAA 3P9LB 3PWPB 4PLNC 3MMEA 2GT9A 2G9HA 4JPIA 5LGJB 4HIJA 2ERJC 5IFJA 5F9JA 5GRJH 1NKRA 1T7ZA 1QRND 4JANB 5KAQF 4D9LL 4G6AC 3LN5A 1LEGA 3TO4A 4JFFD 4MLIA 3SDAB 3VGFA 5DQ9B 1S9XA 1RHFA 3G6JF 4KU1A 3UYOD 1NLDH 1MJ7L 5FKPB 2HT4C 2WQRA 4C4KO 1FQ9C 4FFYH 4HZLA 4YHPB 3STBA 2WSKA 3EFDL 2DIJA 1S7RA 4HUXB 4XC1L 3VA6A 2VXSH 2PYEB 4HDIA 2EKJA 1I9EA 3MRHA 2WWKT 3DI2B 5AZ2L 4KZEL 3L95A 1N26A 1R5WB 3VGAC 1YJDL 3CSYB 4U6HA 5CINH 5HJ3A 3S5LA 2E7LA 5JDJA 2B5IC 2HVKB 3GSNA 1NC4D 3B8SA 3D0VA 3BP5B 3N1QC 3RHWK 2LTQB 5JW3H 4OV5A 1JWUB 4Y1AA 5GGSY 4LLAA 1TJGH 3CFBA 1ZKAA 3STLB 4K3EH 3V5DB 5BMFL 2BSED 4OD3L 4R3SB 3TVMC 1UADC 1BECA 1WT5C 4GKNA 4PTUA 5D5ME 3RY4A 3DV6A 2VKWA 1FL5A 2BHUA 4UT6H 5J6GA 3VU2A 1U8QB 5DRWA 4P5TC 1AGEA 3S4SB 4LCWA 3CU7A 3VGEA 5EBGA 4N0YL 2FL5B 5MEOB 1QSEA 2F54D 1WIUA 5E00B 5I1IH 2F5AH 2VB5A 4P3DA 3A6CH 1AGFB 3VFUA 3O45B 3O6FD 4OF3A 5IVZB 3PWUB 5ERWA 3MBEB 2NXYB 2O61A 3N85H 4CDGC 5D9SA 3ZO0A 2B7DT 4QHUB 3H3BC 4NNYB 1C5CL 3KPQA 5BQ7B 1IQWH 1GGIL 1H15A 2K9UA 3GMLB 5ABDE 3A6BH 4MJID 4U05A 1L7TL 4JHBA 1JYVA 2XQYK 1NMAH 3MLTB 5I8KH 5JOFA 3MA9H 4LLQA 1G7MB 2GUOB 4MDIA 4P4RB 2AKRB 3P0VH 1BX2B 3U0PB 3IFOB 5CUSL 3BXNB 5I8EB 4CW1B 2ITDA 3C09C 2R2CA 3C08L 3E0GA 3JXAA 4OZIE 3UO1H 2VLLA 1RIVH 3K4AA 3KJ4C 3MFGB 1DL7L 4KY1H 3D9AH 3BKCH 5DJ8A 3JWOH 5BV7C 3K2MC 3P4NB 5TGBB 5E94A 5JXED 4UIMB 4JKWA 5IKCB 3EGSB 4G6FD 4NQUA 1BVKA 1DTUA 4JHWH 4WTXA 2N4IA 2VQ1A 3CLEH 1H3UA 5GGVY 3T0WA 4OLZH 2A2QT 1NUDA 5A2KH 1HH9B 5C07E 1T1YA 1OLZA 1MQ8A 3O3AA 5ILTH 1KJ2L 2FIKB 1UZ6E 1CGWA 4RMUA 3BKML 4WY7H 2MQ0A 1FG2A 1HOCA 3GJFH 5EORL 4AG4H 5ACMA 4N90D 1MI5B 2MQCA 4ZFOB 1KYOK 5I75B 1CD1B 4DGIH 4JCMA 1KPVA 4G8GD 5D1XA 1DDHB 4PJIE 4ZFGH 3GMNA 2QSQA 1NGQL 3E6HA 4N8CL 3GMQA 3X3GH 3BWUC 1X4XA 4XP6H 1I3GH 1IAII 3MV11 1D5IL 4NO3A 2UZXB 6CGTA 1K3ZA 1ZLWK 1FAKT 4PBWD 3FN9A 5FYLH 1MJ8H 4G8IA 3P9WB 5DD1L 2WLZA 3QIBB 4F58L 2PW1B 4GG6E 2GJ6D 2DWEB 4HKBB 1EO8H 5MENA 1DUYA 4H1LB 5LJYH 1XGPA 1WK0A 4ZXBB 3FCTB 4EKXA 1D5XB 3FB8B 2R0LL 4ZSOE 5C86A 5EOTA 2HMID 2Q3ZA 4BH8B 4X4YA 1SM3L 1L7IH 4GUPB 2QL1A 1IKFL 2XICA 3QRFM 5HPMB 4ODHL 5C2BH 1T0PB 1OCWL 1HH6B 3CX2A 3BX7C 4LASL 4QY8A 1OQXA 2E6QA 4PRIA 3TH3T 1I1AA 3NGBC 1VGEL 4NWUH 5FA4B 3E2HA 4KK5D 2YHGA 2Z8RA 3LEVH 5HYJB 1BOYA 3WFHA 5J6HA 1FVDB 5HHXL 4XXDA 3VRIA 4JQVA 2NW3B 4WFEE 3WEXB 2Y72A 5HI5C 5JIIA 4KKBD 4U6XB 4LVNC 3QWRD 2D0HA 2FWOB 3QEUA 1UWXK 3F62A 5CIPA 2C3WA 2HT2D 3RNKA 5GRJL 5HI4D 4HV8A 1CFTA 1F00I 2X4RB 1DCLA 1DQDH 1LP9B 3U7WH 1RZGB 4G7VH 1UZ8A 3F12B 3UTOA 4YQXH 4HS3B 2V5RA 3TF7C 1OD7A 4FQLH 1HSBB 2DLIA 3DGCR 4PD4K 4M6MH 1RUPH 4WW1A 1NLDL 4GW1A 4FFYL 1YC7A 3FQTA 3MV8A 4P2QB 4ZPVB 5M94B 4Z76B 3E3QA 2R1YB 4XP9L 5GSRA 2CPCA 5K9JH 2VXSL 2UY7A 2KBGA 3MYJA 3OHXB 4JB9H 3NIGF 3UTSD 4BH7A 4PB9H 4JKPH 5D7LA 3AY4A 4F3FB 1N8ZA 2VQUA 2XWBA 1HEZB 3FRUB 3D1MC 1CU4H 2R56H 5CINL 5A3IC 1DQJB 1D9KB 1NFDF 1QG3A 4LCCC 2HG5B 5B4MC 3UTTD 1FH5H 3VFWB 3PIQB 2HJLB 5A16B 1MCPH 3SY0A 2C7UA 4F7PA 5JW3L 5K9KB 2J8UE 3MUJA 1G0YR 4HUNB 1TJGL 3CPLB 5LVEA 2PXYA 3IGAB 3ZDZE 1Q9OB 4K3EL 2BNQE 3IDMA 1J10A 4U3HA 1NCTA 4ZG1A 5EIVA 1S7QB 2Q6WB 1R5VB 3L3HB 4MXQA 3QDJD 5I1KH 2R4RH 1JWSA 4NQSA 5I1IL 1K8DB 2F5AL 4IRSD 1YQ2A 2W0FA 5CSZA 3A6CL 3WFDH 4U1IA 3ARGA 2EIBA 2QTEA 1HHHB 5GS0D 4YAQA 3N85L 4U1MA 5A2LH 1CICC 1QRNA 4LIQE 1PYWB 2B4CC 3IXTA 4HX1B 1IQWL 4JFFA 3A6BL 3DURA 1F97A 2ARJQ 4A2LA 5I8KL 1B3JA 3T0DA 3GSRA 3MA9L 2XWJB 4Y4FB 3WUZA 5IM7A 4G9FD 3P0VL 3VFVA 4XZUA 2G2RB 2EDWA 4JRXB 3DGGB 4WFFD 3CVHB 3N50A 4CMHB 1L4IA 3HA0A 3T09A 3UO1L 1RIVL 5DYOA 1EEUA 4KY1L 4Y5VC 3W5NA 3SDCD 4AYFA 2BCKA 2YBRA 3BKCL 3D9AL 5E0QA 1B0RB 3JWOL 3WLBB 2Z0BA 3C8DA 4F37K 2X41A 3JTTB 2VDMH 4JHWL 4XI5C 3CDGA 3CLEL 4OKVB 4OLZL 5ANME 5GZOC 4OIBA 2DL2A 1NUNB 4RBPK 3JWNC 4AH2A 5ILTL 4XCYB 2X6MA 1H8NA 4WY7L 4Y4HD 3S35H 2JJSA 4AG4L 3TESA 4Z7VF 4FNLH 5GGRA 1XT5A 3SE4C 4IEFB 3NPZB 5DK2B 4LF3A 2Y36H 3U6RA 1JF5A 5F1KC 4ELME 5ADOH 4C56E 2JJVA 4Z5RA 3UP1A 4DGIL 2J1KA 4WWKA 4GBXD 4ENED 5I6XC 2A6JA 2V9TA 1OGTB 3TZVC 4ZFGL 4NIKB 3P2TA 3O4OB 3TJHA 4XP6L 5IHZA 3RGVD 2X1QA 1I3GL 1NCDH 4JJ5B 5HGHA 1A7OH 5HDBF 5C0AE 3BZEA 4WTZA 3QQ9D 5FYLL 4OGXH 1MJ8L 5D70H 3HPLB 3VXUE 4E41A 2ICEA 5TDNA 1TZIA 3IFNH 4MJIA 1MFAH 1EO8L 1YEGL 2WBJC 1N7MH 4YBQD 3P77A 4Z7NF 4HEME 3OJ2C 1EEYB 4HUUA 5EO0B 2C3XA 2A6KA 3OL2A 3T0EB 3PXHA 2X4UA 4N8VG 4BZ2H 4P5TB 4JFZH 4NRXB 3UPCA 1OAZH 4DEPC 2GIYA 3RHWF 2V17H 1YZZA 3LH2H 1JF6A 3KDMB 1L7IL 2ZSWB 3HMWH 4LDLB 4KC3B 5FHBH 3L3IB 3ZKND 3TN0C 3NZHH 4PIRF 1N6UA 1QZ1A 4JG0H 3RL2A 5C2BL 1NDGB 3VFTB 1NEUA 5KSAC 2LABA 1N64H 5JXEA 3DSNA 3X11B 2P8LB 1X5YA 3BPLB 4NWUL 5FGBC 3RWCA 3VD7A 4HH9B 3AREC 3N1PC 4JFXB 1MFEH 4NN5B 3MRGB 1ZVHA 3V6OC 2LV4A 5C71A 3BIKA 4HG4K 4XWOD 5EIIB 5BZWA 4HUKB 1IGYB 1YEDB 2ADJB 1K9TA 5F3HB 3FZUD 1D5ZB 4NBZB 3GIVA 4KMTH 1FZOB 5EC2B 1KXQE 2V6HA 3KYOB 1X5JA 5FUCC 1XZ0A 1YY9D 4HBQA 3MRKA 1YQVH 2WWMC 4Y5XB 2M2DA 2EH7H 3P0YH 4MWFA 1HILA 2D7OA 4MSWA 3SJVB 1XF5A 1DQDL 2JK5B 3U7WL 4G7VL 4G8GA 1EK3A 5HXMA 2BNRA 4XNMA 4YQXL 3VXSB 3O2DA 5FCUH 3HMXA 3O2VH 1NGWB 4OBRA 1I8LC 4X4XB 5T3ZH 1MLBA 4JFDD 4M6ML 3K1DA 2ZKHH 3PWLA 3V5KB 4DN4H 2XIDA 5FYJE 3QI9B 3CMGA 1E4KC 4R0LB 4RWHA 5D6DA 5K9JL 3T3ME 3DVGA 3UBXG 1OT2A 2X40A 5FK9B 1PKQE 2OQJB 4JB9L 1RVFH 4LAQH 5JQ6H 4P2RE 5D7JB 4JKPL 3BUYA 2GJ6A 3O11A 4D94A 5SWSD 5BS0D 1BAFH 1L8JA 1N5YH 1CU4L 2R56L 2BJMH 5J13C 3VW3H 4JRWA 5JORA 1JF1A 4W4NA 1GZQB 2BNUA 1FH5L 3HE6B 2D7QA 3Q3GB 1MCPL 3U4EA 2VDQH 1WICA 5J3HD 3VFNB 5FOBB 2NX5E 3F58H 3OXSB 4X83A 4MZ3A 2CIIA 2XWTB 5IB1B 4AQ1B 2WINB 4CBPA 3ROOA 4ELKA 4A6YA 4NHUA 2NY0D 3QUMA 1TMCA 3BMVA 4KUCF 2PUQT 2YS4A 4ZUWA 3MFFB 4LSVH 3M1BB 5I1KL 3UXFA 5KSBB 4MHHI 4LLUB 5IVOA 3SO5A 2R4RL 2IG2H 4XGZA 1RUML 3JWOC 4NQVB 4NC0B 3WFDL 3WL9B 4X8XA 1U8MB 4XCCH 3ULUH 4PJBE 4YC2B 2D7TH 1QA9B 2CR6A 5ALBL 3RPIB 1J8HB 1NC4B 4Z0XB 3PJSB 2F9BT 3HZVA 4MJ5B 2Y5TB 3ALXA 4PYGA 3G5XA 5F3BA 1QLRA 3NGBB 2BC4B 4TVPH 2A83B 5EG6C 4EXKA 4JKMA 1N5AB 4EI6A 1MWAH 4IJ3C 1IL1A 4MNQA 4N8PA 5IB3B 4NPYB 3WJLC 1S8DA 4M7ZB 4POUB 1MFNA 1QFHA 3B9KC 1LD9B 4FQIH 4R4FH 3MLSH 2AJZA 3VI4E 3G6JA 5CMAB 2F54B 3H9SD 3B43A 3W0WA 4QHKJ 5GSVA 4NOBA 4D9QD 5EBLA 4ZNEA 3GSXA 2VDML 1EHLL 3UTTA 4PS4H 3O6FB 5IMOA 5I1EH 2IEPA 3JSSA 2BOCA 2ATPB 3IU3A 1S9YA 4YGVA 2FJHB 1TJHH 3SBWC 3S6CA 3PGCA 4HZAA 5K59F 2UWEB 3S35L 4JGJA 1JPTH 2IH1A 4FNLL 4WI6A 1SYSB 2HJKA 2Y36L 3ARBC 2YD7A 2PYFB 2VXQH 4GJTB 1O7VA 3QDJA 5BRZD 1BQHA 4ONOA 3U0TB 5ADOL 3LEXB 4IOSD 5CZKA 1OD9A 4ZDHA 2VAAB 2YSSB 5T33H 4KH2A 15C8L 2BZDA 1ZMYA 2HTKC 2DN7A 3MRFB 4IRSA 4PJHE 4RAVB 5F7UA 1DBJH 1HYSD 2C9AA 1NCDL 4WV1B 1A7OL 4M8QB 1U3HA 2D7PA 4Y19A 4D0BA 2X2YA 4LVHB 2CDEA 3OR7A 4OGXL 4G6FB 5D70L 1RAMA 4POZD 3I3BA 3QXUA 1S78D 3BD3A 3IFNL 3MRPB 5KVMC 3MJ6A 4P3CH 1MFAL 4OFKA 3SN6N 2D9QB 1ZGLA 1N7ML 4J23A 1AC0A 3ESUF 2YWYA 1AJ7H 4PJGF 4NM4H 5EUOE 3IJYA 4WU7A 2Z91A 3MRLA 5DMKA 3UTZA 4BZ2L 4MS8A 4JFZL 4NO0D 1ZGLP 1OAZL 2V17L 4BQ6A 5DGQA 3LH2L 3HMWL 5ICYA 1M7IB 5E8NB 5FHBL 2DQEH 3FO1A 2PTTA 4UB0H 3MSPA 2QKIA 3QAZB 4JG0L 3SE9H 2YPKB 4DWHA 1F42A 3MV9A 1PSKH 2GQHA 2IBBA 2IH3B 4CRPA 1N64L 2VE6B 4U1JA 4DW2H 4AM0B 2UY6A 3FFDA 3AU1B 4CU8A 2HVJB 3KYAA 2BY0A 1MFEL 1IM3A 4KI5D 4TVSa 5K33A 3FQNB 1NMBH 3VGGA 2FD6H 4NKOA 1CDGA 4C83B 1R5IB 1KJ2B 2C1PA 3MUZ1 4NN7C 3QIUD 4KMTL 4Y4HA 4NUJA 4MJ6A 1P7KA 5DUBB 2BHYA 1YQVL 3LDBB 3RA7L 4NZDA 3GIZH 3RFZC 2EH7L 3P0YL 5IROC 5C70A 4JFPB 4U31A 4DVRH 1VFMA 4WFGD 5JHDD 2VSDA 1AQDA 3I9GH 1EFXB 5IMMB 5FCUL 4PGEB 3O2VL 2IQAB 3PWVB 3BZFA 1IGIH 3D0LA 1AO7E 5D7IE 2DAVA 4JFEB 5T3ZL 1IAOB 3DROB 3RUGE 2QSVA 3AFLA 3D39E 4F9PA 2ZKHL 3RGVA 5JW4R 4DN4L 3ZDYE 3EFFB 2NY4D 2EDYA 5HGAB 4PLKD 1ZT1A 5DVNA 3FOLA 3QO1B 4YX2H 3VXQA 1FNFA 1TETH 1VADB 4PGCB 4PLJC 3C6LA 1DANT 1RVFL 5EA0H 4LAQL 5JQ6L 3QB7C 3MREB 2WM0A 4QT5B 1BAFL 2IPTH 1JVKA 1YA5A 3W9DA 1N5YL 3BO8B 5EB9A 2BJML 3VW3L 4PJ7E 4F37F 1G7HA 4F9LA 2EZ0C 5FHAH 3DMMB 3CXHJ 2P5WD 4RNRA 5J0BA 4DZBB 4LCUA 2G75A 2VDQL 1ND0B 2CRZA 3F58L 1LQVA 2X09A 1FYTA 1BM3H 3VH8A 5CP3A 1UQSA 2AEWA 4J7RA 2MQ3A 3BSZH 5HGGS 4Z7UB 3CMOL 4CUCA 3RWEB 4BSJA 3ULSA 4LSVL 1KN2H 5EWIH 4HIEA 4PV8A 1L0XA 4OF6A 1AKJD 4UIKH 1YPZB 1IKNC 1JV5B 2IG2L 3BQUB 3PF2A 4TYUA 4ZOCA 2VTFA 2IAMA 2G5RA 4ODUA 3UTSB 1TQCB 3BPOB 3L7FB 3LSOB 4NQXB 2XKNA 4EI5C 4KUCD 2CGRH 2XA3A 4XCCL 2NQCA 1ZHBA 3ULUL 3DARA 2D7TL 1W0YT 4NZUH 4R2GD 4EXPX 4J3TA 5D1ZD 3MLPA 2A9NH 4P4KB 2ZOLA 2DLTA 3MYZA 5F1IB 2H1PH 3VI3E 4JFDA 4TOYH 4KRMB 3MRNA 2YA2A 3QUZC 4ZUSA 4F7EB 5FECA 1IT9H 4TVPL 3NA9H 3VRJA 4F7MA 4JAMA 1MWAL 1G7JA 4NZRH 2IBGA 2EIZA 3GEWB 4PJCE 3UJTH 1V7ML 3S4SG 5DI8A 5EU6D 2JB6B 3REWA 5DJ6B 3DRQA 4FQIL 4DJMA 5SWSA 4R4FL 1V8HA 3MLSL 5TDOB 5C0BE 3GJEA 1S5HB 3ULUD 4MQSB 1WC7B 3O8XC 4QRRD 4QXGH 1T21A 4XH2A 3BYYA 3S34H 3ARXA 4P57B 5CEXB 5HHMD 4KMQA 4PS4L 2OBGA 5I1EL 4QKXB 3Q5OA 4OUUA 3G9AB 1TJHL 2GSGB 4TVPD 4QYOA 1P1ZA 1JPTL 2HVKA 5I1GH 3S98A 3RZCA 3VGDA 3FN0H 3W81A 1W0WA 5IEHA 1NFDA 2GJJA 2CKBA 4G6AD 4L8SB 4XVTH 2VXQL 3OZ9H 5LXGH 2VOTA 1MPAH 4M61B 1FLRH 2LVEA 5AG9A 5T33L 1ZHLB 3V5DA 1ACZA 2YD3A 4R3SA 5M95B 3MZTA 4MNHA 3RWJA 2HT4D 3WN5A 3DVIA 2VLJD 2FRGP 2W38A 3B8YA 3MCG1 1DE4B 3MOAH 1DBJL 5MHSE 5IBLC 3LQAH 2HLAB 2OI9A 4O02H 4J2XA 5KANG 1SY6A 4X9BA 2OSLB 1X9QA 3IDIB 3GKZA 2APVA 1KTDA 4P3CL 5IQ9B 1ED3B 2XTJD 3T0VA 1AJ7L 4NM4L 3RWGA 1PX4A 2OJEA 4KTEH 4L4VB 5IW1B 1WZLA 5GJTH 1EH9A 3RRQA 1A1NB 2VZ3A 4HPOH 2DLHA 3MXVH 2DQEL 2VDLH 4UB0L 2ESVE 4O2FB 2PNDA 4LSQH 3SE9L 3TVMD 3VFOA 1N3NA 4GBXB 1PSKL 1FSKC 1BX2A 3IFOA 5C8JA 4WHTB 5GGTA 5EIQA 4DW2L 5KOMC 4X5XB 3S3JA 2F53E 5EU5A 3TBTA 4HHAB 1U3JA 4C4KT 1NMBL 2VDNH 5DFVC 2FD6L 4PJFE 3F7YA 3FT2B 5IB4A 1S7XB 1KNOA 1A7BA 3EDFA 4RMWA 3BEWA 3P4NA 2CLRB 4S11A 2V2TA 3GJFB 1F2QA 1S9VA 4PGDB 1RZIA 2YUWA 3PHOB 1FFOA 3ZYOA 4WGWB 3GIZL 4MQ7A 1M05A 1ORSA 1MCBA 5FKAA 4H1LG 4DVRL 2ZUQC 3BDXA 4P2CG 5F88B 3T77A 1OW0A 3EDEA 3ARDC 1ZVSA 1J9CT 5E5MB 2O5YH 1B88A 1IGIL 2VLME 3PP3K 3SDXE 4QF1B 3BP6B 3LKOB 1UXWB 3QQ4B 2DMBA 3X12B 4Z7VA 2H2PC 4FQ2H 1U3ZA 1A7QH 4J12A 3IETB 5I1DA 1TETL 4OD1H 5EA0L 4KK8C 2VZ1A 3EZJB 4YIQA 4OZGF 3SKNB 2IPTL 4PJEB 5INDB 4X6DB 2A77H 2DYPD 3ARVA 5A2IH 3AAZA 4I0PD 4X5LA 3ULVE 5FHAL 1T0MA 4L3CA 2GJZB 4OB5L 4ISVA 4RGNE 3QIBA 2APWA 5F6IB 5GQBA 3QEQA 5SWZE 2NY6C 3JV6A 4NT6A 2WIIB 3VGBA 3S5LG 1BM3L 1RJLB 3FQWA 4MDJB 4Z7UF 1CFSB 3KS0H 1CFNB 1CLZH 4YJZL 1FFRA 3DBXA 3EYFB 3H7BB 3BSZL 4R96B 4KGLA 3WS6C 3V0VA 5A43C 5ESAA 1QSFB 4GUPA 4OSUH 3VFGH 1VFBA 1KN2L 5EWIL 1YPZF 2Z93A 1I85C 2AEQH 2LQRA 3T2QA 4UIKL 4O58H 4UT7H 1BLNB 2NW2B 3S7GA 1FV1A 4I4WB 2EDDA 4JZJB 4PJ8D 4FQXB 3FOMB 1I8KA 5E8EA 2X9WA 4LLWB 1FDLH 2Z9TA 5BS0B 2VLKB 4F33A 2CGRL 4HIIA 4QRUB 2AQ2A 5J1AB 1F6AB 4NZUL 5J06A 3DV4B 3UC0H 5DD6A 2A9NL 4OF7A 1IEHA 1UWGH 2OZ4A 2H1PL 3RDTA 4PRPD 1MCCA 4DKDC 4L4TD 5I74C 1XF3A 2MHAA 3E6FA 2QQLH 4J1UA 4U1HA 4RFOH 1T3FA 2MCPH 1IT9L 3OGCB 3NA9L 2E7MA 2NY0B 4HS3A 4NZRL 1E0OB 5KVEH 2P8PB 3UJTL 4GOSA 2R9HC 1JHTA 4LCYB 3D2UD 2CRYA 3HG1B 4R7NA 4CN4A 1HXYA 2EDTA 3HI1B 1U8NB 1S7VA 1QLFA 4QXGL 4R90H 3S34L 2WP3T 2YPLD 4QRSA 1HSAB 2P5WA 2EYTA 5BJTB 4GLRH 3KYNA 1XGYH 4PJ9C 4YBLC 5HI5D 1CT8B 2W60B 4F3FA 3RU8H 1MOEA 4FP8H 4P46C 3EDDA 1JHKH 2ADFH 5HYSA 2XG4A 4PJDB 1M4KA 4R97B 4IIQA 2W91A 1DQJA 1T22B 2IJ0C 4QRPB 2HFFB 3FN0L 3HHRB 4UOJA 1YDPA 1DBKH 5E1AB 1W8NA 1OTTD 2VISA 2VAJA 4XVTL 3OZ9L 5LXGL 4Z7WF 1WVZA 2B0SH 3BVNA 1MPAL 4UU9B 4I48B 3IGAA 1FLRL 4WW2C 3V79C 3V52H 1KIRA 1VACB 3F6IA 5BXFA 3VGHA 2I24N 1AGBA 1HHJB 3QG6B 4U6YA 3RWFB 3MOAL 5ID1A 1JWMB 5KZCB 2NLJB 1VESA 4J4PC 1DLHA 4XMLH 2E7LE 3LQAL 5DHYB 2YOCA 3EOAA 3H9SB 4I2XB 1G9MC 4GXUM 1T1WA 4O02L 5EBMB 3UJIH 4EUPH 5KS9F 4F8QA 5D1ZA 3FJTA 4Y1AE 2V2WB 1AXTH 2IADA 5A3ID 3IRZA 3AS1A 5CAYB 2CIKB 2WW8A 4K07A 4UUJB 3BAEH 4KTEL 4YDLC 4UDTB 5GJTL 2QQNH 3C5ZB 1BJMA 1YYLH 1HK6A 1FPTH 4HPOL 5FOJA 3RY6A 3VDAA 4LCWE 5FA3A 3MXVL 3BGMA 1DVFC 5DJCA 2VDLL 4ZAKC 1QSEE 5BRZB 3EAKA 2DKUA 4LSQL 4Y4FA 1O7SA 5D1QC 1GC1C 1JNJA 3UDWC 2K7QA 1KIPA 2MPAH 3G08A 3A0OA 5IMLA 1WIPA 5ESVB 2APFA 2O93L 5HHMA 2Y5EA 3MJ7B 3HNSH 4KDTC 2VDNL 3IVKB 2YWZA 1H3WM 1R3KA 2Z35B 1OP5K 4V1DA 3QEHB 1UEMA 4PY8J 3CFEA 4XBEH 1JUFA 3QT2A 1LO5B 1OAQH 4NRZA 3GRWA 1BOGA 5ACZB 2R15A 1MHHB 4NGHH 3W39B 3VRLE 5DQJB 2O5YL 1H5BC 1ZK9A 4Q7DA 1A2YB 2VLJA 1LEIA 1A9BA 4HH8A 3HPJB 4G9DA 4FQ2L 1A7QL 4HS6A 3I02B 4AMKH 3VG0H 2ADGA 4OD1L 1JGVH 3GDBA 3NIDF 1RJYB 4KJQC 4NCC1 3HR6A 2ICCA 1AHWB 3LS4L 5HBBA 1P84J 2H9GB 4JM2C 4D8PB 5F70A 2A77L 3NBNA 3ZDXE 1KJVA 1T66D 4XI5D 4JHAH 3QIUB 2AK4E 5GZOD 5HGDB 1LK2B 1EUUA 3G04B 1A7PH 4CNIA 1YMMD 4LIQH 1BQLH 4DFHA 2MFNA 3T8XB 5I16A 5DK0B 1KPRA 2W65A 4BYHA 5JHDB 3N0PB 3TVMA 4APQB 1WT5A 1AXSA 2IGFH 4W6XB 3WHE0 4HUWB 1OQOA 3VCLB 1CLZL 4PJGA 4P5TA 3EYSH 4PRNB 5D2LF 1UB6B 3ZKQD 3VFGL 4HWEH 1RZKH 5J12C 3ROLB 5IB2B 2NY4B 1S9WB 3TZVD 2AEQL 5E08H 4UT7L 4O58L 2D3VA 3SOBH 4CJ1A 3IJHB 4AQOA 4NC1E 2ADIB 3CFKA 3DUUB 5TF0A 1FDLL 2QSCH 1VPOH 4JFXA 3T65A 1SEBB 3U46A 3ARPA 2DMCA 3JBG7 1G7PB 2YC1A 1IZJA 5F3HA 3UC0L 3SKMA 5ISZE 4Y8AA 2WBJD 2FGWH 1UWGL 3CDYA 4X6CB 1K2DA 4DGYH 1S7UA 4G5ZH 4RMQA 3R06B 1ETZA 4EBQH 3U9PH 1WFTA 1N0XH 4RFOL 4PRIE 4EIZC 5CFHA 2MCPL 2NXZD 2I07B 3BW9A 5DC9B 1JPST 2Y07H 1GSMA 4LVOC 4Y16C 5KVEL 3PDOA 5TH2A 3TN0D 3QWQB 2W0LA 1HHGA 2EC8A 3OB0H 2EE2A 3GB7B 1ZS8B 1TLKA 1EV2E 3WHXB 1BVZA 4NQCA 3F6LA 7FABH 2QR0B 1MCKA 4N5ED 5C07D 3QISA 4ZUVA 1CLCA 4R90L 5FYKE 4QCIB 1TTUA 3EW3B 1XGYL 3UAJC 3D3VE 4L8DB 4ODXA 1G7IB 4FP8L 1JHKL 2ADFL 4O2EB 5JDSB 3KPOA 3FQRA 2WWMD 3PGDB 2AW2A 4HLZH 4WEMB 1EBPA 1NBZA 3U1SH 2OM5A 2DQHH 3EIFA 1IC7H 1DBKL 3MV8E 3O6MH 3X13B 1FGNH 4X98B 1QBLH 4XT1C 4NQEB 2N7BA 1LE5B 2B0SL 4FHBD 1DFBH 5E9DB 4LKXB 3X3FH 2PO6B 2NMSA 1BQSA 2H3NA 2R23B 4IDJH 5H37G 1QTYT 4K3JL 5EU6B 1ZWIB 2IANE 1TENA 1O5DT 3BEVA 2P45B 2ZG1A 3HUJA 3V4UH 4XMLL 2I9LB 5DVLA 2R1WA 4R4BA 5E03A 1I9RH 3QPQC 4W4OC 5CJXC 2OXGA 1AQKH 3MJGX 3UJIL 1VDGA 4FQQB 1ZHNB 4QRRB 1DEEB 1AXTL 3VFRB 2PTUA 4LGRB 1K85A 5D96B 3WL9A 2X1PA 4PRPA 1C08A 5HDLA 4Z6AT 5JLZA 4IS6A 4F2MA 3BAEL 2FIRT 1UVQA 2BVYA 4H25A 5HHPB 3RBSA 1YNTB 1KLUB 1IEBB 1YYLL 5JIPA 2VITA 4JO2H 1FPTL 3S36X 2J7LA 2AV1A 1W0VA 3QNZB 4PGBA 1UACH 3ZSTA 4WHYH 2PETA 1CFBA 3ZE0E 4P59L 3MNZA 4MQXD 2BC4A 3BFOA 4HCRA 3PNWA 2C4FU 4E5XB 2MPAL 1FFNA 4Y88A 2VL4A 5IK3B 2OJZH 1MVUA 1FCGA 1LDSA 3O4LB 3FB5A 1LILA 1MJUL 1QRNE 3HNSL 3FB6B 2NY2B 1XH3A 1F58H 2CLVB 3DIFB 3OKNB 5GGUB 1SBSH 3IFLH 4JFFE 4KUZH 1BJ1J 1KCGC 2ATKA 4OD2B 5DEZA 1GHFH 4K7FB 4XBEL 2Y06H 1U8KA 1CD8A 1BJ8A 1H3TA 1B6UA 1OAQL 2XTJB 4QWWC 5GRXG 2UVEA 43CAB 3TF7A 3GGWB 3RVVC 4LLVB 4NGHL 3DXAA 3HR5A 5MI0B 3HB3C 1FNSH 3SEPA 2YUZA 4H8WH 2WNGA 43C9B 4QEGA 2GAZB 1WBZB 4XB8A 5L2JB 1RU9H 1CDUA 4JPVH 4WI8A 1NDMB 1NCBH 5EU3B 3GBML 1DBMH 3DRTA 2N1KA 4LSDA 3DHMA 2BERA 3D85D 2VZUA 4S2SA 4AMKL 3VG0L 1H8OA 3P4OA 4XNQB 1J0KA 4OF0A 3MC0A 3B9KD 1CN4A 4FFVC 3IU4H 3WBDA 4RAVA 3C60C 4NNXB 3EO9H 4LCCA 1QFPA 4M8QA 5TDPA 4J3XA 1JMZA 1L6XA 4JHAL 1CFVH 4MJ4A 3MNWA 1Z2KA 2HN7A 4M9PA 2VABA 2IPKB 1X3DA 2YEZB 1A7PL 4JKLA 4LIQL 1BQLL 2C5DC 2BNQD 5DJYB 2ED8A 2CD0A 3SHSA 1CIDA 4WW2B 5DJZB 5DWUH 4KRPB 3NCYP 2IGFL 3GMPB 3SCMB 4AK1A 4LHUA 4OQTH 2B39A 2E9JA 3EYSL 1NL0H 3IKKA 4LP4A 3ARBD 3DYPA 1HNGA 3S37H 5JUEH 3D6GA 4HWEL 4P2OB 5E2VH 1J0YA 1RZKL 3QIWC 4JVPA 5DJXA 2BRRH 4HWZB 2HTKD 3TIDB 4E41E 5E08L 3IDNA 2YPKA 3SOBL 4MJIE 4MZ2A 3MUGB 2XY1A 4L3AA 5FGRA 4AM0A 3WXVH 2FYYA 3AU1A 4OUOA 2QSCL 1MHCB 1VPOL 1CICA 1ITBB 4LGSB 3WUWA 2DYPB 1HZHH 1HINH 2QLVB 4ONHB 3OKDA 2FZ3A 5HVGB 3AC0A 3DO7A 4I0PB 4X80H 2Y4SA 5BVJA 3BPCA 5F89A 1X5LA 2WUCH 3VXOB 1T6WA 1VERA 2NTSP 4XVSH 2BHZA 1RZFH 4H5SA 3VXRD 4DGYL 1IGTA 3PWJB 4G5ZL 4X99A 4KKCC 5C0GB 4EBQL 1N0XL 2HT3C 1BZ9B 4WUUE 2X4QB 2A73A 2Y07L 2ZUXA 5E8OB 4YUEH 4Y5VA 4GKSB 2DQGH 4UT9H 1IAOA 4J3VA 1ADQH 3SGDH 1NFIA 4Z18A 2V7HB 3TYGH 1FJ1A 4YZFF 4JRYB 3R4DA 1FZJA 2DF3A 7FABL 4M02A 2XV6B 4LLYA 5JPMA 5IF0B 3ZT6A 3QO1A 4TRPH 4PJ8B 3LV3B 1AD9A 6FABH 3HRZB 1P7QB 4QTHA 1KJ3L 1I7RB 1YMMA 4U6VH 4UINH 1CS6A 4HLJA 4LEOA 5J4MA 4G8GE 5F7WC 2DLFH 2BNRE 3OAYK 4OZGA 1I4FA 3RGHA 1ORQA 4MD4A 1LNUB 2QJDA 2ICES 3SE4A 3RVUD 5HHNB 1MCLA 4DN3H 3PDGA 3U1SL 4ODWB 2DQHL 3TFKC 1IC7L 2FX8H 3O6ML 5DHVA 1FGNL 1A6VH 1QBLL 4Z78B 2F58H 3MRDA 5GRWA 1JTOA 4WO4C 3TZVA 3VD9A 3BT2H 1DFBL 4I8DA 1DQMH 2GJ6E 3X3FL 2EECA 1C12B 1CR9L 5C0AD 4IDJL 4JO1H 4Z7UA 3FO2A 4KXZI 1UJ3B 1JCKA 1FHGA 5DF0A 3VXUD 3V4UL 3D2UB 1T80A 1XGQA 4ZMAT 3QUKB 4PLJD 2QV2A 2R1XA 2HFEB 1I9RL 1CDYA 1AQKL 3CJJA 4NQDD 4TTDC 3T4YB 25C8H 4M5YH 2YPLB 2WBJA 1EDQA 3JV4A 1T0NA 2H41A 3MOBH 2JLLA 2EZ0D 4NHUE 1H0DA 4N68A 5DD3H 1CDHA 5KVDH 1UACL 2ILLA 5AUMA 4Q9BA 4FFZH 3BP7B 5INCB 1CLYH 5KSAA 3GMOB 4IMLA 5FGBA 1HXMA 3GBLA 3AREA 4IOFC 3V6OA 1MCJA 2D0GA 5I1CH 2OJZL 1KLGA 4XC3H 2AEIT 5MEPB 5I17B 1U8IB 2BSRA 1W72A 4I3GA 5JW4M 1F58L 1NCNA 3MRCA 1SBSL 4XPBH 3IFLL 2F5BL 3BD5A 4KUZL 2GITB 3ARYA 4NFBA 4RGMB 1JTTA 4UV4H 3RP1A 2SEBA 1GHFL 3SDDB 5L7XL 2Y06L 4NFCA 4LMQE 3QO0A 5HGBA 2DWDB 2NNAB 4NBYB 4GH7B 4RSVA 2LVCA 3MLYH 4PJIA 3JTSA 5CJ5A 4MNQE 1FAIH 1I8LA 2E7HA 1FNSL 4H8WL 3R0NA 1IM9D 3QUZD 2DM4A 5FYJD 3BJ91 3DNKA 2GKIA 4E0RB 4L8BB 1OSZB 3G6JE 4JPVL 1E4KA 4RGOH 1NCBL 1DN2A 2VH5H 2VQTA 3ETBF 3W0WE 1DBML 4GRWH 4P2RD 4ZNEE 4J8RB 3BH8B 1Q94A 3RJDA 3WFEH 1VCAA 5DQDH 4Z7WA 4LHJB 4V3EB 3AS0A 3IU4L 5FB8B 4H0HB 1BFOB 1F90H 3WLWC 4OCWL 2P8MA 3EO9L 1DJSA 3O8XD 5K9OA 2CJUH 1YNKH 2RJMA 1CFVL 1NEZA 1OPGH 2XFXB 3E1F1 2GK0B 3AMKA 2QBWA 1U95A 1R24B 4TSBH 4MXQC 3QH3A 1TVHB 2DQFA 4WW2F 4PV9B 4BSWB 4PRBB 5C0EA 5KS9A 1JZ6A 4Z7QF 3PV6B 3ARFC 3OKOA 4HFWB 4ZFFA 3C2AH 1NGPH 1MSPA 3GSVA 1KG0A 5LGKA 4OQTL 3BDYH 2P24B 2ARJB 4JPWH 1NL0L 1A1NA 4IRJC 2VUYA 3S37L 4L29B 1KIUA 5JUEL 3GSUA 2CK0H 4MNGA 5E2VL 5EOQH 4Y19E 1CK0H 1IGFH 2BRRL 4YEFA 4MAYD 3VJ6A 3VWJC 2A6DB 2BOBB 2UZIH 1G0XA 2YD8A 2X1WL 4JN2A 2NTFA 4Q6IC 3LZFH 3EO1B 4HK3N 3NOIA 4ZUTB 3WXVL 1LK3H 5IBLD 3KPSE 5IEKB 2E27H 5FIEA 1HZHL 1HINL 1OP9A 3C8HA 4I77H 4X80L 4WFFE 4N0UE 1ES0A 2WUCL 32C2B 4XVSL 1MCRA 4XAWH 2CMRH 3QFDA 3ZSSA 1RZFL 1VKXB 2EYRB 2EXYC 4ZD3H 3MV9E 3DI3B 4NN6B 5D5MB 1IILE 1EBAA 3CLFH 2RFXB 5GS2H 5DDHA 1BBJA 1WBXB 2X70B 4MXVE 4R4NC 4WJ5A 5HHQB 3MV01 3RVWC 4YUEL 3B9KA 4UT9L 2PF6A 4AIZB 4KPHH 1HCVA 4YHKH 3CUPA 1UXWA 3TYGL 3QQ3A 3QUXD 1JNLH 3KPPA 4U1LB 4N9OB 4PJXF 4JG1L 3FT3B 4TRPL 2YUXA 5H94B 3GUTB 4MQTB 1V3JA 3MCKA 5DFVD 3LQMA 2VDRH 6FABL 4U6VL 1JMXA 2AK1H 2D0FA 3IS1X 3SBWA 4UNVA 2DLFL 4M3KB 1X5HA 5B3NA 1P5UA 3ZTJG 4YK4C 3CC5A 1PKOA 1UH4A 2D7NA 4DN3L 3ARBA 3MA7B 1VEOA 4KKLC 5E8PA 2FX8L 1YEKH 3ARDD 3D87B 2F58L 4EN3B 1ZLVH 1A14H 2WIIA 3GSQA 4WI5A 3C8KB 4OZIB 2NXZB 3M17B 3F7VB 2GSIA 4JM2F 1PG7H 3FHQA 1EHNA 4HIHB 1DQML 3MRIA 1CFSA 5A40E 1G9NC 1H3VA 1KYOJ 5IV2B 1D5BB 4JO1L 2H2PD 1BWWA 4XCNA 3MO1B 4M5ZH 2V9QA 1NCWH 4M4RA 5ID0A 5D2LA 2BVPB 5HVFB 2LU7A 4KK8D 4PTTB 2ENYA 1G7QB 4K71C 5B8CC 1JGDB 25C8L 4M5YL 2EDFA 2OXHA 1EUTA 3VXRA 1FYTE 5HYQB 1UT9A 4PRDA 1J88A 2GTZB 2V7NA 3MOBL 5ECJE 3VFSA 4M7LH 4LFHD 4F7CB 3T3PF 1L6ZA 5DD3L 4GG8A 5JA9A 5DRNA 2NY6D 3CCHA 5KN5A 5KVDL 1E4XI 2WY3A 4FFZL 3WMSA 1U8OB 3UZEA 5GRZA 4DCQB 4ONFH 2OR9L 4OLWH 3HTLX 3FFCB 4KROC 1CQKA 5EN2A 5I1CL 2FO1A 1JPGB 4XC3L 1GGBH 2CDGB 4QHLA 2P8PA 4UAOB 4N0FB 4WI9A 1Q1JH 1FVCA 4LCYA 4XBGB 3HG1A 5LG1A 2JIXD 1A21A 3VE0A 4YDJB 4UV4L 3W82A 3AXLB 4L9DA 1OF2A 3B3IA 3B5HA 3UMTA 5IROA 4ZSOB 1I1FB 4NRYA 1MELA 4GW5B 3OR6B 3ULVH 4F15C 3C5JA 3MLYL 1AO7D 1FAIL 4LBEA 3ALPA 3D39D 3EOYG 1VGKA 1WFNA 4YHNB 1KB5A 4FFWC 2M8XA 5SWSE 5FO7A 3MRJB 1OWRM 4G43B 3QXVA 2VH5L 2GFBA 5J11B 4PRAB 1S5IH 4O51B 4PD4J 2NY1C 1A3QA 2BVEA 3WFEL 1U42A 4XMKH 4L9LB 1KGCE 4EUPB 5DQDL 2R9HD 4NQDA 5IMKB 3HI6H 1UCTA 3NIGE 5FGCE 1F90L 2VERN 2B20A 1JWMA 1Y6KR 3O6LH 2CJUL 1YNKL 4JY6A 1WCBB 1ZSDB 4BUHA 1WWWX 1NGXB 4LRIC 4GT7A 1NFDE 5IHLB 3MJ8B 4TSBL 4PJ9D 3QULB 2EKSA 4JPKH 2FJFB 2VDKH 4P9HH 5KVFH 4KJYB 5E6IB 5BZDA 1NGPL 4W6WB 1XIWC 5CHNA 3QDMA 3BDYL 3C5ZA 4JPWL 2I25N 4Z7WB 1HHIA 3IFPA 1I7UA 4Y2DD 5HI3C 1FN4A 2CK0L 5EPMB 5EOQL 3LRSA 1CK0L 1IGFL 1IKNA 4JN1H 2GW5A 2ZWLT 2AS5M 1BD2A 1JBJA 3D85B 2UZIL 4UDUA 3ILQC 1Q9LB 4H1LH 1K4CA 5C09B 5EBWB 3LZFL 4J4PD 3HRPA 3O3BB 4EI5A 1LK3L 3DPBA 1LO2H 4PFEA 5SV3A 3TBSA 2DRUA 4XP1H 5IHBA 3RNQA 3F5WB 2E27L 1Z5LA 4F7TB 1NFKA 2BK8A 4MMXC 3V0WH 2X4PA 2J8UB 3U36B 4XAWL 1IM9A 2CMRL 3QUZA 3DX9B 5ALCH 5ESQA 2BNQB 2E9BA 2Z31B 3FT4A 4ZD3L 1N2RB 4XXCC 3NFNA 1Q38A 4QRTA 3CLFL 1ITCA 4D9QE 4JLRB 4XNZC 5AYUH 5SX4H 3CFJB 3IXAB 3W39A 1DVFD 5B38A 5I1HH 3LKRA 1F8TH 5C0BD 3U4AA 1R3LA 4KPHL 4YHKL 5D1QD 3CVIH 2AP2A 1JNLL 2X4SA 3EDJA 4DGVH 2B1AH 3A67H 3O8XA 1WZKA 2O5XH 1NBQA 4X0KA 4QGYA 3CFDA 4K7PH 3H0TB 4XHQA 1YN7A 2VDRL 5IR1B 5FO8A 2Q76B 3H9YA 1LE9B 2AK1L 3VXNA 2F19H 4W70A 4TUOA 1INQA 1DBBH 1A0QH 2HTLC 3PWNB 5F7DB 2ZCLH 5C2UB 4FXKB 4Y5YC 2FDBP 4R7DA 2CKNA 3FB7B 5LQBH 4NKMA 1MIEH 2GCYA 3G04A 1QHPA 5I66B 4Z7VE 5DVMA 1TQBC 5LAXB 3UZVB 1X7QB 1YEKL 1UM4H 2BRQA 3OG6B 3EYQD 1A14L 5DJAB 5T1KD 4CGTA 3EYVB 3BN9C 4U0RC 4CVZB 4YHYC 1PG7L 1PGRB 3OV6A 4TUJB 1B6DA 3U9UA 4AENA 5MHSD 5DVKA 5I2IB 4OGAC 4LNRA 3MV7B 4P23C 4NOFA 4M5ZL 1NCWL 2QADB 3FQUB 5IW6A 2A0LC 4GRLD 2NYYC 4PYHA 3NFPB 4ZS6C 5HDBE 1AP2B 4KJQD 5EO9A 4GKZB 5ANMB 3TBWA 5E4EC 4W6YB 4UQ3A 3QEQE 4X4ME 1WFOA 1NMCC 1GGCH 2J4WH 1O0VA 1OP3H 1JI2A 5C1MB 5TE6H 3SE3C 5L9DL 3WFCH 4M7LL 1K5NA 3WKMH 4Z7NE 1KFAH 2NY3C 3TA3B 8FABB 2ESVD 3VDCA 4C56B 3I6LE 4KQ4L 5CZXD 2C1OA 3OKKA 4M6OH 2Z8VC 5EC1B 4ONFL 1WISA 5MEQB 2F53D 2WLYA 1RIUH 4EZMA 3FQXB 3NZ8B 5DD0L 3B2UD 1GGBL 4XNYH 4YR6A 3ZL4H 3VFPA 4WFGE 4AEIH 3VXUB 5C9JB 2CO6B 1Q1JL 3MCLH 3IDYC 2AXJA 1WWBX 4HG4J 4IRZH 4I18B 5FV1L 1G7LB 1A6AB 2NR6D 1GOHA 4Y4KC 3ARDA 5DJDB 3ULVL 1YY8A 4HJGA 2Y7QA 3TPUA 1T5WA 5C0DA 5DC0A 4ERSH 3VXPA 3ZKSD 4XPFH 4BFIB 1CDIA 3RAJH 1S7TA 4PG9B 1QUNA 4U1NA 1GRWA 2KQMA 4X98A 1N4XH 3PL6C 2DMKA 1TIUA 1K4DB 4IHOA 4ZUUA 2EIDA 4XBPB 1LE5A 4HK0B 1S5IL 3VXTB 2KUTA 3SPVA 1CXLA 5JO5A 4XMKL 4EVNB 5ITFB 1M7DB 4U2ZA 1NC2A 5SWQB 3HI6L 4UOW0 4IOIB 4FOMA 2DM2A 4U0QB 5I1LA 1XR8A 2CLZA 3L3JB 1D6EA 3RKDC 3O6LL 2VLRB 1ZT4A 4ZFOL 4PREA 5FDWB 5J57B 3RIFK 5CEZH 3LKPA 5DMGD 4L4JA 4B53A 3MLRH 5SX5K 1FFPA 4JPKL 2Q7YA 2EE3A 3IKCB 3L3OB 2VDKL 4P9HL 5JPNA 3RL1A 2Q7NA 1ZA6B 3O9WB 5KVFL 2YRLA 4K9EC 4M7LT 2VWEE 1TZHB 3HZYA 1JJUA 3FKUS 4OF8A 3WS6A 3BPNB 3H8NA 5CLTA 4BSVB 3LKNA 1MWAA 1I8MB 1J5OH 1I85A 1PX3A 4JFQA 4DZ8B 3BP4B 4QRQB 3JUYA 1JRHI 4JN1L 1PKQB 4HMEA 3KXFD 4P2RB 1LEKA 2X4OB 2JIXA 2ZSVA 4XX1E 3HE7D 2XN9A 4L1HA 3PDDA 4RMTA 2X89D 3D25A 3TCXA 1LO2L 1T1XA 2R0KH 4XP1L 1Z3GH 5CIPH 1YNLH 1EO5A 2CSPA 5C6WH 3SDAC 2XTLA 1EEZA 5F8RC 2ICWA 3V0WL 4TNVF 3D39A 1BFTA 2NX5B 3LN9A 1X4YA 5FF6A 2VNCA 5ALCL 4OZHF 1CL7H 3L3DA 1RZ7H 5EZJB 1YUHA 3WXWH 2X4TB 3K8KA 3KWWB 5EZLA 2UUDK 5AYUL 4L3EA 2FEDC 5HD8C 3T04D 3WSQH 5I1HL 1F8TL 5ELIA 4UBDC 4I3RH 3QDGD 3CVIL 5L2JA 1IGJA 3U30B 4MAYB 4DGVL 1K6QH 2B1AL 4V1DE 3A67L 2J6EA 1MCEA 2O5XL 1FRGH 1PQZA 2Q1EA 4K7PL 1I3RA 3BUTA 3MLVH 2LTQC 2MMXA 5E7FA 3TO4D 4X6FB 5DMIH 1EXUB 2DI9A 4PJBB 1L0QA 2XXMB 1GOFA 4DVBB 4P46A 1P4LA 4FG6C 2AVGA 3CSBA 3CH8A 2F15A 3B4NA 1DBBL 1A0QL 4MD5A 1FVEB 3ZZ1A 2ZCLL 4KDVA 3NFSH 4M03A 1PVHA 4KTDH 2XPGB 5IJVA 5K59E 5LQBL 1QFWH 5C0JA 4MX7B 2IPKA 4QWWD 4LDOB 3RWIB 2YEZA 4TUKH 1CBVH 1SVCP 1UM4L 2P49B 3RVVD 4WW2A 5DJZA 4Q9RH 2VYRE 3HB3D 5C0IA 2VL5B 5EO1A 4GAJH 1TCMA 4PRHD 3SCMA 2IMNA 1YN6A 4KKNA 1XCQA 3MROA 3MBEC 3OJDA 5HHOB 1A6WL 2NXYC 4J4PA 1IGCL 4OZ4B 3FO9A 1XF4B 3QUXB 4P2OA 1CI5A 3OGOE 2D31A 1BZ7A 3IDXH 5JZ7D 4Z95H 3BHBB 1KIQA 2VXVH 1P2CB 1RULH 1GGCL 2J4WL