3MRQA

Crystal structure of mhc class i hla-a2 molecule complexed with melan-a mart1 decapeptide variant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of MHC class I HLA-A2 molecule complexed with Melan-A MART1 decapeptide variant
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 77
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mrqA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mrqA01
1MWAH 4NKOB 2SEBA 4A6YH 1I8KA 3RL1B 1P1ZB 3MYJB 5IM7A 3OAUL 4HXAH 1K2DB 4NPYB 5DK0B 3OX8B 1T83A 3MV8E 5FAAA 2NXYB 4PJ5B 4U6YA 1UKQA 4E5XB 3AS2A 1Z5LA 5I74B 3KYAA 4HPYL 4BZ2L 3W9EB 2VDQH 1N5YL 4P2QA 2CO7B 5EOCH 2HFEA 3VFWB 4F7PA 1GGBH 4RQQA 5GS1B 3TF7A 1KLUA 2YZ8A 1JF5A 2HT4D 1KIUA 2NW3B 4HS6A 4GSDL 4G8IA 3D2UA 2AJUH 1U95A 4XCCH 4YXKH 3V7AE 4JZOB 4IRSA 4NO5A 3D85B 4IOFC 4N9GB 4LLQA 3LH2L 4EN3A 4ZFFA 1XCTB 4XPHH 6CGTA 1B6DA 4DGYL 4YBQD 4NQCA 5DS8A 3TEUA 2IPUK 1QRKA 1BBDL 4L8CB 1DLFH 1OD7A 4AIOA 2WNGA 5IBLC 2EO9A 5K59F 2PNDA 4Y5YA 3V6FA 4LSRH 4PY7B 3OB0K 3QIUC 4LGPB 1NMBH 3MV7D 2X1XR 3H0TA 2CJUH 2QSTA 1B0RB 4IRJC 3QO1B 2E27H 4J8RA 4LCCB 2EO1A 2IADB 3G5ZA 2X2YA 3REWA 1JTTA 2BSTA 1MCLA 3PWPB 4M7LH 1OSZA 3FOLA 5ISZD 5FUOL 5F6IB 3KXFA 1E6OH 1FL3A 2MPAH 3HC4H 3RJDA 4XVJH 1U0QA 4NZRL 1JMXA 4NOBA 3TWCL 4JFDB 2DQFB 5CLWA 3T08A 1EAPB 4UU9B 1A2YB 5F9DC 4OUOA 5DUML 2Q7YA 3FHQA 2DWEA 3E2HB 4U1GB 3JTSB 1FYTD 5EUOB 3NPSC 2Z92A 2DQCL 3IDIB 3EHBD 1ADQH 1QLRA 5KSAB 3NABH 4Z95H 2WK2A 1MFDL 2NXZB 4JFPB 3T77A 2P24B 5B4MC 1VERA 5ICXA 3ZDZF 4OGAC 1NMCB 3UJTL 2OJZH 4M6ML 5JHDB 2NY5H 3QULB 1BFSA 3AGVA 2IF7A 4JRYE 1JZ5A 3T09A 4HWNA 4M03A 3UZEA 3T3PF 3BX7C 3IU3B 4D8PB 3O11B 1QLEL 1REIA 3CVIH 1T03H 1CBVH 1CT8A 1AGFB 2IFGA 5AD0A 3MCKB 1U42A 5I30H 3FL7A 5EBMB 1ZGLP 4N90E 4UAOC 3QUYC 1C7SA 1UM4L 4JQIH 4L4JA 5DJAB 3B8SA 3HE6A 1Q0XH 3ZKMD 3I9GH 5I1AB 3LPFA 4YHIA 5FF6A 4K3DH 1RZFL 5ESQB 1UEYA 2X7LA 1X5FA 2B1AH 3LVEA 1R3IH 3PABB 4LK4A 1CTOA 1ODAA 1WCBB 2IEPA 5T5FH 2PYEE 1A5FH 4JDTL 2BDNL 5BVPH 1G7LA 4GRMB 3BGMA 1CDGA 4MA1B 4OI7A 2C1OA 4HIHA 3NGBC 5H94B 2PXYC 3V4PL 3DRTA 4UDUA 4OQTL 3MA7A 5GGTA 3E6FB 4GAJH 1E27A 4X9HA 3INUH 1ZEAL 3QI9C 3UPRB 2BC4A 2RJMA 3MFFA 2J12B 1LO4L 5CGYC 4H1LG 1DBKH 3DWTA 3IF1B 3QEHB 3SO3C 2DIBA 3ORJA 5F7NC 2AI0L 1QFUH 1G7MA 1EDQA 1QVOA 4I18B 4O5LH 5FDWB 2FX9H 4PJ8A 4ELME 2NLJB 4G6FD 1CIDA 3EGSA 1BFOA 4C57C 4KUZL 2EC9T 3BPOB 4R0LA 4P23C 2V9TA 1T21B 4XXCA 4OM0L 4UV4L 3D25A 3R06B 4OKVA 3MJ6A 3ZHDA 3DO7A 1R3LB 4HIJA 1XGRA 4F3FA 5DFVD 3JV4A 3RQ3A 4YHLH 2D7TL 3G5VA 3CU1A 4MQXC 4GXVH 3ARFC 1FNAA 1EXUA 5IROC 2ORBH 3OKOA 4Z78B 4XP1L 4J2XA 1U8HA 4N8VG 3SE4C 4KMTL 2HRPH 2PO6A 4MJ6A 4PRIE 5ESVB 3VXQA 4IM8A 3MBXL 2FLRT 3F12A 3QFJB 4IDJH 2FIKA 1FYTA 1IGMH 3IU3A 1DQLL 4DEPB 4UQ2A 4Z7WB 2VH5H 4ETQA 4IRJD 4JZNA 2R0KL 4KRMB 5CEYB 1MNUH 3OF6D 3G6JE 1DBML 3TESA 1F3RB 1F6LL 3V6ZB 2E9BA 1I75A 1KXTB 1PKQA 1ZGLB 1I7UA 1UZ6F 2WUBH 5I75C 2HT3C 4O9HL 3MJ8A 3WFDH 1JIBA 3QIUB 3MSPA 5D8JH 1I9RL 4F7EA 3CUPB 1TPXC 3WNNA 15C8H 1NUGA 2DM3A 3B9KA 3L1OL 1S9XB 1GZPB 4I48B 4M93C 4EN3D 4Q9BA 5E8PA 4YDIH 1U2HA 1PZUB 2D31A 3VXUA 4YAQA 4IEFB 5I9QB 2DN7A 4NC0B 1BGXL 2VDNH 1D9KB 3V6OE 2WM0A 5IV2B 4J23A 1BX2A 2PTVA 2C1PB 2OZ4L 4JEGB 1D5ZA 1IE5A 1RIUL 5FCUL 5DFWH 4U6HB 3HI5H 4ZAKA 2MNUA 3FB7A 3MGTB 3IDNA 1HCFX 5E2TL 4PBVC 1FO0A 4X6CE 3NCFB 2PCPB 2XZAH 2F53A 4G43B 1DTUA 2R4RH 4N1HB 3W9DB 4YHNB 2AK4D 4BUGA 2XTJB 4JN2A 3U0TB 1N59A 3FAWA 4Y5VA 2VDNL 5FYKD 4OSUH 5L2JA 2FJHA 4LNVA 3B9KC 1QD0A 4KUCF 1A14L 1F45A 3NN8B 5C0BE 2XZAL 3KWWA 5LQBL 1W72L 3BSZL 5BO1H 3GMNB 4G5ZL 1ZS8A 1QKZL 2N7BA 1XMWA 5A2KH 1JHKL 3MUY1 5HDOA 2IBZY 1NMAH 1P7KB 3K3QA 1UJ3B 2UYLA 3C5ZD 1FV1B 3D39E 5DD6A 4UTBL 1AIFB 1CGUA 4J12A 4WFGE 4ZUSB 3MJ9A 4O02L 1PW3A 3FFCB 3LS4L 1RUQL 4PYHA 5F7HA 3HB3C 3RPIB 1AFVL 1N2RB 4B41A 4QNPE 1HYSC 5E24E 3ZHKA 3KLSA 4FTVE 1PLGL 1MHCA 1VACA 4YR6A 5IP4A 4KK8C 1TXKA 1JK8A 3DMMC 1IMHC 2WUBL 4WUUE 1S9VB 3HRPA 3U9PL 4Y4FD 4BQCA 3SE4A 4JO1L 1PYWB 4HX1B 5I18H 1YQVH 3FO2B 1LO3L 3ARFA 4OGAD 2XOTA 3OGCB 4MQ7A 2VLRB 3OKYA 4HK0B 1WZMA 5HPOA 5C09B 1CLYH 3SPVA 1PEZA 2EYRB 1EA9C 3ROLA 3SDDD 3L95B 4QCIB 3GSXA 4QLRA 4R0LC 2RFXA 2QQKL 1U8QB 4MD4A 4Z7WE 1BOGB 2DQGH 4APQA 5DGRA 3SCMB 5B8CB 3HA0A 2IADA 1CR9L 4PJ9B 5FXCH 2XY2A 5T1DL 1KYOK 5HGHB 1V7ML 5D96C 4M43H 3EOYG 3BPNC 1VEMA 1IAOB 5JOPE 4KXZH 2P5EA 4M1CD 5CIPB 1YYLL 4MX7A 1OAKL 2NCMA 1UADC 4WO4C 3NCCB 1HNFA 1I4FB 1MQ8A 1EZVX 4HSQA 5AWNH 3LKPA 1QACA 4F58H 1Y6MR 4LKXB 3D69B 2D4DA 2YHGA 5DI8B 4BSVA 3AXLB 5GZOC 1PG7L 5HHMB 4I77L 1FLRL 4PJBA 1FJ1A 3C9NA 5HYJA 5DJCB 4OCSL 4OZFA 4RX4A 1GGUA 1R6VA 5EBWA 1JNLL 5C0CA 1IGJA 2EICA 1BFOB 4OLZL 5GGRB 1ZHLB 4XC1L 1VACB 4TSCH 4PP1D 1D5IL 4LFHD 3W0WD 4OGYL 3VI4F 2VYRE 1UM6H 4OZHE 3Q6FB 4OB5H 4AENB 3ULVH 4Q7DA 2XA3A 5D7IB 1MCJA 2W1NA 3MXVL 3NGBB 2R0LL 5IK3B 4FQPA 1SMOA 3NTCH 1K8IB 1OSPL 5EIQA 2R1WB 5CCKL 1OTUC 1AIFA 3TA3B 3ARGA 5DJ2A 1DQQB 2I60H 4OCSH 5CBAA 5I6XB 1T0NA 2HTLD 3ZTJH 5DJZA 5EORL 4RMWA 3RI5F 4HQQL 4LSDA 4DWHA 2E8YA 3NFNA 5J6HB 3BQUC 3PWNB 3EO9H 3RP1A 2CUIA 2BDNH 1AGBA 2R9HC 5DMKA 2NY0D 5BVJB 1DBBL 1LO0L 5J3HC 1M4KA 5FUZH 4XWOC 5TPWH 2HG5A 5HGAB 5DJ6B 2XZQL 2H2PD 3SKJL 5DK2B 4HT1L 3WJJC 3T0XA 3GI8H 1BZ7B 3A6OA 5KS9E 3QUKA 3DSFH 3BRGC 3QBTB 2QQKH 5KVMC 4GG8A 5ADOL 4KK5C 3CVHB 1RK0A 4WWID 3CPLB 1ZHKA 5I73B 1IGJB 4Y16B 2YOCA 4HFUL 4OZGA 5DA4A 2R29L 2EIZB 1I9JH 1Q9WB 3K8LA 3DVIA 1MUJA 1D7FA 5B22A 2BCKA 4JO1H 4R6UA 2V7NB 5A3ID 2X09A 2YD4A 5DURB 3TT3L 4WUKH 2LU3A 3RVUC 1FFPB 3BP4A 4JANB 1U36A 2VL5B 5F1OB 4M02A 3MLYL 4V2CB 3EOBA 4X4MA 2DYPD 1KCRH 2FHCA 5DC4B 5FYJH 3EFFA 4G6KH 4U1HB 2YZ1A 4JKLA 5JOEA 5C9KA 5C07A 3RL2A 1CK0L 2E27L 1KC5H 3OAYK 1LHZA 3IJSA 1S9VA 5FM8A 4L3EB 4WFEE 5IBTL 2EXWC 1EIBA 2Y72A 3UBXA 4I4WB 3GSNA 4HWZB 4YPGB 5LBSL 3EO9L 2P5WB 1NCUA 1VKXA 4IRSC 3TZVA 3QA3A 4H8WC 4KV5F 5BZWB 3QNXA 3L9RB 1IZKA 4P3DB 3H9HA 3X11B 4ODTH 2HJKB 3LB6C 4WJ5A 1RUQH 1I9JL 1S7SB 4LFHG 35C8H 3ZYIA 4HPOL 3CK0L 2MJWA 1KXQE 3UTTE 1NMBL 1JI1A 1A5FL 4N0UB 2A1WL 3ULVL 3OJMB 4GRLD 5F7UA 1R5IA 4MD0B 5D9SA 3HAEH 2G75A 3K7UA 1KIRB 3SN6N 1U91B 1B2WL 3JTTB 1JNHB 5F3BB 2LV4A 2R23B 1MJUH 2A6JB 4L4TD 4OLZH 3LCYA 1AI1L 5DEGB 2A6IA 4NQEE 4QOKB 3HPLB 4DKAA 1INDL 2P7TB 5E8NA 3KPRE 3N9GL 2AEWA 2EDNA 1A1MB 3GSRB 4RFNC 1LK2B 3MJ7A 1N0XH 1KEGL 4LMQI 3BZEB 1E4KC 5D7LE 4K71C 1QA9A 5FO9B 4KHXH 4N1EA 4YHMH 5D5MA 3NFPA 3B5HA 2VB5A 1A9EA 1LEGA 4DCQA 3DUSA 5AUMB 1EX0A 4X6FB 3EO1A 3O3AA 4BYHA 3KNBB 4OZGB 1WBZA 3O3BB 2A77L 4NQEB 3EOAA 4GG6B 2Z8WC 5CEZD 1CS6A 5INCA 5M7QA 1MJUL 4OM1H 2HLAB 3SKUD 5IFAL 3PP3K 2ED7A 4M48H 2CDEA 1KV3A 25C8H 5AAWA 3PXHA 2W65A 2X4QA 2VLKE 2Y25A 2Y07L 1MFDH 3KYMA 1J0YA 1LK3H 3WEXB 3HZYB 5I8KH 1BD2B 1W8NA 2YR3A 2AAVA 4ZD3H 4XNUH 2W0PA 3T0ED 2WWKO 4UZGA 4KKCD 1W0VB 1VHPA 1NC2D 3LN5A 5KVGL 1XT5A 1TNMA 3PGFH 3QJFB 5JHDE 3TV3H 4WHTB 4MDJB 2DS4A 3D6GA 4I2XB 1PLGH 1SMAA 4X4XB 3S6CA 5JPNB 3C8KB 3L3GA 3V8CA 1DQQA 5CJXC 4YGVA 2JE8A 3VE0A 1YJDH 4KTEL 3BZDA 1KGCE 4PG2C 4K3HA 1DVFD 5DDHB 3SDCA 4U0RC 3SQOH 3UC0H 2GJZB 4M43L 1QHOA 3NPZB 2Q3AA 3IU4H 4OF6A 5F1SA 4QRUA 2QTEA 3L3JB 5A3IC 1J8HA 2AJSH 3HZKA 1MRCL 3UJIH 3VRIA 4LHUD 4LSTH 3WDIA 3HG1B 2NY6C 5HGAA 4PJ9C 4CU7A 3L7EB 5IG7A 2AEPH 3GHEL 1KCUH 1XR8A 2HKFH 4TVPD 3FKUS 2HTKC 1TJHH 1IEBB 4MA8H 2H3NA 2FGZA 4C59B 2X1OA 4QRSB 1H0DB 4BELD 2E3VA 5F7LB 1FZMB 2LQRA 3O2WH 3MBXH 2NYYD 5FA3A 3UTPD 5C7XH 5FO7A 2JELL 2Z31A 5CWSB 3NCYP 4PJFF 5CBAB 2NY7L 1ORQB 1P69B 1UACH 2PKDA 4I0PA 2XKUA 4PJ8D 1X4YA 2NY3C 1T7VA 2WLZA 2ARWA 3RWDB 3BP6A 1CVSC 4HIJB 4R7NB 2W60B 1F4XL 1UZ8B 3RDTC 2EEDA 1ZA3B 1DDHA 2H9GA 4PJHF 1SBSH 4JFXA 4P99A 4UUJB 5JW5B 4XNUL 5B3JF 4P4KD 1N5AB 3MGOB 3O4LA 3BN9C 1HXMA 3EDEA 1WBZB 4K7PX 4IRSB 4NO5B 4CW1B 4D0DB 1RUKL 3VH8A 5I66B 3NIDE 5F44A 1TETL 4ACPA 1DQDH 1UENA 4F2MB 3A67H 1MJJA 4M7JL 4GQ9L 4WJ5B 5JORA 1QFUL 4BFIB 5HI3D 1KCVH 1TTFA 2YN3A 3V0VB 2GJZA 5DI8A 4U3HA 1OP5H 4M8QA 5C2BH 1UKSA 5A16A 3QXVA 1DQML 1AE6L 1B0RA 3P4NA 2GT9B 2YRPA 5C0CB 4JRXA 3AAZB 1RK1A 3VXTB 4NNYA 5DZNA 3DYPA 3VFGH 2X89A 4XZUB 1R5IB 4MD0A 1A1OA 3ZE0E 3P11H 2VLLB 1GRWA 3UYOD 2M1KA 4OLXL 4HH9B 4P2CG 2VSCA 1I3RA 3KYKH 4QRSA 3KPSB 5HGGS 2FSEB 3N50A 5HDBE 1ERNA 4FP8H 3C60C 1CE1H 5EN2B 4L5FL 3VJ6B 1BQHB 2WBWB 1I7ZA 3ARQA 1CGTA 1EEQA 1F00I 1I1YB 1TZIA 2AJ3A 4S1RH 1F2XK 5GRUH 4DZ8B 4CN6A 1R24B 1U8KA 1NCBH 5EUOF 5GRJL 2B7DT 5IHZB 5L0QB 3KPOB 2IH1B 1QR1A 3K4AA 2DMCA 1Z9LA 4JFFA 4YJZL 1IGFH 4GJTB 4HUWB 5B39B 4CN1A 5I30L 2JCCF 4PRBB 2SEBB 5T1KB 2DLIA 5IVXA 1RQ5A 1M71B 2A6KB 1JN6B 1YQVL 4LCYA 2YKLL 2R2EA 4S1SL 1YJDL 4KTEH 3CFDA 3GZKA 4NQSA 1ZLWK 2Z31C 3I6LE 3BE1H 4WWKD 4D9QE 4HIHB 3UDWC 4RGMC 1J8HD 4GXVL 1P4IL 2YPKA 5F93C 1QFWH 1UB6A 4JM2F 4OUUB 2DQTL 4HGWA 1UVQB 2H45A 2R8SH 4OF3A 2VXQH 1DVFC 1J9CT 2O61B 1PEWA 3R1GH 5ESQA 2VLJE 5JW3H 4B7LA 1EAPA 2EDEA 3L3IA 4JLRA 4PG2A 5F70A 2NX5D 4TTGA 1CQKA 4BSWB 3H9ZA 4W68A 3GMOA 1QRND 3SO3B 3R4DA 1KTLB 1CFTA 3HC4L 4OKVB 4IDJL 4UNUA 3VXSD 5MEQB 5GS1C 4L8SA 3T04D 5IGXL 5C08A 1D5MB 4JZJC 1TTUA 3C6SB 4D2NA 3BP5A 2ITDB 1Y6NR 4X98B 3G6DL 3W11D 1CDYA 1RHHA 2VDQL 2NY0B 5H8DA 3LRSA 3PWLA 5D7LB 25C8L 4JM4H 3I50H 3IF1A 5DHVA 2PYEB 4LSRL 5K9KB 2F54D 3MRNA 5SWSE 2UUDK 5MEOB 5DZOA 4TYUA 1V7NH 4RFOL 5CEZH 4ZO6A 5C07B 3RL2B 3IDXH 4L8BB 1HILA 4JFQB 1VEOA 2VZ1A 2J88L 2MHAA 3ILQD 3QXAB 2ADIA 4HT1H 3CFEB 4Z7OF 5T1LA 4RNRA 1AQDA 1LDPL 4POZC 5IJVA 4X4YA 1GYAA 1IEAB 2DQJH 4X7TB 5GIRA 2JTDA 1MFCH 3KPSE 4PRNA 3I9GL 2OZ4H 3DXAE 4JKPH 1TPXB 1JGEB 1VGKA 2VR4A 5ICZB 3LKQB 1UM4H 1WICA 4JQIL 2JJVA 2DJUA 5D93C 3S5LB 4ZS6D 3MNWA 4M7ZC 4JFDA 2X7LB 2VWEC 3FQRB 1RZIA 4Y4KA 4XTRD 4XCFL 5DEZA 4OZGE 1JV5B 4OQTH 4UT9L 5IUSA 1J18A 4LLYB 4Q6IA 1RIVL 4KAQH 4MNGB 1J0KA 5E5MA 2WSKA 2NY5L 3KPPB 3V79C 1E4JA 3MRDA 3ZKNC 4PJDA 1OGAA 1RUML 5HPMB 1BJ8A 4LRNH 4Y4FB 3QG6A 2ESVA 2FX8L 3ZKMC 1G6RL 2NXZC 3TFKA 4CNIA 1Q8MA 4PJFB 3LDBB 3OKKA 4OCYL 3NZHH 4MDIA 5C08D 1N4XH 4KK9D 5IBUB 1IC1A 3RUGE 1G84A 3CD4A 5DQ9A 1YDPA 4DUVA 4ODTL 1NFIA 4Y1AD 5I8OL 2X4OA 4K3EH 3MLYH 1Q0XL 4ZXBA 1XGTB 4F58L 3BYTA 2CD0A 3P73A 4JFDE 3T1FB 1IGCL 2X4UA 3IDMA 1WQVT 3GMQA 4EI5C 5D5ME 1J1OL 1BWWA 3BUYA 1N6QH 5D1QB 1PX4A 1EEZB 1M7DB 4NYLB 4NNYB 3O2WL 2L4OA 4M7LL 4AH2B 5B39A 2R29H 3BGFC 2XPGB 3VD4A 2IFFH 3RY6C 3V5HA 4XGZB 4ZPTA 3RY5A 1UH4A 5L2KB 1T1YA 4PJHA 4WWKC 2BNRB 3GB7B 3X3GL 3GJFH 3QB7C 3SDXF 4YNYA 1EHNA 5C09E 3HR6A 4NC1E 43C9A 4L29B 5E9DB 3ZKSD 1DQLH 5IFJA 5GGUA 1NH6A 3QAZC 3LN4B 2E9WA 4OFYD 3H7BB 3VXPA 3WLWD 3BWAB 1XH3A 3TO4D 3VFRB 3WDJA 1QSED 3UC0L 4HUUB 2YRZA 1X5KA 4G8GE 3PWJB 2ED9A 4PJ5D 3U0WH 2FX9L 4D3CL 2DQHH 1ZT4B 4PJCA 3QEQA 2YD7A 4R4NC 2HMID 2CMRL 1ZE3C 4N0CC 2GSGB 4NO2A 3MRKB 2EDBA 3PGFL 3QEHA 3UTZA 3F12B 3QDJE 1CZ8H 4Z7VE 3O9WC 4HAGA 3KPQB 4P46A 2UWEE 1SJEB 4MZ3A 3IDJB 4ZD3L 3ZE0F 4ODXA 1QRNA 4PJBF 2XXMB 3OG4B 5F9JA 4LKCA 2ENYA 5HJ3A 1ACZA 1J5OH 4PTUA 5KVDH 4HHAA 4WV1C 5MEND 4Y88A 1KELL 2R2HA 3AB0B 1GGIH 4P59L 3S37H 5D2NB 2WBJD 4WRLA 1CE6A 4XB7A 5C92A 5L9DH 4JY5L 5D70H 3LS5H 4DW2H 1O5DT 3TBYB 2OR8A 4NM8H 2IG2H 3QWRD 4Z7UB 2CKBA 3ALWA 3LD8C 2EIDA 4PGCA 5KVFH 2OI9C 5FKAB 1XGTA 5IWLA 3EYSH 4OZHB 2EH7L 3ILQC 1IQDB 2R4RL 1M1SA 1A7BA 4LRIA 2C1OB 3O6ML 4JQVA 3RZWA 4ZODA 5MHSD 4URTB 2NY4C 1EJOH 3IJYA 4XPFL 5EOTA 2WBJB 3MCLH 1LE5A 1CLOL 5CSBA 1ZLUH 1RK1B 5ACMA 1X4XA 5HHNA 3OKLA 1I3GH 1UGNA 3FB6B 3MBED 5DQDL 4AJ0A 1EV2E 2ADGA 5J7CC 1KF9B 1CLYL 1NCCL 4WHYH 5FM4A 5IB2B 4A6YA 3RWGB 4K7FB 1CFQA 2NY2D 4F9LA 2VABA 3QEUB 4X5XB 4ZTOH 4Q9RL 2Z8SA 4P2QB 5L8LB 5JW4Q 2X9YA 3VMOA 5F3HA 1OLLA 1CXHA 2Q8AH 4GBXD 1TMCA 2O5XH 4WW1B 1UZ6E 3K4ZA 2MWCA 4ZUUB 1O7SA 1VENA 3H9SB 3WS3A 3SKMA 2Z91A 1T04B 3FTGA 1Q9LB 5DUPH 3GBML 1Q94B 3QXDB 5TDPB 4WI4A 4PY7A 2EYSA 1CFNA 3D5OF 1ADQL 2FCBA 1A3RH 3KDMB 4OT1L 5F9OL 2I9TA 1DBMH 4JFQA 5D6DC 5HHVH 5FYJL 1Q0YH 4FQ1H 2EIZA 2VLRD 5DHYA 4U1LB 4NN6B 5BXFA 4OCNC 3RHWK 5L2KE 1NMAL 3U82B 3BE1L 1MF2L 2YPKB 1QKZH 1PQZA 2R4SL 5ID1B 4NCDA 1CGSL 2WZPD 4AEFA 3QUMA 4P46D 4MB4A 4QY8A 1XIWA 1ZLVH 3NN8A 1ZT7A 1NPUA 3DMMB 2CK0H 2V2WA 1ZV5A 4U1MB 2ZCHH 3SGDH 2HLFD 1HHJB 2AQ3A 5KJRL 3QHFL 4HCRL 1VADA 3C8DA 1YN7A 3QQ4A 2V7HA 5BVJA 1NCBL 3I2CH 5EC2B 3W11C 1TITA 4X6EA 4M62L 4M1CC 5EG6C 4WEBL 4WFFD 4HUVB 1C16A 1WUNT 4GUPB 2EE6A 3DX8B 2BOCA 3QCVL 4WI3A 3QDGA 1I3VA 1CDHA 3HMWH 5F88B 3HFML 1DBBH 2P8LA 4ZTPH 4GAGL 3JUYA 1MVFA 4PJAA 1HSBA 2YBRB 2I25N 1H3PH 2FHFA 5BS0A 1QBAA 4P2RE 1MCPH 3K2MC 1C5BL 4LSPL 4S11A 5EWIL 2WBJC 3IKCB 2EKSB 1BLNA 2I60L 3RZCB 4U3CA 1OVZA 4FABL 1AE6H 1MWAL 1JYWA 5I1AA 1HEZB 4EUPG 3KPRA 2PW1A 2DRUA 4WNQA 2X4NA 1XF3B 2RGSA 3PWUB 3DX7B 1AH1A 1NGXB 3CXHK 3IDYC 3GHBL 4O2EA 4X5WA 1U8NB 4YBLB 4RISH 3W5NA 3WHXB 4LKCB 5AZEL 3IDUA 4KDWA 4RMSA 3KJ6L 4S2SB 2OI9A 3P77B 2APWA 4RGNE 5TDOA 1HXMB 3MTRA 4LASL 1T2JA 2H1PH 3JTTA 3M17B 2C3XA 3IETA 2IGFL 3GEWB 3UPRA 4L3CA 4GUPA 3AUVA 4NO3B 1X6LA 1EO5A 1YNKL 1WIPA 4Z7QF 1R5VA 2YPVH 4FQ2H 5D7LA 2GSGA 4NO2B 1X5XA 1AD9B 3BIBX 1AGDA 4CVUA 1MFAL 3H2WA 1AQKL 5TQ0H 4JHAH 4OF5A 1HILB 3QWOB 5I74C 5DVKA 1VFMA 4WI5A 3GIVB 2BRRH 5IIEA 5GRZA 4PLOB 3QFDA 1P4BL 3PJSB 4JHWH 8FABA 1IT9H 2GY7B 1FFNA 3N1PC 3QJHA 5FGCE 1PSKL 3TA3D 4N8VB 4LPYA 1YY9C 5KSBB 3P4MB 1VFAB 3ET9F 5T5NF 3WS6C 2JLLA 4GRLA 1CDJA 2XPGA 4MS8D 1P1ZA 3MYJA 1D9KD 4TVPL 5ID0B 1AO7D 5LAXA 4WW2C 4HJJH 2AI0H 4OI8A 3LKNB 3UXFA 3TV3L 1I8MA 2I9TB 1EEZA 4NYLA 5IKCB 2IPKA 2Z93A 1YECH 4LCUA 2CIKB 1TZHB 5FYJD 1RUAH 1JCKA 4DTGL 4GW1B 1FNEB 4JFED 4YFEA 5E8DH 3LS4H 4YE4H 2EZ0C 4JO3L 4NCC1 2B1HL 1P7QB 1CD1A 2PUQT 2AXHA 1Q9LA 4Y4HD 4FQQB 3RU8L 3IRZA 5SX5H 2AV1A 3ZE1E 1RURL 3ECBB 4Z7NF 2YPLE 3UTQB 2CDGB 1FH5H 1GC1H 4NDMB 5EU6B 5GHWL 3B9EA 2KPNA 2HJKA 4UIMA 4PJBB 4XTRC 3E0GA 2HN7A 3SCMD 3EYQC 1CGXA 1A14H 1WBXA 3LD8B 3MRJA 5BW7A 2E9JA 5DUBA 1MEXH 2CUHA 5C0FA 5AD0B 4KXZI 3BN9D 2IPUG 4LSVH 1AP2A 5T3XH 3G9VA 3IXAB 4H5SA 1F02I 2AJVH 4GG6F 5TGBB 4R2GB 1A9BA 1WAAF 1NFKA 3TBTA 1NGQH 4G6FB 4P57B 5ESAB 1TFHA 5L6YH 1CFBA 4WTWA 4PJCF 1KCSL 1AI1H 1BOGA 1PGRB 4CMMB 4NUJB 2P4AB 1FL6A 4X7EC 4K3DL 2FZ3A 4LEOA 3W81A 2P44B 5IKCA 4JFFD 3TVMB 2GSIA 1L9MA 3JTCA 1AD0A 3ZTJG 4PJGF 1A7QH 4HJ0D 4BFGA 1JE6A 3BKCH 1ZLSL 5D7IF 1CFVH 4JHZA 4XNZB 1N26A 5E70A 2VLLA 4P9ML 5DSCB 35C8L 3C09C 3D2UB 3TGXA 4TPRH 1HHGA 2DQCH 2PTTB 2XWJB 5EZOH 3MUJA 4L9DA 2MCPL 2C3WA 4HCRA 3L3OB 3MLUL 3SY0A 3AY4C 3HUJA 3V8OA 2NX5B 4XAKE 3I6KB 4I5BA 4CDHA 1JMZA 2CSPA 5D8JL 3VFTB 3O6FD 1JBJA 3WFDL 3FFCD 4N0RA 3VU2A 4NFDA 2JCCE 4PRNB 4PB9H 5CGYD 3HAEA 4DUXA 3ARFD 4OCRL 4K7PH 2CIKA 1I7RB 4XNQA 1BFVL 1WWCA 1HDMA 3KGRA 5F3BA 5E4EC 3A0OA 3ARDC 3PQYA 5CMAB 1ACYH 5C0RH 3VXQB 1JHLH 4HZLA 4WUUD 3ZYOA 4N0CD 3RNQA 3IRPX 2XQBH 3KG5A 1MIEH 3KXFD 2WUCL 4JZOA 4V3EB 3FTGB 3EOBB 4NBYB 3JSSA 4LCWE 1D5BA 2FJFB 1KIPB 3VGFA 2O5YH 3M8OH 3SHSA 4AEEA 5GS1A 4YUEL 1YMMB 2COQA 3BKML 3PL6B 3PJSA 2AJUL 1G9NL 4P2OC 3LV3B 1CD0A 2PETA 3ERYA 4QHMB 1OARH 3VFMA 3Q2CA 2K9UA 4JPVL 3B3IA 4H1LB 3W2DL 4YBHA 3CNKA 5KZCD 5C3LD 2NW2A 3DX7A 4L9LA 1T20A 5JOPD 2ID5A 2DQEH 2M2DA 4L9LC 1S7VB 2VDLL 3BH8B 1RUPL 4PP2A 3FQWA 5EO9B 3QQ3A 3C2SA 4KZEL 4KK8D 5TF1L 1HOCA 1RVFL 1TZIB 5I1KH 5GJTH 4P9HL 2BFVH 5E2UL 4N5EC 4S2SA 4YIQB 1A0QL 3F7YB 1KN2L 3TO2B 2ERJC 4FFZL 4LSQL 5CP7B 4O4YL 3DTXA 1FZKB 3PIQA 4NHUE 3B9KB 2DLFH 1HQ4B 2HFGL 3CFBA 3AVEA 5ALCL 5DRNB 1UQSB 1OM3L 5HYSG 4M1GH 1JI2A 2HVJA 2C5DC 1Z0NA 4PRPD 1XFPA 3B4NA 3UJJL 4OLVH 1JJUA 3CZFA 1B0GB 3THML 1FCCA 1MCWW 4X6BA 1NFDE 5T3ZL 1MCOL 2BVYA 4LPVA 4M8QB 1WAAA 3CFJA 1U8MB 1S7RA 4P4KC 2V6HA 1NL0H 4GQPH 3MRRA 3RVTD 4I3GA 3B9KD 3PDDA 2DQIL 3EOAB 2IAMB 5LG1A 4TSBH 4ODHL 5DXWA 1U8PB 1WT5C 1I1FB 4XNXL 3BDXA 3FQRA 4JFHE 4WU7A 4PJ8B 2ESVD 4QRRE 3W0WB 4WDIA 4R96A 1CL7H 4NSKB 3EW3B 4MVBA 1HI6A 1HH9A 3MV11 4WI7A 3EYUL 4JKMA 1AKJA 4JM2A 3H0TB 1I8LC 1K6QL 5KBNC 3AAZA 1IEAA 5CJBA 4XNMB 3VXRB 2GI7A 4NBXB 1AGCB 1KTRL 1FFRA 1GGCH 3V6BR 5EDXA 1GPOH 4HIEB 3WDHA 4O51B 1NKOA 1T5WB 3QUZD 3HPJB 2DQGL 4F3FB 1OTTC 3FT2B 1ND0A 4JQXC 4ZSOA 5ACZA 4M9PA 4R26L 3U2SA 4EBQL 5JO5A 5LCVH 1OAQH 1ZT1B 2JB5L 4HWEL 2QADB 3CDGB 3ZT7A 3H3PH 3KWWB 4RWYH 4TSAL 5K9QG 3WNOA 3TM6A 3RDTA 4MJ5A 4Y16A 4EQ2A 3H9SD 5MERA 3HC3L 5DUMH 4KKLD 3ABZA 2X6MA 4HBCH 4QRUB 3REVA 3G5ZB 1E6JH 3MUHL 5IIEB 4KI5F 3STBA 3TIDA 2OR7A 2BC4B 5ELIA 3FMGL 3RWEB 4O2CA 4ONHB 4V1DD 3PHOB 3PHSA 3QRGH 4U2YA 4JFYB 5CSGA 3VXOB 4JRYA 2NY2B 3PWPE 1BEYH 4HUKB 1TQCB 2BNUA 2I24N 3T2PA 1NFDB 3WLBB 5IMKB 4LDOB 3VFUB 3WD5H 2RCSH 1MIML 5DRZB 5LKNA 4RRPG 1F4AA 5B8CA 1K3ZA 4LHQB 4K8RH 3ZE2F 2X1WL 3D39B 4OLUL 1ONQA 2XACC 3L95A 4QCIA 3UTSA 4WO4D 4KV5E 4H25A 4ZUTA 2APVA 2XNAA 3HNTL 4MNQE 5CD5D 1MAML 1MLCB 4Z7VF 5DC9B 1QPXA 4XPHL 4PLNC 5F7MC 3CLEH 5C07D 2X1QA 2BVEA 3BIAX 4FQJL 5F89B 5L8KB 5BMFH 1DBJL 4N0YL 4Z77B 1EHLH 2BY0A 1M71A 2VN7A 1SJVA 2BVOA 1YEFH 2J8UF 4NKIL 3O11A 5CSZA 3IFPB 2AV1B 3NAAH 4RFEB 3QH3A 4G7YH 4QOKD 1J0ZA 3BZFA 4OLYL 4POUB 4OZFB 4NN7B 4HUNB 8FABB 3LV3A 2V5MA 5FUCE 5CEXB 4Y8DC 5D71H 5FB8A 3U0TA 4XP6L 3TO2A 2O5ZL 4LDEB 3IFNL 4MMXC 3W9DA 3NZ8A 3QCUL 2YXFA 5INDB 3P0YH 1YYML 2OK0H 4YHYC 1V3LA 4GS7B 3P9MB 4LCWB 1AY1H 1BBJA 1JTPA 1ZS8B 1K3IA 4HGKC 2G60H 3MACH 1RZKL 2JJSC 3L1OH 1X5ZA 3MBEA 1A7NH 5HHME 5I1CL 3LSOA 3DUSB 5AUMA 3MLZH 3IFLL 5DD0L 5TGBA 3WSQH 2ITDA 4K3JL 4U0QB 4X98A 3GSQB 2ZSWA 1F3DH 4OZIB 3VH8B 1MFNA 2UV3A 2IAMC 1HXYB 1J12A 3ROOB 3QUXB 2O93L 1CU4L 4RWHA 1R3JA 1XGUB 4AMKL 1U8IA 1OQOA 5ISZE 2GUOB 3RIFK 3FOMA 5DT1L 3G04A 5FEBA 4N5UA 2AJYH 5EBWB 5IB2A 1FVCA 5TE6L 1R5WA 4XVSL 1XGYH 3IGAA 1MAKA 5TE4H 2P43B 1G7PA 2WLYA 3TN0B 2ZNWA 3FONB 1YEJL 4GRWB 4NJAH 1PJ9A 4F8TA 1QTYT 2WBJA 5CUSH 3HPJA 4RA0C 1CYGA 2DBLL 4PRHA 4QRPE 2R1WA 5EUOE 1FFPA 2XN9B 1YEGL 5KAQG 5CKGA 1DEEB 4XP9H 4XP1H 1EERB 3O81A 2F5BL 4V2BA 4EVNB 3FHAA 3QFJA 5FV1L 4WENB 3NIGE 4EI5D 1A2YA 5CSZB 4GBXC 4XXDB 2GK2A 3UTSE 3WLWC 4JRYD 1LVEA 3SE8H 4GW5B 1MWAB 1S5HB 2YD3A 4ISVA 2Y7QB 4KC3B 4KDTA 3VWKA 1IKFH 4HUWA 1L7TL 1I7TB 5HGBA 5KSAC 4TOYH 3UPAA 4LLWA 1MFBH 4P4RB 5DWUH 4G9FD 2Y4SA 2E5EA 2XYCA 5E56A 3VFOA 1SYVA 3QUKB 4O5LL 1EMTH 2E6QA 3D0LB 4W4NA 3GSOB 3FQNA 1YDPB 5E03A 1RMFL 1XIWC 3CC5B 4KJYA 1OWRM 1D5BB 2VR5A 3OR7A 4ODXB 2HWZL 3FFDA 4M61A 3LRHA 1G7QB 3FB8B 5BS0E 2YS4A 3E2HC 4U1GC 5DJXB 4PTTB 4DVRH 1D5XB 4PJAE 4E42A 1JF1B 1GXEA 5GS0C 3QXAA 2ZPKL 3V4PH 1N7ML 5TDNB 1SHMA 2A83A 2D0HA 4NQDE 4X6EB 3QYCA 5MP6H 3D48R 3QHTC 1GL4B 2UZIL 1HDMB 2LU4A 4OLWH 5BV7H 4KJWD 2YPLA 3JVGA 1FPTH 4XBPB 3OV6A 3VXUB 1ZTXL 5CILL 2XWTB 3DO3A 3VWJD 3MCG1 1UXWB 2V17L 1CE6B 4BFIA 4HXBL 1J10A 1LP9B 2XXCB 3C6LC 2NY6B 5GGUB 1LEIB 3RWCB 4I3RH 2BNQA 2Q8BL 4G6MH 3SDAD 4DN4H 2FX7H 5DLMH 4PRAA 4L8SB 1OARL 2FYYB 1XR9A 2BP3A 1KN4H 4FQLH 3O6LH 3ZMRA 5IQ7H 4L3EA 4YUEH 4WGVB 1AGBB 3UPCA 5I76A 3MLSH 4PUBL 4U1LA 5SX4H 2V5TA 1WWWX 1EBAA 3DUHA 4HUXA 4EIGB 4Z7OE 3SEPA 4G6JL 3LKSA 2P24A 3I02A 1CF8H 4KQ3H 4LKXA 2ARJQ 5IJKC 1PG7X 1W72A 1YEJH 2ITCA 5E8NB 3S35H 4AEHH 5ITBL 4OZFH 4FQXC 5GGRY 2XY1A 2DWDB 3QHZH 1YNTB 1JHLL 2BNRE 3HMXA 3VGBA 2WAHA 5I1DB 4GKNB 1P4LB 4BKLB 1ULVA 2FD6L 4LHUB 4DKEL 1L0XA 1HH9B 4JGMA 3JV0A 2VDRH 2OMBA 2AEIT 5F1NA 2NZ9D 4Z95L 3P4LA 1TMCB 3QUZC 2DTML 2EC8A 1A9BB 4GO6B 2DAVA 1FAIL 3WFHA 4R7DA 5IVZB 1A6PA 4PGJA 3CXDL 1MCCA 3S9DB 1EFQA 4XCYB 4RAUA 3VGAC 2JJTC 1HHIA 4Z77A 4NT6B 5JXED 1RSFA 2HJFB 1NDMB 1GAFH 4J3WA 4OFVA 1H5BA 3MRGA 2DLHA 1KEMH 4D9LL 3SE3A 2YBRA 2Y9RT 3OXRB 3U79A 1BD2D 1GIGH 4PJXF 3O8XD 4DGIL 1KBGH 2VZ3A 4U3XA 2KDGA 4KRPC 1IJ9A 5C1MB 4Z8FH 4I9WD 3EYFA 4DQOH 1RV6X 2O5ZH 2NTSP 4IIQB 3MRFA 3V4UL 5CZVH 1CD9B 4F7TA 4FNLH 4AT6A 2WMPA 3BIKA 4PFEA 3I6GB 4QHUA 3QQNA 4UIKH 2EDXA 1CI5A 4PPTA 5E4IA 3UTZB 3QNZA 2DM2A 1ZTXH 4RDQF 2X4PB 1QUNA 3RNKB 4UTAH 3LKNA 5GZNC 4FQLL 3DMMA 4I18C 5DURD 2IANA 2VE6A 4PRHE 1TJIH 4QRPA 2A0LC 2EZ0D 3MRMB 3DARA 3EYVB 4JJ5B 1WWAX 5AYUL 2H41A 1F90H 1KUMA 4GFTB 2MCG1 1MAMH 1K8DA 4FFWD 5M94B 4TVSa 3QDGE 5EO0B 2J6EL 3DETC 1T0MB 2HJLA 5SWZE 1FNGA 5GSRA 1G7HA 1FPTL 4QXGH 5IBUG 1UH3A 3IJHA 3T4AA 1SEQH 3V4VL 3LRGA 3VWKC 4U1IA 4WWKA 2GJJA 4WCYH 1K4DA 3GSNB 4P5MB 4UIMB 4XHJD 2W60A 4HF5L 4H25B 4AEIH 3RGVB 4DOHE 4Z0XB 2H6PB 1U3HC 2NR6C 4PD4J 4RMTA 1S8DB 4BH7A 4PJ7F 4Y19B 1GIGL 4U6HA 4ZAKB 5GS0D 3O6KH 4NQCB 1D6EA 4ZUWB 4NZDA 1MRDL 1FO0H 2D2OA 5D1ZB 4N9GA 2H3NB 4KWUA 3K2UH 5HYQA 4QHLA 4XP9L 1NCNA 5IMKA 3KLHC 2XZCL 3V52L 1FNSH 5C6TH 4QRRA 3WNLA 4OD1H 3QH3B 2CLRB 2X4TB 2NNAB 1H3XA 2B2XH 3QNYB 3MRQB 3BPNB 5TJWK 1HOCB 1EEUA 4ZMAT 3O3DA 4P0DA 5DJAA 4XAWH 1A3LL 2IANB 3O3UN 5IM7B 3TFKC 4E41A 1S5HA 4ISVB 1JZ3A 1YPZA 4J6RH 1XCQB 3IDYB 4ERSL 5BRZD 1C5DB 4B50A 5GGQL 3VRJA 5GGQH 4XBPA 3OXSB 4IJ3C 1DSFL 5MI0C 3PQYD 5KZCB 4BH8B 1A6VL 1KSRA 4FMKA 2YRLA 3PGCB 1Q1JH 4Q6IC 2BSED 4E41D 3DROA 1CF8L 3T2QA 3ULSA 1I7ZB 4ZNEE 1QR4A 3F5WA 3S98A 5FKAA 2CDFA 32C2B 1YMMD 2JJSA 4DJMA 2XKNA 3MPCA 4R8WH 3OKMB 5IQ7L 2ZSVA 2Y06H 3EBAA 3MLZL 3WUWG 1S8DA 1NAMH 1QNZH 5FIEA 4H0GA 3KJ6H 3HZKB 1MJ8L 4J7RA 3MLRL 4Y1AB 4CUCA 3LOWA 4M7LT 3C2AL 3O4LD 3VFPB 1U41A 4ODWB 4RISL 5J1TC 2Z31D 4ODUB 4BZYA 1KTKE 3FOMB 4G8GD 5J12C 2C7UB 1OCWH 3RWGA 5EBLA 1HKLL 3MODL 2DDQH 4L29A 2FO4B 2V9RA 4DFIA 4JN1H 3WHXA 1ZT7B 4JJHA 3R06A 3IAGC 2ATKB 4DAGH 5C0JA 4XBEH 1MI5D 3ULUE 3WN5C 1BVKB 2EDWA 1WZ1H 5L0QC 4P2RB 9CGTA 3HNVL 1G7JB 3SGDI 1QHPA 3BMWA 3T4YA 2PO6C 1S7WB 4XRCB 1KN2H 3LEYL 5E2UH 5D1ZA 4WFHE 2C1PA 3D3VE 3BIKB 3DGGA 4WO4B 1YUHB 2YD6A 4PJIE 1A6TB 3HNSL 1SEQL 4TOYL 3NMEA 4ONFL 1FIGL 5DHVB 5K9KA 2PYEA 4GOSA 4POZD 1HH6A 1BZQK 1JGLL 3B5TA 4HV8A 1DVFA 1YQ2A 1LNUB 4PJAB 4GW4A 1A1NB 3SE8L 4MAYD 4UIKL 4O58L 1M7IB 4NC1C 4X7SL 3BVNB 4QTIL 5HXMA 3ZE2E 2UWEA 3DIFB 3P4MA 2J8UB 4NNXB 1JFQL 1YMHB 4NRYA 1HHIB 4HBQA 4NZTL 1S9YA 3L3IB 4JLRB 2A9ML 2BVQB 2J4WL 4ORGA 3VD9A 5ERWB 4AM0B 4Z5RB 1U92B 2FBJH 5T1KD 1FVEA 5E9DE 1EPFA 4ZPVB 3UTSB 5IOPA 1Z9OA 4Y16C 2PXYA 3U4BL 3D2UD 3OQ3B 2RAMA 3E1F1 1QOKA 4Y19A 4MHHG 1NUDA 3GNMH 3CXDH 3NVQA 2FATH 1X44A 3SKNB 4F57H 1IBGH 1P7QA 2GFBB 2ZOKB 3IETB 3M17A 5F1KC 4CNIB 2F58L 3GSOA 3QRGL 1YEKH 3G6AA 2X4OB 5JXEC 3C2AH 3BP7B 5ESVA 2VOTA 4F33B 2B2XL 5FOBB 2WANA 4G9FB 4I3SH 1L4IA 3TYFA 4EOWH 4HWBH 2FWOA 3MLUH 1F11B 4JY4B 4JRXB 1PZ5B 1QPPA 4K2UH 4LAJH 2XIDA 5E2WH 4MJ2A 1XGPB 1S9KC 1NCWL 2F53D 3GKWL 1K6QH 3VDBA 1FZOA 5FYJU 1F5WA 1BZ9B 1U2CA 4JO4H 1NGWA 1JGDA 1NDGA 2GTWA 3DBXA 3P0VH 3E3QE 4R0LB 1FN4A 1KB5H 3NCBB 5LVEA 1HIMH 2AJ3B 2DQFA 3ZYZA 3HUJB 1QQDB 4XCNA 4GMTH 1UXWA 2DLGA 4BM7A 3LZFH 4LLUB 1JV5A 1T7XA 5F6IC 4WCYL 3BKYL 1AR1C 3QQ9D 4G80B 1OB1B 5E6ZA 1PAMA 4Z7QE 2W07A 3O8XC 1BFTA 1PY4A 4MQSB 2BOBB 2G9HA 3SJVA 1MCHA 1P2CB 2I5YH 3EYSL 3TJEH 4R7NA 5I1HH 4JO2H 3QIUD 4ZS7L 5HYIA 4MB3A 2Y5TB 3SE9H 3LRSB 5KTEH 1JPSL 2UZIH 4LF3B 1R5VB 1EEYA 4U6TA 2C3VB 2LABA 4LSVL 2IG2L 5K9JL 1EJ6A 1KJVB 3GJEA 5E99L 4AY0A 4AG4L 3ULSB 2W38A 3LMJH 5GGVY 1KJMB 3HMXH 5JORB 5IB1B 2EEBA 3AS0A 3VFTA 4P5KA 2FO4A 3U36A 4BFEA 5I71C 3IXTB 1QSEB 3C5JA 5IF0A 3CGTA 5JA9A 4IRJA 3MYZA 4RMRA 4W4OA 5C0JB 3T2NH 1Q9OB 1FZOB 5ABDE 3OWEA 1IC4L 5D2NA 5I1LB 4HK3N 4HS3A 1B4JH 4Z8FL 1OTSD 1QSFE 4X99A 3O41A 3BRFA 5CP7A 3HNVH 2HVJB 1YECL 3HI1A 1AC0A 5F1IB 1SVZA 5ADPL 1ZAGA 2ICEA 5I0ZA 1G1YA 3WFCL 2OR9L 5F6HJ 1ONQB 3KHQA 4JPVH 3SGEI 1XH3B 5I15L 3UYRH 4FXKB 5T3ZD 2B8OT 3BZFB 5TF1H 5LGHH 1OGTA 1YEGH 1RHHB 5E0QA 4W6XB 1LE9A 1IGTB 2W9LA 4G3YL 4G59A 5L88H 5AAMA 1MHEB 2BXZA 2OTUA 1IARB 1LP9F 4RWYL 3D0LA 1NLDH 2E6PA 2Y6SC 4E9LA 1UFUA 4GG8B 3LKRB 3L9RA 5F8RC 2VDML 1T20B 1JN6A 1S7XB 4ZOAA 1HHKA 1OT1A 3KLDA 1MCFA 2VABB 4QRQA 2GJ6A 3TBSB 3ULVF 4YR6B 5SX4I 1I9IH 4KTDH 1I1AD 1JUFA 4PJ7A 3P0VL 5ETUB 3EYOB 4JZNB 3O3DB 1KCKA 1UB5B 5DFTA 4F9PA 2BVTA 4JPKH 2GTZA 1QEWA 1FZKA 3PIQB 4HKXB 4TQEL 4HUMB 4P49A 5DR5L 1KN4L 4QRRB 5INDA 1T66D 4LVNC 1ZGLM 3TH3T 2DB8A 3MQIA 4K94L 3HPLA 2GUOA 2VLMD 4JG1H 1FO0L 1HQRB 4LIQE 4ORZC 1NL0L 1DZBA 2P49B 4K9EH 1RD6A 5C0BD 1U8LB 2P5ED 5J13B 1MCOH 3P0YL 5T1MA 4UV7L 1G6RH 2OK0L 1NAMB 1UA6L 4UT7H 1QSFB 4KU1A 1C5DA 4H26B 5DQ9B 1GJIA 2XRAL 1XR8B 2FD6H 1GC1C 2J8UE 1OLZA 4OGZA 3WS3B 5HYFA 3MROA 4MNGE 4JFOA 1FN4B 5DHVH 3CDGA 3D39D 1KCSH 4DVBA 1JVKA 4DKFL 4OLYH 3WFCH 3REWB 1KJ3L 5CINH 4GLRI 3AXLA 3H9HB 3X11A 5AG8A 2A9MH 3QPQC 3G08A 4NHUB 2C3HA 1QFWM 3AREC 3QXTA 1CFVL 5FV2A 2D4FA 5BW7C 3HS0B 5DJCA 5IQ9A 3T2OA 43CAB 3WHE1 1WGOA 2VDPL 2DQJL 3PHQB 5DQJB 2DOCA 3QWRA 3SQBA 4FQJH 5LWYL 1F4HA 1UWGL 1BJ1H 5GSVB 4GH7B 2HT2D 1DQJA 2E7LA 2EE2A 2G5BA 3QDMD 3GBNH 3ZKXC 3E6HA 4ZQKA 4PJGA 4R4FL 2K3TA 1F2QA 4PB0L 3RWFA 1A6UH 3QIBC 1MCIA 3WIFB 3WL9B 3MOBH 2F5BH 4YHOH 2VDPH 4X8JB 3DRQA 5IVNA 1MIMH 3TZVB 5BZWA 3DURA 3KPPA 2AKRB 1CVRA 4QRQB 5GRYA 3REVB 3UO1H 4ZS7H 4WW2A 5IGXH 4OV5A 4U6VH 2I5YL 3N1FC 3U6RB 5J11C 4C58B 2QQLL 1MVUB 2ZP0T 1U6AH 3SO5A 1WITA 4KJQC 3W82A 3QEQD 2YUVA 1IZJA 3O2DH 5TE6H 1IM3B 1DEEA 3RA7H 4NQCD 3MRPB 3SDAC 3QEGH 3QT2A 2Z31B 5CWSA 4OT1H 5GS3A 2DQDH 4UV7H 3ES6B 4OCRH 3WJJA 4GRWE 5DMYA 5FB8B 5D2LB 3C60B 5I1JH 1G6RA 4LGSB 5EA0H 2AABH 2ATPA 4WTZA 1DFBH 4J8RB 3O3EB 4AIZA 4RZCB 3V0AC 2VIRA 3I6LD 3MJGX 1SYSA 1E4XL 4XAKD 1XZ0A 4LVNB 1BWMA 3GNML 3VCLA 1E28B 1S7WA 5IW1B 3PNWA 1A7NL 1HYRC 4TQEH 4PGBB 2BRQA 4YXLH 4OQTA 4PLKC 5GGTL 3OKOB 3RFZC 1FAIH 3U9UA 4EZMA 4LQFL 2Z91B 1SEBA 4WVRA 5J13C 5J56B 4ZPVA 5IOPB 5FGCB 1CDIA 2EEAA 4R3SA 3O0RH 4OCXH 3BHBA 3BKCL 3LQMA 3VXPB 3CFDB 4ZS6C 1MRFL 3SJVE 4LBEB 3QCUH 4GT7A 1WZKA 3DGCR 4JZJB 4UQ2B 3MV8D 2NX5E 1FLTX 2H2SC 2Z4QA 4LAQL 1I1AC 1ZANH 3GSVB 4RGMB 1IAIH 3X3FL 1F8TH 5B38B 5C0NC 1OGAE 2DD8H 3U4BH 1MHHB 4L1HA 3IDGB 4XAWL 5D2LE 2HTLC 1HI6B 4X7DC 3F65A 3GSNL 3ZTNL 1PD6A 1EFXA 5E94A 1KPVA 3HNSH 4K3JH 4RGNB 1OP5K 4HKBA 3NA9H 2A73A 3PWVA 2XWBB 4PV9B 3MRHB 4TUOA 1X7QA 4JPWH 3UYRL 5LAXB 1KCLA 2L0DA 2FX7L 2VAAA 1S9XA 3GK8L 4HC1L 5L8JB 4MGXA 3QDMA 2DLFL 3CUPA 5ADPH 1HYSD 2D0FA 3EFDH 4PGEA 2VISA 3X13A 1G9NC 2V17H 3W39A 4NC2B 4O58H 4I48A 2DICA 3QIBB 3HCVA 1RJYB 2YC1B 4FXGA 5E8OB 4Y5XA 4YFLI 3DXAD 5DK0A 1H5BB 3MRGB 1SYVB 3WNMA 2EDFA 3BT2L 1OL0A 1A22B 1MSPA 1RUPH 1S7XA 2V2XB 3GIVA 3QA3B 1LEKA 3BN3B 5C0CE 3GMRB 2A0LD 4CMHB 2NZIA 1HHHA 5BS0B 3UP1A 1CGWA 3QSKB 1B9ZA 2Y5TA 2X4SB 2QKIA 1JK8B 3UZQA 2N56A 3GJFB 4Y2DC 5DJ6A 5HY9A 3STZA 5I71B 3QIBD 2GTZB 2D9QB 2NY7H 1QNZL 3FZUC 1JYXA 3LKQA 3NIFE 4BZ1L 5IVXE 1CLZL 4V1DB 3SE9L 3JXAA 3WFEH 2ZUYA 1R3KA 3SPVB 4PJXB 3WHE0 3LIZH 1BECA 2WUCH 1ZHKB 3KYMB 4AQ1B 4Z18A 2G5RA 1OGAB 5HPMA 2WY3A 1L6ZA 2YD2A 4M9OA 1RY7B 4F7EB 5JR1L 5J6GA 3Q6GL 1TVHA 4FQ1L 5I1LA 3DO7B 3UTTD 4Y0GA 4CAGA 5SWZA 2EDRA 2QSVA 1A7OL 2JK5A 3MROB 4ZFZA 1VFBB 1IGTA 4RBPK 2OCFD 4X6FA 1H3VA 1X4ZA 4KKAD 1AXIB 5JQ6H 4D9LH 4F7CB 1LQVA 2BVOB 3RWCA 1P6AB 3L3JA 3ZKXB 1WZLA 5F96H 4FFYL 4HGMA 3RPIA 4ZOEA 3QNYA 3QUML 1U9KA 5C6TL 3R8BB 5FYLE 4Y5VC 5DD0H 5EU7E 4K3EL 5EO1A 3L6FB 5FO8A 2XTJD 5F8QC 4F9LC 3QWOA 2A73B 3PWVB 2XWBA 4RNRB 4L8DB 4WI2A 2W65B 2X4QB 5CZXC 1Y6KR 2W9EL 3EDDA 1A4KB 1AO7B 2V7NA 2ZUQB 1MREH 4P9MH 1JHTB 2N1KA 3C09B 3ULVD 4HDIB 4QNPF 2GKIA 4PGZA 2I07A 4ZAKC 1IEBA 1VGEL 3D0VB 1UB5A 4IJ3B 2XA8H 1FSKB 4JFEB 1I85A 4N1CA 5E7BA 1ZKAA 2R69H 3MOAL 4M7ZB 3V4VH 4WWKB 3JV6A 3K2UL 4FRWA 1BOYA 1JRHH 1HSAA 1QFHA 1FG2A 4OFIA 2R9HD 2X4RA 5ALCH 2J6EH 2DKUA 3HZMB 3GMRA 2J4WH 1TVHB 2R2EB 5I1EL 1NAKH 4PJCE 4HWZA 3MRIB 4YPGA 4YHIB 5FF6B 2IC2A 3WXWH 5DD3H 3U6RA 2A6JA 2PTTA 2XWJA 1MEXL 1MH5A 4FQXB 4QTHB 2APBA 1F3JB 3LS5L 2C9AA 1U3HA 4OCWH 4JRXD 1J7VR 3D69A 4QTIH 4BSVB 4MNQD 4HIXL 4F7TB 1AC6A 2OTWB 2B20A 1QA9B 2HRLA 2Y5EA 2KKQA 3HZVA 1FH5L 1GC1L 3QNZB 5KVDL 2IBZX 3QDJB 1FORL 1T89C 1FGNH 2W92A 4H5SB 4J4PC 3QO0A 3QHFH 1GHFL 1T1XB 4HZAA 2FL5A 3BXNB 4CKVX 3TH4T 3O9WA 2BCKB 3UROR 4MA1C 4DW2L 3SCMA 5IHBA 4G8FA 2CDEB 2H26A 3LHPH 1JWUB 4K23L 3DOSA 1J1XH 1H8OA 4UTAL 2DL9A 1DBAH 2H32A 4YEFA 5GPRA 1JYNA 4ZFZB 3S3SA 4M00A 1NBZA 5EBLB 3VXMD 1TVBA 2J5LB 4MNQB 3VG9C 5E5MB 2V2TA 4DKFH 2CGRL 3N1GC 4X80L 1RZ8B 3KPNB 4ZYKA 2KUTA 4X8JA 5HVHB 3RKDC 4JO3H 5H2BA 3QCTL 5DD1L 5IFHH 2V5RA 4H20L 1G0XA 3RVVC 2WP3T 3T0VA 3N0PB 4WEUD 2PCPA 3H3PL 1QFWL 5IJVB 3O2DA 1BQHG 3RWIA 1HZHH 4TVPH 4YHKL 3IKKA 5KVEL 1NAML 1H8NA 3HZYA 4BH7B 1H5BC 2DI8A 4H88H 5D2LF 43CAA 3UMTA 2AP2A 3EHBC 3M8OL 3TA3A 3BDBA 3N85H 5IB3B 3SDCD 5CUSL 4TPRL 1Z0MA 1OTTD 1DCLA 1XCQA 4YH6A 2GY5A 1T5XB 5T5NG 4XH2B 1PYWA 1Q1JL 2PW2B 3D25B 5C0ND 2G2RB 3L5WA 3NCJH 4XP5H 1FBIL 4KDVA 5IW6B 1I85C 1RJYA 5KOVC 3WUWA 3ARUA 2XICA 3HI6L 4JDVB 3JWOL 2GAZB 3E8UH 5H37G 4HLJA 5KS9B 3VXUD 4PGBA 3VGHA 5T1KA 3KPMB 4QHNA 5FYLH 4BSWA 5DSCA 1CXKA 3QPQD 3T8XB 1IQWL 5HGDB 4G6JH 5TPWL 4RZCA 3I3EA 3GUTA 5HDQH 3MV01 1WSST 2H1PL 5AZ2L 3SDXE 1DANT 5GGVH 3HE6C 5BQ7B 3V52H 4UDUB 1RJZB 3IFLH 5I8OH 4KAQL 1DUYA 1JP5A 1LO2L 1L7IL 5EFIA 4M1GL 1LE5B 1ES0A 2ARJA 2B0SH 2JJUA 5D1XB 4JY5H 2B4CH 1MHHA 5DRZA 7CGTA 5EBGA 2BNUB 1A0QH 2EYTA 1U92A 4X6CA 2F5AH 5CD5C 3RWHB 1PKQB 5C09A 3QQ4B 5K93A 3ZT5A 2RQ8A 5DUBB 3L3DB 2UWEF 1TTGA 1N7MH 4ZYKB 4U6YB 4XC1H 4C56D 1NSNL 4MA3A 1UYWL 5HGBB 5C0GA 1OM3H 4U1JA 1RZ7H 2OQJA 3MX0A 4WU5A 5MEPB 5HYJE 1C5BH 1X5LA 4LSPH 4FFVC 5D1XD 2D9CA 1CTNA 4Z7VB 4O4YH 2FLBT 5CEZE 5I19L 4JDVA 5DD5H 2ZG1A 3VJ6A 4HIIB 4G9FA 2NY4B 5JDJA 4LHUG 1EHXA 5IV2A 1RVFH 5JHDA 1VPOH 3U4AA 2KH2B 3ZSSA 3G6JF 1AGEA 4KY1H 4OV6F 4HLZG 1HN1A 3LQZB 5E8EB 1A4KA 1VB9A 3I2CL 5JIKA 1KCGC 3VXSA 5GGSY 3MRKA 1EVUA 4QTHA 2VNCA 4LLDA 2DI9A 3U1SL 5E08H 1WCQA 3OKEB 2APXA 3VXRD 4K8RL 4ZOBA 1MRCH 3MRLB 2BRRL 3P2TA 3G5YA 1YJDC 1G9NH 3KR3H 2HFFB 3VFSA 4KI5E 3I6KA 3TN0D 3UDWA 1C1EL 2NY3D 1S9YB 3BPOC 4DTGH 1JYVA 4GKOA 5B3JE 2AV7B 5C8JB 3PDOB 2QADD 2CLZB 1KEML 4L4TB 1Y0LA 3FMGH 1YN6A 2QSCH 4PJHB 1S9WA 5DMJB 1IM9D 3WSQL 2ZOKA 5D1ZD 5KVGH 4EOWL 2OM5A 3E6HB 4MWFB 1ITBB 3RL1A 5ALBH 2GJ6E 3MLVH 4MNQA 2FIKB 1VA9A 4TVPE 2G60L 1XF4A 2CUMA 3V9FA 2VLKB 3VFVB 4MCZA 1N8ZA 2P47B 2IAMD 2VXTH 4HD9A 5SWSA 1UB6B 4OUUA 3UZVB 4TTDD 4PR5A 3QO0B 3T1WA 4Q2ZA 2IAMA 3JWDL 1DEDA 3O4OB 4PJEF 3QUXD 1QQDA 3WXVH 3RZCC 4ONHA 4CVWA 4QY8B 3MACL 4HS8L 1CL7I 3VI4E 1NGWB 1YNKH 2GTWB 3DBXB 3RRQA 1MUJB 5I8CA 2BSRA 4O2EB 3NAAL 1YYMH 1UM5H 1NDMA 4FXLA 2NLJA 3TVMC 2B5IB 1PZ5A 4N8PA 1WVZA 3C5ZC 2AQ1A 4R97B 5T1MB 5L7XH 3MJ9H 2EH8H 2VIRB 3CSBA 4JRWA 3B5GA 3HE6B 5IHZA 5D71L 1FL3B 1JWMB 2Q6WA 2XG4A 1T6WA 1MLCA 2DIJA 2H32H 3UTQA 3O8XB 1A7PL 5KVFL 3V6OA 3VFNB 4KJYB 2R1XB 3BKJH 3EKCA 5DO2C 4F7MA 4JAMA 1KB5A 2ZPKH 1IQDA 3BH8A 1SM3H 5EIVA 3VG9B 3DSNA 3GUTB 4JRYB 1F4XH 2R4SH 5C2BL 1JPGB 4FTVA 1JZ8A 5EU6E 1KELH 2GT9A 5LBSH 3MV7A 1KB9K 4Y4HC 2DQHL 4LNRB 2Y1VA 1BHGA 2IALB 1S9WB 3ARED 1IEHA 2J8UA 1XIWB 4LSSL 4GKSB 3S36H 3U7AA 1Z3GH 2E7LC 2UZYB 5J9PB 3CZJA 1QSEA 5KSVB 3G6JA 5TH2B 2AEPL 3GBMH 3MLWL 3U48A 3Q3GA 5E2VL 3GRWA 4XPGH 3SDCC 2ZUUA 5C2UB 2ICCA 1E6JL 4EXPX 4I13B 3CU7A 5IMLB 1WC7B 3KHOA 4NKDA 5C7XL 5CJXA 1S3KH 3KS0H 2CRZA 4OFYA 1CG9B 5MENE 3L7FA 2VSDA 2R0WH 4W81A 2NW3A 3VA6A 2VL5A 5JTWA 2IPTH 1FVDB 4KMTH 1J1OH 43C9B 5A1AA 1N6QL 2R1XA 3OR7B 4GRMA 5E5RB 5SWQB 4U7SA 3V6OC 1IL1A 4FZ8H 4N8CH 3SDAB 4UOW1 4G8EB 1U8OA 2R56L 5GRJH 3CX2A 3PE9A 5DGQA 2ADJA 3U4EA 4AH2A 5HHOE 3L3DA 3M45A 5IB3A 4LCWD 2CRMA 3B2UD 5MHSE 4Y19E 2RR3A 4ALAH 1JGDB 1NDGB 4C83B 3K80A 4S10A 5ILTH 1R3LA 3OB8A 1QR1B 1KOAA 3FQXA 2XZCH 2ICES 2NXYD 3RVTC 2VZVA 3OMZA 4HJ0C 5GS2H 4LGRB 4OLEA 2F54E 3ZKND 3ALXA 1IC7H 5D7SH 2EDKA 4OCYH 3TFKD 4AIZB 2APTA 4EUPA 1VFUA 3MV8A 1ZLSH 2JIXA 4LLVA 1HWGB 4HS6B 5I1IH 2YEZB 3HFMH 4FQCL 3DXAB 3MRNB 1MVUA 5GJTL 1OTUD 3MO1A 2QSQA 4XPFH 3GO1H 2NW2B 3VXNB 2A77H 1FNLA 4QRTB 2HT4C 5CEZL 1OHQA 4HMDA 3T0AA 4E0RA 3KYOA 4NRXA 5J1AB 3U30B 4X83A 3I75A 3IAPA 4D8PA 3UBXI 4PTUB 4WFHD 5CJQL 5D1QA 2X42A 3C5JB 1FYTE 5IF0B 4QXTB 3KAAA 5T3XL 1QP1A 4K55A 4KRPD 5FM5M 4PRHB 2VQTA 4L3EE 3L5WB 3QCVH 1N59B 1YA5A 2YA2A 3MRCB 2RHEA 4N5EA 1SJXA 3TIEB 2ENSA 4M62H 1JZ6A 5ITFB 3HNTH 4WV1B 1HQRA 1OF2B 2IQ9H 4ODVL 4FA8A 4YWGL 4R4ND 1XF4B 3VGGA 3C08L 2LU7A 3ILPB 4HV8B 1WAAE 3BPCA 2BMKA 5BRZB 4EI6A 3KPLB 1PG7W 4P5MA 2BNQD 4DKDC 3R1GL 3K8MA 2EDYA 4FTVD 2JF1A 3AU1B 4D9RD 2WW8A 4P48A 4O2FA 4OFDA 4XPBL 3LKOA 3F58H 3H7LA 2MMXA 1MCKA 3QFJE 4N90D 5B38G 5I76B 5KG9A 1U8PA 2DM7A 2ILLA 4JDZB 4P2OA 5GZOD 1P7HL 1VKXB 3MREB 1JFMA 4YHZH 2EIBA 5LJYH 1GAFL 5IB1A 3MLTA 4LCIL 2Z8RA 3TPKA 2ZJSL 1RULL 5C0FB 1RULH 5D7JA 4WUKL 5EOQL 1XGQA 5C0RL 4XVJL 4EQ3A 4AIXA 1NGXA 2X70B 1AGFA 2A74A 1RIHL 2OSLB 1RFDH 3QUYB 4K7PL 5BXFB 3MFGB 4PJFE 3ARDA 5DUPL 4HWEH 3WIHA 2AK1H 1KIRA 1B6UA 3H9SE 4EBQH 5ADOH 3T3ME 4DKEH 3LQAL 3DROB 1FQ9C 4M48L 4Y2DB 5GRUL 3OJ2C 2EYSB 2CK2A 3MCLL 4LEOB 4OM1L 4OIAA 1GZPA 3O6MH 1Z5LB 4FQ2L 4CN4A 2BXYA 5EUOA 1ZXQA 5C08B 2MKWA 3NH7L 4UDTB 5GJSH 5HYSA 3TJHA 3BD4A 2NY4D 3QR2A 2HVKB 5DQDH 1QLFA 3W0WE 3CFKB 1Q38A 3ARTA 4OJFL 5GISH 1BZ7A 4YHYB 4G6ML 4DN4L 1J1PL 2OL3H 2X89D 4F2MA 4DN3H 4IMKC 3K46A 1FSKC 5F7DA 4RAVA 5C07E 3UEZA 5L6YL 1SY6H 2NY2C 1KGCD 4OFKA 5SWSB 1JRHI 1LO0H 3VI3E 1IM9A 4TRPL 4J1UB 3QI9D 1U93A 4GKZA 4PJIA 5D7JD 1OW0A 3UJJH 4OLXH 1C08B 4CVXB 1I8IB 1HINL 3DI3B 5BRZA 1D5IH 3MRHA 3EZJB 1RUKH 4IHOB 1U8JB 3IS0X 1KNOB 4P2OD 4V3DB 3T0DA 3DVFA 4U7MA 1CICB 2V5YA 5IR1A 3V5KB 4X8XA 1CZ8L 2AGJL 3DGGB 4WO4A 1MY5A 4FFZH 1UXSA 1TQCC 3TNNA 3MA9L 1KACB 5IFJB 1S7QA 4P5TC 4KK6D 2HFEB 4F7PB 1MFCL 3ISWA 1WFOA 5I1KL 3O3AB 4PRAB 1K4DB 1NGPL 4L4VD 5JIIA 5IESH 3I75B 2CKBH 1AJ7H 1J8HB 1V7MH 1IKFL 3HLAB 4N5ED 1UH2A 5DJDB 5DJ8B 3TO4A 1SBSL 4FFWC 4LARL 1U8MA 5C6WH 1SJHB 4HKJA 4N8CL 4JHWL 4G43A 3VG0L 2XWTA 7FABH 2XFXA 2XN9D 3TPUB 3MO1B 5IHUL 3STLA 4ZFGL 5I2IA 4WTXA 2CK0L 3GMQB 1MY7A 4U6XA 3RDTD 3U0WL 2G75B 4AL8H 4JFZL 3DYOA 3SQOL 4U7KA 1ZMYA 2HTKD 5MENB 5A2IH 1LQSR 2J3SA 2X40A 3F7VB 5T1DH 4Z6AT 4P3WA 5JUEH 4CVXA 3G6JB 4Z0BL 3WS6A 4CMMA 3U30C 4QF1A 4XPGL 3BP4B 4JANA 5TE7L 2IAND 3OKNB 3MRCA 4XVSH 3MRBA 5HHVL 1FNGB 3DPBA 3RUGB 3NCMA 1BREA 1F6AA 2AJYL 3V7MA 3JBG7 1Z3GL 3QUXC 4O02H 5ISZA 5I8EA 5DVLA 2R8SL 3VMNA 1EUUA 5IVXB 4KHTL 1FVCB 2A6DB 1T4KB 1GCFA 5IEHA 2FWOB 3EJYC 4PG9B 3G04B 4I2XE 4WW2B 3FO9B 4UB0L 5TQ2H 1CLCA 2E7MA 4DCQB 4Y1AA 4QEGA 3RVVD 3BP5B 4G8EA 4YK4B 5KSBF 1I1CA 1F11A 4JY4A 4XMPL 5BO1L 3C6LD 2FL5B 3BXNA 3MRQA 4GAJL 5IVZA 1BD2A 4BSJA 2CRIA 4XVUD 5HHXH 3VWJB 1OAYL 4M8VA 4V1DA 5GXBB 3MRPA 4PRID 1I1RA 1P84J 3MR9A 1ZVSB 1OP3K 3KJ4B 4ELMB 5E6ID 2GEEA 1FZJA 1PKQE 2HA1A 1KCVL 1M6OA 3KPRD 3P4OB 3EUUA 2N7AA 3T8XA 2EYRA 3BPCB 4G5ZH 5DRXA 5GIRB 3RIFF 2ICWJ 4ZSOE 1Q94A 4KQ4L 3ZYJA 4KQ4H 3GMMB 1VADB 5DJ2B 1Q72H 2WBKA 3FRPG 3JTSA 4JFDD 5T1LD 3MV9E 3G5VB 3HI5L 3IVKA 4S1QL 5EWIH 1CXIA 4ZDHA 5IW6A 1A02N 3TT1L 4JM4L 4R90H 3EAKA 2DKSA 2F54A 1T0MA 4H0IA 4NQDD 2X05A 3JV6B 5D7IE 4RMQA 4LCYB 2CKNA 2FO1A 5DVOA 3EO1B 1LDPH 5IW3A 1H15A 3DVNB 4UOW0 3C9NB 3S37L 3B9AA 3JUZA 5GHWH 5DYOB 2VUYA 3BO8A 2FEEL 3T0EB 5I17B 1JF1A 1T5XA 5HHNB 3FO0H 4NUGL 3TZVD 2ZKHH 2E7HA 3A67L 5E1HB 4AQOA 1F4WH 5BV7B 1BVLB 1T1XA 1MFEH 3H6JA 1UCTA 2NYYC 4L1DA 3MMEB 3OR6B 2AS5M 5EN2A 3VXMA 5FYKH 1RFDL 2P46B 4DK3A 5D9SB 3MLVL 4ZXBB 2OZ4A 4ELMA 4DGVH 3HZVB 1RUAL 2P48B 2ATKA 4PJ9D 2CR6A 4GXUM 1GVIA 1MF2H 2BSSB 4N0FB 5EOQH 3EOTH 5C0AB 3F6IA 5D93B 1T1ZB 2FGWL 4O9HH 4WY7H 4PRPA 4Z0BH 5IBLD 3TT3H 1AHWB 1ZT1A 4WW1A 3ZE1F 3LEVL 5JW3L 2DWEB 1NEZA 3CFKA 1QFOA 2KZWA 4TUKL 2VXQL 1QYGH 5DDHA 1R3HA 3LKPB 1D3CA 3MUGA 5D6DA 3TN0C 3ARYA 3K8KA 3MREA 3BGFB 1RJLB 5JZ7D 3O6FA 4M1DH 3NFSH 1ZA6A 1G9EA 4LSTL 4PY8I 4Y5XC 4XXCC 4MA7L 4UT6L 5DMIH 5C0AD 3DETD 3FB6A 4YWGH 5F1NB 1A3QA 1D5XA 5IFAH 4OM0H 3S34L 2CKBL 4OTXL 3X17A 3VWJC 1KULA 1D6VL 1A1OB 2WINA 4XI5C 1BQHA 3PQYB 5CMAA 4XCCL 4YXKL 3AMLA 1BD2E 2VITA 1OPGL 2EH7H 3FCTB 4HFUH 5FUZL 1GOHA 1BJ1J 4JVWA 2BK8A 2EXYD 4I0PB 1IGCH 4GXUN 4NZUL 2JJTA 3T65B 2Y6SD 3TNMB 5EZJB 4G8GA 1PFCA 1HXYA 4S1RL 5CBEB 5IEKB 1OW0C 2CLZA 3T0WA 5IESL 4RDQG 4OBSA 5EOCJ 3B43A 1P9MC 4MJID 1I1AA 3LQAC 4H1LA 2R2HB 3DVGA 4OIIH 2R0LH 4J3VA 5KG9B 5DF0A 4GQ9H 4U1SB 5GRWA 4LSUL 2JCCA 4OB5L 4UILH 3SBWA 3U46B 3UTTB 2AW2A 2BY3A 3P11L 1DUYB 3GSRA 2C7UA 1YC8A 4NM8L 4TNWK 5CHNB 1VDGA 3LEXA 4FABH 5IJKA 5E5UB 3CFEA 5E94B 2F53B 2B0SL 1EZVY 2GIYA 3TJHC 1T22A 1F13A 3P73B 4G7VL 5MENA 4N0UE 3P9LB 1T0PB 5J1SC 4YDKL 2Z9TA 3LDBC 4PIRF 1JHTA 1FL5A 5TQ2L 1UVQA 2KL6A 1UM6L 3CCHA 1C08A 3N9GH 5FA4A 4D3CH 4YK4C 4HKXA 2WP3O 1QBBA 1DQDL 1TETH 4PLJC 3TBWA 4F8QA 4TSCL 3JV4B 4U1KB 3SOBH 5JXAL 3B9VA 1LP9A 1CDBA 2BX5A 3HE7D 3F7RA 2F54B 1BQSA 1INQB 3GB7A 4XWOD 4OJFH 5EZJA 4I77H 1P84K 2OJZL 4M6MH 4Z7UF 3UJTH 1KCRL 3JVGC 3S96B 5EPMB 1K2DA 4NPYA 3CDCA 4JG0L 2CMRH 2Y7QA 5GRVL 2HMIC 3VWKB 3W2DH 2AJSL 1S7QB 3UJIL 2C4FU 3QG7L 4HPOH 1YNLH 1X5JA 2IFFL 3IJSB 3PWNA 3G6DH 4ETYA 1T03L 3F6LA 2I26N 2LE9A 5D7KD 1N2RA 4H88L 1TJHL 5CEYA 3MLXL 2FECI 3VFNA 3WL9A 1KCUL 3GHEH 3VXMB 1MQKL 5FECB 4MA7H 4QHUB 1JWSA 1FDLH 5EU5A 3IDMB 5BRZE 3HG1E 4M6OL 2VLJD 3FN3A 1UWXK 1IM9B 4MHHI 4BQ6A 3EJYD 4XNMA 4X99B 2VDKH 3QQ3B 3CFIC 3SDYL 4H20H 3FO2A 4X5WB 4KDTC 5DYOA 4JGUA 4LPUA 2RFXB 1QRNE 4M4RA 1ROWA 3QIUA 4MD4B 3S36L 1NGPH 2VXVL 2DQTH 2XZQH 2CJUL 1I7UB 3QEUA 1FFOA 4X5XA 3U9PH 2YSSB 1PDKA 2H32B 5CP3A 4MWFA 1FDLL 3V6ZA 4R7DB 3JZ7A 4J3SA 4WIQA 4Q9QH 5I16A 4NQVB 1E6OL 2MPAL 3QIWC 2ERJB 1KFAH 2OTUB 2FH8A 3LHPL 3QP3A 3ZDXF 3GMOB 5EH1A 2WIMA 1A8JH 2V5SA 2OJEB 3S3PA 1A9EB 2UYLB 1CD1B 1A7PH 4LSUH 5IW1A 2FNBA 3BH9A 5HHMD 2DI7A 3KLHD 3FO0L 1CG9A 3RHWF 1D5ZB 3OG6B 4ODVH 4FHBD 2PO6B 4MJ6B 5HVFB 3OKEA 4L8BA 4KKAC 5GS0H 4TUJB 5CJOH 4BKLA 1G7QA 4HGWB 4YHPA 1CD8A 5E6IC 3P4NB 4X9BA 1RZFH 2NXYC 1I7RA 2APFA 4FP8L 4X9FA 4X7FC 2UVFA 4YHML 4U4BA 4JVPA 4LL9A 4NZUH 4UQ3B 4YDKH 3MBEC 3ZT6A 1N0XL 5FFLA 3MUZ1 5DRWA 1IGIL 1X9QA 5KN5B 1INDH 5L9DL 2PF6A 5DJ0A 3I85A 1NAMA 1B2WH 1UWEH 2IQAA 2R69L 2HJFA 1V7NL 4RFOH 5I16B 2JJWA 2A1WH 3H3KA 4RBPH 3EFFB 4M7JH 2V9QA 1AD0B 4ALAL 4X5LA 4M1DL 1FV1A 1I1YA 5I75B 3WIFA 1MCDA 3CK0H 5DMGC 4NKMB 5C0EB 4IMLB 4BQ9A 4AT6B 4Y5YB 4NN6C 4A2LA 4LLVB 2LVEA 3MZGB 4HJGB 4IIQA 1BIIA 2VDKL 1FC2D 1FLRH 4PTTA 3RAJL 4XMPH 4U2ZA 2YN5A 2X1PA 5DA0B 3JWDC 2LAGB 1I9RH 4NQED 1LGVA 1NFDF 4C83A 4G9FE 5F96L 4UB0H 3T0EC 4Y5VB 3EJJX 5A2FA 1HHKB 1IM3A 2VRAA 2VQUA 4KHTH 4XP4L 3RI5K 5L2KA 3S96A 3TYGL 3KYOB 2VKWA 1Z2KA 3ARFB 3RGVD 5J12B 2OBGA 2PYED 4AL8L 2YPLD 3SDYH 2F74A 1CR9H 1MLBA 3FZUD 5BS0D 5CJ8A 2DL2A 4NM4L 4LLYA 4Q6IB 3RWFB 4UT6H 5DMIL 3WUZA 1T2QH 3RUGF 1KG0A 1F4WL 5KN5A 5KSBA 3U1SH 2VH5L 4P23B 1VFBA 4EJ1C 1MCBA 2VXSL 4XPAH 2XN9A 5HD8D 3LN9A 2YEZA 2A9NL 3CJJA 3MLXH 2Z35B 4JHAL 3BP7A 5HHQB 3TNNB 2VTFA 5TQ0L 4S1SH 1MI5A 4LSSH 5I18L 4EIZC 4KUZH 1EGJL 1JGUL 3SKJH 4ZUSA 3LEVH 1IVLA 2YPVL 4UAOB 3IGAB 2IPKB 2Z93B 3QDHA 3QG7H 3KPLA 3Q48A 4TNWF 2EIEA 3BUTA 4LVEA 4MLSA 1PBYA 1FE8H 3MA9H 1ZLVK 3V5DA 1MCWM 1FYTB 4KJWC 4ENEC 1DQTA 3T0EE 1DE4B 1WF5A 3FT4B 3DLQR 3BZ4A 3BO8B 4YDJA 5FGSA 4GBXB 5EORH 3KYNB 4RGND 3B9DA 3VFGL 1AFVH 4PGDA 4S1QH 4ESKA 2D03L 4DGVL 4RAHA 3PWLB 1V3KA 1H3GA 3GSVA 4XC3H 4BFBD 4JFOB 4JY6A 3IB4A 2BZDA 1DQMH 4WU7B 3AS1A 3BT2H 5CCKH 3KPTA 3CC5A 1HINH 1TNNA 2DMBA 4UILL 3G08B 4JQXA 1OAXH 3BDYH 2VLRA 3JWOC 3PGDA 2J7LA 1TIUA 4NUGH 5JQHC 2YMXL 3A6BH 1J0IA 3ZKQD 2EECA 5JLZA 1A1MA 5J6GB 1KENL 2AGJH 2VE6B 1RIVH 1G6VK 2LFGA 5LQBH 3F8UB 4PD4K 4MJIA 3MGAA 3DHMA 1I8LA 3AM8A 1AHWA 2J2ZA 1J1PH 2LVCA 1FFOB 3PNWB 4YFDB 1IGIH 2X10A 5FK9A 2ED8A 2LAAA 3TCXA 3L7FB 3OKMA 3FT3B 4HMCA 5C0DA 3NFNB 1YUHA 1UJ3C 5DRNA 4QGTA 3F5WB 1OAXL 3BDYL 1KEGH 1WTLA 1I4FA 4OIIL 1JPFA 1CBVL 1IQWH 4G8IB 4OGYH 3HS0A 1YYLH 4NO0B 4PRDB 2AQ2A 4P4KA 2QKIB 5HYJD 3JWDH 3MRRB 4C4KO 1U93B 4XC3L 5DK3A 2GCYA 4LAQH 4WGWB 1DANU 5FYJE 4LMQE 4HWBA 2P5WE 4NRXB 5J1AA 3VXSE 4ELKA 1T3FB 4XP5L 1Q9WA 1PQZB 5BJTA 1BGXH 4CADA 1FE8L 4MXVE 4X6CF 1YN7B 3L3HB 1M7DA 5EIIA 2XNAB 2DYPB 1JWUA 4NRYB 3S34H 4MXQD 3KXFB 4XP4H 3CFBB 3GMLB 1RZIB 5JMOC 1WLHA 2HRPL 3O45A 3UAJD 3X14A 3GSQA 2ZJSH 1N6VA 3UYPA 3HKFA 1D9KC 3IVKB 3ARDD 3C6LB 5ECJE 5FCSH 5FUCC 3T3PE 4KI5D 4NM4H 2VLRE 3NABL 1P7KA 4NWUL 3RGVA 4PJ9A 1T7YA 4ZG1A 4HMEA 1OF2A 1A6TA 4OZ4A 4FQHA 1CXFA 3MOQA 5FGRA 4QWWC 4PGCB 3FQUB 5SWZD 3VDCA 2A6KA 1X3DA 3DMMD 1II4E 4MJ5B 1JHKH 2R2BB 3NOIA 4JREC 3SDDC 3EOTL 1YMHA 4ODSL 2ZUSA 4NZRH 4LBEA 1IGML 3KNBA 5I17A 3T0EA 1IFHH 2Q8AL 3VD3A 5DJ8A 1Z9SA 3DIFA 1DBAL 1EAJA 3HB3D 4K23H 3RKDD 4JFZH 5DHXB 1OWWA 3MLTB 3EJZD 1T1WB 4UTBH 5D96B 4IIQC 5JW4M 5DD5L 3WBDA 4HPYH 4O51A 2F19L 4P2QD 2D7TH 2W0FB 4R4FH 4R4BA 4PBXA 5ACZB 4L3CB 4LCCA 1NLBL 1YEEL 4KFZC 4C56B 2E8ZA 5TFSH 4JFHD 4PV9A 1NBYB 5ENWA 3GI8L 1J8HE 3LH2H 3BAEH 2PYFB 2VZOA 2A6IB 2IJ0C 5CJOL 1CFNB 4XRCA 1HSBB 1PKOA 3IDIA 2P45B 2OJEA 5K59E 4NO3A 1G7LB 3FJTA 2QQNL 4KHXL 3HC0A 4XHJC 1IILE 1XF5A 5DJYB 3NH7H 5GJSL 4LLQB 3CAFA 2OL3B 1TJGH 3ESUF 3VGEA 3MR9B 5F7DB 1YY8B 3FRUA 3L3OA 4X6DF 1J0JA 4XX1G 3PWUA 1E4KA 3BYYA 3LAFA 5GRVK 1UYWH 4KI1A 2FJHB 5D7LD 2NXZD 4KJPD 1JZ4A 1AKJD 4JM2D 5GS0L 4PLKD 5GGVL 1QLFB 3IKCA 3LQAH 2EYTB 4FQCH 5E6IA 2P5WA 4NWTL 2AK1L 5EBMA 1NKRA 1XF3A 3GM8A 3ARBD 5HI5D 3O9WB 1JGVL 5ICZA 3C8HA 1CK0H 1JNLH 4NUJA 1P2CA 2EE9A 4U31A 2OLDA 5C0IA 1KJ2L 3S8WA 5EU6D 4FXKA 1PG7H 3DX8A 3VW3L 5DMGD 4APQB 4OAWB 1SY6A 1UXSB 5EUKA 5D6CB 3VFOB 1YZZA 3QIWA 5DJZB 3TWCH 5EC2A 4PS4L 4KZDH 2CKBB 1CXLA 1CICA 4JR9H 1OAKH 4ONOA 4IOIB 5KW9L 2YD5A 2VXVH