3MRQA

Crystal structure of mhc class i hla-a2 molecule complexed with melan-a mart1 decapeptide variant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Crystal Structure of MHC class I HLA-A2 molecule complexed with Melan-A MART1 decapeptide variant
rcsb
source organism Homo sapiens
total genus 77
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mrqA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mrqA01
4UOJA 1NGQL 4PPTA 4DN3L 4I3RL 3ZTNH 5GJTH 2NW2A 3VI3E 4JG1H 3TZVB 2Z8WC 2BNQA 1KYOJ 4L4VD 4QRUB 5JXAL 4XPTH 5D1XC 1CICC 5ICYA 3HE6B 4M7LH 1JHTA 1N64H 4JPWL 2CR6A 3WFZA 1S5IH 2C1PB 3TH3T 2O5YL 4M48L 5DRXB 1PLGH 1U8KB 3PP3K 1NEUA 1DQQA 4NO2A 1RZJC 4Y2DB 4YBHA 1QYGL 4I4WA 4X4MA 4PJXF 5MEQB 4DAGH 4KC3B 2NXYD 3ARFA 3LPGA 1HHHA 1LEGB 1T5XB 1QLRB 2DJUA 4YDIH 4YDVB 2J5LC 3IT8D 2MCG1 1NLBH 1N59B 4CDGC 1JZ5A 3V6ZA 4XGZB 4MMXC 1QFHA 2HJLA 2M1KA 2ZKHH 3MV9B 4KQ3L 3QHFL 5J56B 1HHKB 4KUCF 3V6FA 4NOFA 1ZLVK 2HFGL 4XP6L 4CKVX 1ZK9A 3O2DH 1IGTA 1LO2L 3KHOA 2D4FA 1A6AB 2E8YA 3RKDC 3MV9E 5KSUB 4PTUA 4ZSOA 2X1PA 4NN7C 5ADOH 1DUZB 3WIHL 4HIJA 4KI1A 1RUKH 1J1XL 3OZ9H 4IIQA 2FIKA 4WO4A 2NY6D 1EIBA 4FFZL 3OKKB 2X89D 4Z95L 1F4YH 5KSAD 1CL7L 4HLZG 1ZA3B 4R8WH 1LK3L 4HT1L 1J9CT 4XHJD 3B6SB 3MXVL 5DEFB 1J5OL 4M62H 2NXZD 1OAQL 5DEZA 5CJOH 5HDBE 3WFDH 3NH7L 5LGHH 1J0JA 1NL0L 3MSPA 4FFVC 2OTWB 1ZT4B 3JWDC 4P0DA 3QWQB 1I1AC 3ALWA 1ORSB 4NRZB 2UV3A 2WUBH 4K23H 4XC1H 3GMRA 3QZWA 4IRSC 3DI2B 4RFNB 3Q3GA 5T5NF 3DMMB 3GBMH 1NFIB 1T3FB 3EYFB 5C0DB 4LEOB 3NTCL 1AGDB 1G7MA 2XQYK 1TNMA 2QR0A 3D9AL 2O5XL 2C4FU 2XQYG 2R1YB 4W6XB 1A6VL 2W38A 4HZLA 4WI8A 1ZS8B 3TA3C 4ZMAT 4OI7A 5AUMB 4N68A 3CFCH 2V7HB 1IEAB 4YEFA 5CEYA 4UINH 5LG1A 3BN3B 2CUIA 4G80A 4HIXL 4ZUSB 2EE6A 4Y19A 4LCWB 1HWHB 4XNUL 5DA4A 3AUVA 3QJFB 4I5BB 4LLDB 3EGSA 4MQ7B 2CRZA 3MREB 4CW1B 3QUKA 1MCLA 2VC2L 4OCSL 1IQDA 3EBAA 1RK1A 4LCWE 4J3TA 4L5FH 1W72B 4Q9QL 1KJVB 32C2A 3F65A 4OD3H 4GS7C 4AL8L 1B0WA 1IAIM 2C3VA 2ARJQ 3D69B 3P4MA 3SQBA 3VFWB 5C9JB 4Q7DA 5BRZA 4MD4A 4U1HA 4YXKL 2J1KA 3VWJA 1K3IA 1W72L 4M7KL 4M7ZB 4UAOC 1LP9B 2J88H 3D0VA 1KENL 5I74C 3BESR 3CXHJ 4NQXA 4ZUUB 3AFLA 4KKCC 3O4LB 3BSZL 1I4FA 3DVGA 2V2XB 4RCAA 2EDBA 4EBQL 1LP9E 1PD6A 3IFPB 3QXAA 3CFEB 5A1AA 5E70A 1I7ZB 4ZD3H 1JNJA 3O4LE 2XPGB 4PFEA 3NCFB 4X8JB 3W39A 1IGJB 1A4KB 2DQGL 3OG4B 4L1DA 3DHMA 2PXYD 1DE4B 4MLSA 3L1OH 3U7WH 1OPGL 4APQD 2PKDA 2ZSVA 2DTMH 4WUUD 3MBEA 3MJ8B 3C60A 4KDTC 4RQQA 4HV8A 4N8VG 1KLGA 1NBQA 5J1AA 5BOPA 1G9NC 3O6ML 1AQKH 3KYOA 5MEND 3VW3H 3JZ7A 4A6YA 5B4MC 4HK0B 2BY1A 1OCWH 4IOFC 4PP2A 3TYFB 1JHLL 2QHLA 1HIMH 4XNZC 4HS6B 4KRPB 1KB9K 4PP1D 8FABB 4KVCL 4P57B 2GJJA 4M7JH 3ME0A 4NJ9L 5E03A 3TIEA 2ZJSL 3BGAA 5F93C 4WHTB 3MODH 2WSKA 1UJ3A 4AK1A 1ROWA 4YBQC 5D1QA 2A0LC 2A9MH 2QSVA 1NCDL 3I6KB 4Q0XL 5C09D 3VD3A 3LMJH 3U0TB 3MA7A 1IMHC 3QP3A 2FD6H 1DDHA 1SJEA 1PFCA 1K8DB 5F3BB 4HCRA 4QTIL 4LKXB 4EQ3A 3PXHA 4LRNL 3ZSTA 1K4CB 4WTZA 1TVHA 3O11B 2CLVA 4NKIL 5JZ7D 4MZ3A 3GMPA 4RISL 1P2CA 4RFOL 2B5IC 1CG9A 3UC0L 5ADPH 2EC9T 3WUWA 5EA0L 5IGXH 1HI6B 5HHQB 1DCLA 4DKFH 5H2BB 1CZ8L 2DS4A 1T0NA 3QI9A 2B1HL 1P7HL 4GRLA 3TJHC 1F4HA 1MCPL 3EO9H 4LAQH 5ICZA 2Z92B 4MXVF 2YRLA 2X70A 1Q9OB 4OBRA 3TNNA 1ZVSB 4F8TA 1RZ8A 3KYKH 4JHWL 4UNUA 4MDIA 1GIGL 2ARJB 1AXTL 1CT8B 3FO9A 4K3DH 2N4IA 1T5WB 5DK2A 4HWBA 4NQCB 4LSRL 3UJIL 4M5ZL 2VUYA 4ZNCD 3ZYOA 2AI0L 3FT2B 4HG4K 2R0ZL 2VDMH 3HUJF 1Y0LB 4R4NC 2VMFA 1X4XA 2Y36H 4NQCE 5JHLH 4XP9H 1LHZA 1VSCA 5E8DH 1NCNA 1JE6A 1NEZA 1N0XL 4DKEL 4GXVH 2FJGA 3CSYA 3SGJC 3R0MA 1TMCA 5FF6B 1A0QL 3QUYC 4PJHB 4PJ9A 3FO2B 5DJ6A 1U8MA 5HXMA 4KGLA 3I50L 2VKXA 3MBXH 4H0HB 4L9LA 4PDCE 1B0GA 2Y06H 3QH3B 3LHPL 2VLKD 2Y5TA 3VXNB 1C1EH 1MOEA 4HC1L 5GGQL 5BO1L 1MLCA 2BNQB 2IBBA 4Y1AA 5EC1A 3DGGA 4PJHE 2Q8AH 1I8KA 1YDPB 4POUB 3SGKA 1JHTB 5HJ3A 2AS5M 1B4JL 4OSUH 3JWOL 1KCSH 2BNQE 1MWAB 1SJXA 1DQQB 5CINH 3HR5A 2N7AA 3RNQB 3FN9A 3DVFA 3SQOL 3N1GC 4X6FA 5IIEB 4X9GA 3ARFB 2WAHA 3MRQA 1TETL 2YZ8A 1IAIH 3CZFB 5EIQA 4PB0H 4C83A 1RMFH 2UZIH 3W0WD 1NGWA 1H15A 3FOMA 5J57B 1MWAL 2O5ZL 2HJLB 4KJQD 4P4KC 5IQ7L 5DJYB 1YEGH 4YWGH 2WBJC 2NY2B 4L8DA 4OB5H 5D2NA 1ND0A 3VH8A 1IGTB 3EKCA 4CJ0A 1P53A 4KGJA 4BZ2H 4U3HA 1VFOA 3MLYH 5FUOH 4PTUB 1JI2A 2VAJA 4KQ4H 2DQHH 3GRWH 3GSVA 1H3XA 2IPUG 3IETB 5DC9B 4PGJA 3OTTA 4NP4H 1AKJB 1AD0A 3E6FA 2IADB 5FA4A 3DJ9A 4WO4B 3HZVA 3BP5A 2HTLC 5FYJU 4K3EL 4GRMA 3W5NA 3U7AA 3RY4A 1DBKL 3KPRD 5CD5D 2R9HC 3B9KA 4FQJH 1G7JB 1LNUA 1WVZA 2Z35A 5T1KD 2VWEC 2XN9D 4H1LA 3ARBA 1LO5A 3UPAA 1XCTB 5SX4I 1NC4A 1YPZA 4NKMA 5FCUL 2HT2D 3OB8A 4XPFH 5IHUL 3ULUE 1FL6A 1FNGA 5HY9A 1ZANH 3CVHH 3ULUL 2FX8H 3FZUD 1G7MB 5DHYA 2QR0B 5DO2C 3MLUH 4H0IA 5GS1C 4HZLB 1EGJL 2XZCH 3KDMA 1LO4H 1PEWA 4JFQB 3FN3A 1F97A 3L3JA 4ALAH 3O2VL 4S2SB 5ID0A 4JHAH 1CYGA 2H32A 2FRGP 3GIVA 2Z31D 3WKNA 4I18A 2F58H 3UZEA 5FYKU 4R7NB 4PBWD 4U6YA 1S9XA 3F6LA 3QEGH 4FMFA 4K8RD 1F11A 1G9NH 1CGSL 4U3XA 3QUKB 3DV6A 1ACYL 3FHQA 4TQEH 2NX5D 4OZFA 1YNLL 5KJRL 2YPLD 1FG9C 2ZCKH 3S37H 4OKDA 3VFRA 5DC0A 1Z6JT 4GMSH 3MRMA 4LU5L 4TULH 1E6JH 1TLKA 2C3VB 3JTSB 5IWLA 2PR4L 4KK5D 2F53D 4CMHC 4MS8D 1YEIL 4MD4B 2CRIA 4Z7NF 4JFFD 4U1HB 1A14H 1MQ8A 1QG3A 2X09A 4HHAA 4TTDC 4YHYC 4P23C 1NMAL 4X83A 3C2AH 1O7SA 2YPVH 3OMZA 3D0VB 2R15A 3H3KA 4XCCH 1P84K 2EDJA 3MJ7A 4NQXB 3TFKD 3BPLB 3UJJL 3R8BB 4KKBD 4MA8H 2OQJA 1I4FB 3RZCD 2CQVA 1JTOA 4IDLA 3RY6C 4IMKC 3RVXD 3QXAB 1HH9A 3TBVB 4P2OA 4PG9A 4YC2C 2XTJB 3BWAB 2CD0A 3U48A 3S35H 3W39B 4JGUA 4J7RA 1HYRC 1NJ9A 4LMQI 4U1SA 4DK3A 2Q7YA 3C6LD 3FMGH 1I9JL 2HA1A 4QCIA 3SE9L 3HS0A 4NDMB 4L3EA 4LDEB 2ZSVB 4X4YA 2JK5A 3MBEB 4JY5H 2XTJE 1X5GA 2FEEI 1NGPH 3CFJB 3EYUH 1KLGB 1A4JA 1WC7A 3KYOB 2JIXA 4A6YB 2H2PC 3ZKXB 4YHKL 5C0CD 3RWHA 4PP2B 4EXPX 3OPZH 1DANU 5LJYH 1Q9KB 1R5VA 4RBPH 4OV6F 1EXUB 1UACL 3F62A 3TZVC 2YK1L 3O41B 4X7FC 3V5DA 1A3LH 4F3FA 3HE6C 1JL8A 1UJ3B 2EXYC 2CPCA 4A6YL 4N0FA 1UVQA 4B5EA 4WVRA 4QXGL 1FZKA 3MA7B 1S3KH 3VFNA 3P9MA 5AZEL 1YY8B 4Y2DC 5CIPB 4HQQL 4KTDH 3T09A 3U9PL 3UTZA 4BQ8A 3V6OA 1FFRA 4YBLB 5FGCB 2CLVB 5SV4A 5F88A 2EDQA 4PR5A 3GHEH 3MTRA 3SDDA 3DHJA 5F7UA 1G9ML 1KIQA 2EE3A 4JKKA 3GI9L 3NCEB 1VCAA 4EI5D 5I17A 4HCRL 4TUKL 5FGCE 4PYGA 3PQYB 5SWSD 3LKPA 2IPKA 1JGUH 1T7ZA 2YD7A 2CIIA 4WHDA 3EOTH 2WK2A 5EU6D 4XX1G 1M6OA 3RVUC 2AJZA 4TSCL 3FO0H 2X70B 3MLRH 1Q94B 4MCZA 2BNUA 5FUZH 5ALBH 4QTHA 4OLZH 2P8LB 3PQYE 3E2HB 4V3EB 1F8TL 1MIEH 4JDVA 1QO3B 4KV5E 5ACLA 1EEZA 5HI3C 5E56A 4TTGA 4G6MH 3QSKB 3EDJA 4L3AA 1D5ZA 4B7LA 4X6BA 2XICA 2IWGA 4WFHE 1ZLSH 4LSQH 3DYPA 4KHTH 4X8XA 3LSOA 5E99H 4ZFGH 2XRAH 4ELMA 3X11A 2H2SD 5IVZB 3MC0A 4HWBL 3T0AA 4FNLH 3LIZH 3RBGA 2FJGB 3W82A 4MB3A 4X5XA 3D18A 2HMID 1F2XK 2VXSH 1U8MB 4DVBB 2YBRA 3A6BL 4RFNC 4FQXA 2IPTH 3ARDD 3DMMC 3VDCA 4D8PB 1B0GB 1HSBB 3U4EA 3MUZ1 2Y5TB 4PJ5B 1IL1A 1NCCL 1WBYA 4C57C 1A6ZA 1KGCE 5EC1B 4F7TA 5B39A 5DHVA 4KUZH 4P46D 4AJ0A 1PX4A 5C70A 1I9IL 4NKQB 4NN5C 5HJ3B 3RGHA 1D5BA 2VDLL 1FNFA 1SYVB 5EUKA 1INQB 3GB7A 4WUKL 4PJ5E 4NNXB 1OSZA 2AJ3B 2HLFD 3QG6A 4MNGA 1T0MA 4KTEH 3V0WL 3BHBA 5FECB 5JW4N 4KAQL 1G7IA 4X6FB 4HS3A 4JJHA 1MJ8H 5D7LB 2C5DC 1I8LC 3CK0H 5CLWA 3EDFA 5ESAA 4BELD 3HHRB 1FHGA 3PDOB 4TNVK 1NGWB 4IDJL 3D2UD 5J06A 2R1XA 5D7LE 1IT9H 3VG0H 4PS4L 1XF2A 2VN4A 5D2NB 1ETZB 3M17B 3LEYL 3TN0D 2QSTA 3HKFA 3KPOA 5T1LB 5IBLC 2I9LA 4M7ZC 2DDQL 4NNPH 4Z77A 1YMMB 1HINH 2DQDL 3DXAA 4ONGL 3REVA 1RHFA 2VR5A 4HF5H 5D2NE 3MLSH 3E6FB 1AD0B 5E08L 2ITDA 5IHLB 1E4XL 5DVKA 3HZVB 5I0DA 1AGBA 3BP5B 1T1YB 2FATH 4DGIL 2ZCLL 4GRMB 7FABL 5LBSL 5DD3L 1FZMA 1YMME 5EZIL 2FGWH 5HDQH 4HGKC 4H88L 1FH5L 1UB6B 5GRWA 1VENA 1NAMB 3U36A 4WEBL 3NPSB 2Z35B 4TPRH 5HBBA 2OYPA 4PRAA 4GOSA 3T2QA 4H1LB 2XNAA 3ARBB 1ES0A 1YPZB 4DQOH 3O6LH 1RUAH 3LEXB 2ED8A 3TV3L 3PWUB 1FL6B 1RFDL 5HSFA 4TNWK 4YUEL 1A7NL 1H9VA 5M7QA 3I02B 4KVNL 1A7QH 1JVKA 4OF5A 2LAAA 4LF3B 1NAML 2EH7H 1YPZE 4OBSA 5E8EA 2X89A 3ZT7A 1CK0L 1FBIL 2EKSB 2W0KA 4G6FD 1OTSD 4ZUTA 4KRPC 4O2CB 4N1HB 4D0CB 1KTDB 3IDIA 1DN2A 3GIVB 4JE4B 4I18B 4DN3H 4LLYB 1HH6A 1KEMH 4I3RH 3WEXA 2HLAB 1ZT1B 4WU5A 3VXRA 1QNZL 4FFYL 1S9XB 5JXAH 2FO4A 2VUOA 1ED3A 3EOYG 4RAHA 2E9IA 4JPWH 4PP1C 4IBLT 1PVHA 3VFSB 4MNQD 1CGWA 3B9VA 2C4FT 3VFRB 4NQSB 2RB8A 3S3PA 5EU4B 2FX9H 3PWJA 2R0KH 1OM3L 1MCDA 5JQ6H 3G6JF 1ZLUK 5BOZG 3TH2T 2XYCA 1GOHA 4NBXB 4U4BA 4OJFH 2QQLH 4I3GA 1CLOL 2KQMA 3NIFE 1CIDA 4BH8A 3WJJA 2YUWA 1QBBA 3MXWL 2APXA 3QHFH 1FCGA 3C5ZB 4RWYL 1T2QL 4RDQF 2CK0L 1VA9A 4RX4D 4XP6H 5J6GB 1AR2A 5L88H 4L9DA 1NANI 1MHHA 3B8SA 4FRWA 2Q8BL 4F37F 1HH9B 3ET9F 3BJ91 5A16A 5I15L 2YD5A 2FH8A 4P2OB 1FYTB 2J4WL 1K4DA 2DQEH 2Y4SA 4QHUB 3VXPA 3P4NA 5K9JL 2DM2A 5T3XD 4Z76B 4U1SB 1OAZL 4QCIB 2X44D 3HS0B 4XAWH 4TOYH 4L3EB 2ZWLT 1FYTE 2IC2A 1CFTA 1SQ2N 1UEMA 2JK5B 5FDWB 1IC4L 3S4SA 5LWYL 5E1AA 5E8OA 4CNIA 4F7MA 1C7SA 1WC7B 1NL0H 3U4BL 2JIXB 1F4WL 3RWHB 3QNXA 3CU1A 4ZS6D 3CDGA 1B9ZA 2X4SB 3JWOC 4YHML 2CDGB 1MI5B 1WTLA 2F5AH 4L3EE 2O93L 1E6OL 3T1WA 2BNRD 3IAGC 1NGXB 5IQ9B 3IRZA 3K1DA 4UV7H 3WLBB 3UO1L 3D9AH 1UADC 5TE4L 2VL5A 4R2GB 1BM3L 5I66B 1MI5E 2PXYA 5M94B 1FFPB 3DX9B 1XR8A 2R2EA 4APQA 2VZTA 4WUUA 1S5HA 2VXUH 2EYTB 3P9MB 3BDXA 4DW2H 1OVZA 5ANMA 1QSZA 3UDWC 5HD8D 2HJKB 1HCFX 4HIXH 4XMPL 5MENA 3T3PE 4GAFB 3UTZB 2X1OA 1NCUA 2G5BB 4FTVD 3UZVB 3UAJD 1KYOK 4XNUH 3LDBB 3ARFC 4PR5B 4HFWB 5JO5B 3SDDB 1P4LA 4YK4B 4WCYL 3IYLW 5I8EB 3NPZB 1KPUA 1EV2E 2VC2H 4OCSH 5CJ5A 3DUSB 3MRLA 1CXHA 4Y4FD 4I3SL 3UTTD 4Q9QH 3HR6A 1XCQA 1KJ2B 2GJ6D 4Y4HB 2IPKB 1IE5A 4I0PD 2P1YA 1DBBL 1OTTC 2NTSP 3U7YH 2BZDA 2NY2C 3L3IB 3B4NA 4OGXL 4PRPA 3B3IA 3ARGD 1KFAL 3OKYA 3QIUD 2ADJA 4MCZB 4TUOB 2J2ZA 3AS2A 3CUPA 4PD4J 3WSQL 4F7PB 3HI5L 4PY8I 3LKNB 3UTTB 4OLVL 1W72H 1EVTC 2P47B 1KJ2L 3BGMA 5TDNA 2E7LE 1QFUH 2Q1EA 1GOGA 4WO4C 3U83A 1F02I 4XAKD 3DV4A 3S5LA 5HHVL 2ADIA 4P5MB 4CN1A 5E2TL 3WYRA 4OCNC 3BSZH 1KPRB 3RNKA 3KR3L 3UTTE 3ULUC 4UILL 3MGOA 3LSOB 1NBYA 1YYML 5B38B 3INUL 4ODTL 1QRKA 1PG7L 1IQWL 1GGBH 3ZSSA 2HWZL 3HLAA 3QYCA 3G5VA 3FCTA 5E5MA 3CPLB 4X5XB 1AR1C 3D18B 1AD9A 3KXFA 3ARRA 5CD3B 4G42A 4HPYH 3CGTA 4BQ9A 4ZQKA 1NUDA 2DQGH 3V4UH 1RIVH 2NZ9D 4BSWA 2X4TB 2RGSA 1CDHA 3MCKB 2FIRT 3U4EB 1VEMA 5BMFH 2WNGA 1OPGH 3E8UL 4N1EA 1E4KA 1IL1B 1WBYB 5E6ID 3U0PA 5B39B 1EAPB 5DHVB 4P2QB 4NM4H 4ZUWB 3CX2A 4JFHE 3O6MH 1BEYH 3IB4A 5D70L 3BO8A 5TDPA 1T6VN 3CFBA 1JHLH 3VGBA 1LGVA 3TBSA 4YDJB 3WNOA 1T0PB 1R0AH 1M4KA 4GKZA 3JXAA 4R96A 1OAXL 4KVCH 1FDLL 4P2QE 3WJLA 1R24B 3QNZA 4YGAB 5E0QA 1CBVH 2MCPH 3SDCB 5SX4H 5DI8B 1OW0A 3U9UA 4Y0GA 4UUJA 2VLKA 5FAAA 1BMGA 2Z31C 4HIEB 5HHOB 3EIFA 4NO3A 5CJXA 3GO1H 2X4PB 1QLEL 4ETYA 5CLTA 1CFSB 2R1XB 4QTIH 3T0DA 4LRNH 1JMZA 1XZ0B 5IJKA 3NCYS 1XF2B 4NKIH 3HMXH 5TFSL 5EO1B 3T4YB 1HDMB 4RISH 5CBEA 2D31B 1QA9A 5HHOE 3DWTA 4RFOH 5K9KB 3UC0H 3V0AC 5BVJB 2X4RB 3P0GB 2XG4A 3HI1B 4NO0A 3I9GH 4J3WA 3QDMD 5EA0H 3DXAB 2J8OA 4X4ZA 4KU1A 1UM5H 4L4TD 2ITDB 3BPLC 1VB9A 3W0WA 1C8PA 5DZOA 2D7PA 3FQRA 3FL7A 3UBXA 3DXAE 4S11A 2BOBA 3LQMA 3KYMA 1KXTB 1AXTH 4IOSD 2GCYB 4Y5YB 3MLZH 1U3HD 4OT1H 4PRAB 2XTJC 4K7PH 3A67L 1NH6A 2XNAB 1YEJL 3UJIH 4LOUD 4M5ZH 5GRUL 3C8DA 3MV7D 3W9EB 1RZFL 2V5TA 4K3HA 4NUGH 4NM8L 1PAMA 5EIIB 2ADFL 1YYLL 1FVDA 3MBEC 1OY3B 4HUWB 3DO3A 5BW7C 4DKEH 5MERB 2FNBA 5HTSA 3AMLA 2WWMD 4PRHD 3ZKXC 1FVEB 2C1OA 2RQ8A 5IMOA 1B2WH 4KJYA 5FM8A 3KPRA 3ARTA 4WI3A 5L0QB 4K9EH 3AAZA 4ZUTB 3ULSB 2UY7A 1XF3A 1ORQA 5F1NB 1SEBB 5T1KA 3FB7A 4UIMA 4NYLB 3VFVB 1WJ3A 3BP7A 3LHPH 5EZLA 3FAWA 5DRZA 4HC1H 2I24N 4WU5B 1CN4A 5J3HC 3VXRB 4DTGL 4XMLL 5C08B 4WWID 1G9MC 3T0VA 4N8CH 1UFUA 1J8KA 1B4JH 1X3DA 3S36X 3G5YA 4CBPA 3DX7A 2PYED 2YA1A 3JWOH 4DGYL 2VR4A 1VKXA 3EYQD 3VXRE 5C08E 1GXEA 5I8KL 4LSSH 4YBLC 1A7RH 3BVNA 1DL7L 3SQOH 4Q6IA 5IJVB 3GSRB 3AGVA 1YEKL 2NPLX 4BFGA 3QG7H 4FFEX 3OB0H 1HKFA 1NCAL 1TETH 5MEPA 1JPST 4KROB 1MWAH 4W4OA 4DKDC 2O5ZH 4OCRH 3TVMD 3QUMA 3H9SD 2A6JB 4QRTB 2HKHH 3FRPA 2BRRL 1YQVL 4QNPE 1JF6A 2YPLA 5FGRA 3QPQD 1A6WL 2BVPA 1DQDL 3E2HC 4ELMF 3DBXA 3LN4B 1NMBL 1OTUD 5A16B 3BKML 5D9SA 3ZKSD 4AT6A 4FQLL 3VXPB 4X7SL 4MS8A 2YD8A 4JFXA 4JFFA 2GKIA 3VXMB 1PX3A 2HVKA 2OX5A 3WFBL 4EN3D 5IW6B 2DMBA 1KPVB 3ZT5A 4X6DA 3D39B 3AXLB 2J8UF 2MMXA 2E9WA 5E9DB 3TFKA 2I9TA 3NA9L 2AQ3A 2R0WH 4CNIB 2CGRL 4LCYA 3VXME 2DD8H 3LV3A 4U1KB 3IDXH 2DI7A 5BQ7B 1DBAL 3FFDB 5C0FA 5GQBA 3RZCA 1WZLA 3D39E 3OV6A 3E6HA 3P77A 5E9DE 2QQNL 4Z7VF 1CDBA 1AJ7H 4OI9A 4JRXA 4TN9A 4RDQG 4Z78B 3VI4F 5ISZD 1YQ2A 3PHOA 1JPGA 1D6VL 1EGJH 1Z0NA 1L0XA 4G9DA 4NHCH 1RI8A 1IM9D 5CGYC 2R2EB 3O2VH 3OJMB 4LRIA 1RUPH 4F2MA 1Z5LA 1OGAB 5DQDH 1CR9L 2F8XC 5I19H 4N5UA 4MQXD 5ISZB 3MRNB 5AZ2L 3WFCL 4NC0B 4DUWA 2VLJD 3V4PL 3VFUA 1U8NB 5JIHA 5DJAB 5B8CA 3HCVA 1CGSH 1P4LB 3PNWA 4RZCB 2P44B 1IEBB 1OGAE 4QEGA 4QXTB 1KPUB 1ACYH 2ZUQB 1L7IL 5ISZE 3MRLB 4FQPA 5JDSB 3NZ8B 5CWSB 1XCQB 3L3DB 3X17A 5FYLD 2Y07H 1CXIA 4KKLD 4LHUA 5KOMC 1MAKA 5D2NC 4J3VA 1CCZA 2PR4H 4PRPB 3T65A 2P43B 5CCKH 3P11L 2VYRE 1YEIH 1FAIH 3GEWB 4HS8H 3IDMA 2GSGB 4F7CA 2VB5A 3RWJA 3KNBA 1IGCL 1QPXA 4XVUD 2VN7A 1SJHA 1NMAH 4ONHA 4JPVL 2PTUA 1WAAF 2BHYA 3BGMB 5TDNB 4UQ3A 1MHPL 1FG2B 3QUZA 1JTTA 4PRPE 4LLUA 1BIHA 2MKLC 3DV4B 3E3QA 2A83B 1S7TA 4PJ8A 5KVFH 3UJJH 1MLBA 2NW3A 4EI5A 2UUDK 3RNKB 2ZOKA 1CLYL 2JLLA 1U8QA 5IOPB 3O3EA 1KIPB 3OR6B 2CLRB 3NPSC 5EU6A 2MQ3A 3PP4L 2MPAL 3ARBC 3P40A 5TQ0L 1MH5B 4ODBD 3G5VB 3FCTB 5E5MB 3ZLQC 3DX8B 3QWRD 1AD9B 3AREA 5K9OA 3KXFB 4ESKA 4UTAL 4G42B 1KCUH 4X5WA 4BSWB 4S0TD 5E8PB 2NLJA 1UWXH 5JOFB 3SE3A 1ZLWK 5HGDA 4M7LT 1DZBA 3KXFE 2GAZA 4HULB 4URTB 4QY8B 4WI7A 5EORL 1II4E 3BO8B 4MYWB 5TDPB 2QBWA 1GZPB 1GVIA 2EEDA 4ODVL 3NABL 5KVMC 4LQFL 2VZ1A 4I18C 4OLYH 1BJ1J 4CU6A 3LEVH 4GKZB 4QOKD 4L8CB 1JHKH 4R96B 1UACH 1PZUB 3FQXB 4PJFA 1T4KA 4P3DB 3V5HA 4GRWH 1JZ3A 1AFVL 3AMKA 5D7IA 2GK0A 4JKMA 4BK4A 3U9UB 1U95A 5BJTA 5DQJA 2CDFA 4NO3B 1LO3H 5AZEH 4GW1B 4EZMA 1XF4A 4O58H 3QDAA 4U1JB 2CUMA 1LD9A 4HQQH 2ZCHL 4P46A 5F70A 2BSTB 3DRTA 3VRJA 3RTQD 1MRFL 1PQZB 2FBJH 1D3CA 2DLEA 1QKZL 2B8OT 1QA9B 1DQTA 1LVEA 2P45B 4GBXA 1CFQA 4LARL 5F89B 3W11D 5I30H 3OF6D 4NO0B 4PV9A 3FO1A 1F6AA 3B5HA 3GI9H 1A7OH 1C12A 2NY0B 4JB9L 3BRFA 1HKLH 2H8PA 4TUKH 5CIPH 3WHE1 5T3ZD 2EIZB 2BJML 3C5ZC 2W9DL 2R2HA 1MJJA 1DBJH 2R2BA 2OSLA 1F00I 4OTXL 2FO1A 3FAXA 4KJWC 3FQRB 3TNMA 2Q76A 2AP2A 1V7ML 2H1PH 2NTFA 1AGFB 5K9QI 3KHQA 4P2OC 2BVUA 5FA3A 3SKNA 1REIA 4ORGA 3TN0A 3LQZA 4NKOA 4QT5B 4F33A 5LCVL 1J0KA 1X5IA 1T89C 3O2WL 3F58H 1QRNB 3QDGA 2BFVH 2ICEA 3IJYA 5ILTL 2SEBA 1NBZA 5F6HI 3RIAK 1A3RL 3U2SA 4PY8J 3N1FC 1AHWA 5F7HA 3IVKA 3MJGX 2NY3B 5FOJA 4CRPA 3PGDA 3H42L 1QRNE 4UT6L 5MHSE 3BEWA 2C1OB 15C8L 4NC1E 5IMOB 4WFED 1AY1L 4KJYB 2O61A 3QQ4A 3WL9A 4ZG1A 4RIRA 4LGSB 3AAZB 5SWZD 1NANH 5EBMA 2VXTL 1XF3B 3O6KH 1ORQB 1ZHKA 5ESQA 4DOHB 1RZKL 1N4XH 4R3SB 4N9GA 5E8NA 1A5FL 4AEFA 3BP7B 5GIRA 2OL3H 1UCBL 1INDL 4QXUL 2WM0A 4R2GC 5DRZB 2VABA 4G8EA 1IC5L 3GGWA 1LDPL 2DTSA 3K81A 1I9IH 1QVOB 2BXZA 1I7TA 5SWZB 4DOHE 5JLZA 1XR9B 2ILLA 2VDLH 2AEQH 2QSQA 1ZE3C 4UB0H 1BJ1H 5ITBL 2AXHA 2VE6A 4N5EC 3CDYA 1FE8H 5JW3L 1NCBL 3LDBC 5SWZE 5DJCA 3SDDC 4YK4C 2EH8H 1M05A 3QUXD 4WY7L 5CILH 1KJ3L 3MRKB 2A9NL 2ORBL 3BP4A 4X6EA 4QRPA 1AE6L 3PWNA 5F21B 1FO0B 5I1CH 4LEXH 3THMH 4Y4HC 3GSQA 3UYRL 5FHBL 3MRGB 3QUMB 2X9YA 2WBKA 2E7LC 4KRNA 4PS4H 1A8JH 1MEXL 3KPPA 3FB5B 1F3JA 3BZDA 3RVTD 1TZHB 2WANA 1NC2B 4LCCB 1E4WL 4YX2H 1OP3K 2BP3A 3DBXB 3KPQA 4XBGA 1FO0L 3WNMA 5DK0A 5JR1L 2DDQH 3QEQB 2OR9L 3D3VD 2DQDH 1I9RH 4JPKH 1IC1A 4R0LA 1WFOA 3QUML 4QHLA 3REWB 4OCXL 1P4IL 5E08H 1WWAX 1MRCH 4NZJA 4G8GD 3UTSB 2E6QA 2XI9A 4JQXA 2C3HA 3J7HA 4ZAKB 4JKPL 3RGVA 3HE7D 2HVKB 4FZEH 4MAYA 5TGBB 5IM7A 5GRJL 3QEQE 4X6DB 3KPMB 4XB8A 1MHEA 4P5TA 4JFED 2YEZB 4ELKB 1FRGH 3FQNA 1I7RB 4NWTH 1GOFA 1DVFD 1I1YA 2I9TB 4RX4A 3UTSE 4GJTB 1IARB 3LV3B 3ZKMC 4K3JH 1K9TA 4HGWA 3P0VL 5TF1L 2ICCA 1GGIL 4X6DE 1XGTA 1LK2A 5DQ9A 4CMMA 3IFOA 3TV3H 4YUEH 1CF8L 1RAMA 1R3JA 4Z7QE 3O3BA 1E28A 3A6OA 4YDKL 3MCLH 4JRXB 4KVNH 5FYJE 2BVQA 1KF9B 1NAMH 3SO5A 3SDXB 5JXED 1CK0H 1JPGB 3L3HA 1FBIH 5IMMB 1F45A 3MRJA 4G9DB 3SJVA 4Y4KA 2D9CA 2V5RA 2XT1B 5IBTH 4WI5A 1R5IA 2H6PB 5FYKD 4JRXE 4NPYA 1Z5LB 1V3KA 2IAMD 4JANA 5ACZA 3SDXE 5KTEL 4HKXA 5F8QC 3SDCC 1KG0A 2DM7A 1XGUA 4N1CA 3HNSL 1OSPL 3VGEA 5HPMB 4FQCL 2YD3A 2FEDC 4FFYH 2Q6WA 5D7KE 5B8CB 2BNRA 3HCVB 4ZPTA 5JMRA 3RWEA 1EHLH 3QWOA 4PJAB 5ALCH 1NCTA 1IGYA 3ZHKA 4HWEL 5JIKA 2C3XA 3PL6A 5D6CA 2MHAA 2JCCF 2FR4A 4LHUB 2YRZA 4F7EA 3MR9A 5I2IA 1IC7L 5DSCA 4PJAE 2Y1VA 2IGFL 3NN8A 4PREA 5DYOB 4E41D 5CUSL 3KNBB 5DJDA 4ZXBD 1U6AL 1SJHB 4U1LB 2AJXH 3GM0A 4Z7OE 3MXWH 4M5YH 4EUPH 2QSCL 3QUZB 4PJEA 2JB5L 1YEHL 3QEHB 4KPHL 4PJ8B 1EVUA 5FV1L 3SE4A 1BBDL 2K7QA 3R06A 4Y4FA 2HN7B 4O2FA 3SBWC 1IAOA 5HYEA 2ZOKB 3WHE0 4BSVB 5CJ8A 2GJ6A 4LSTL 4G6KH 5CSZA 4QWWC 4I0PA 1U8QB 3RWFB 3QRFM 3GSWB 4Y5YC 2Q8BH 1KCRH 4PJGA 5DZLA 2CDEA 5FM5M 5I15H 3MJ6A 3QIUA 2COQA 3T77B 2ZOLB 3S3JA 3DROB 1QHPA 2EEAA 2Z8RA 1JZ8A 3AREB 2QADB 4PJCB 4X5WB 1OAZH 4U1NA 4XB7A 4ZPVA 4B7IA 3WDIA 3H7LA 2NLJB 1QLFA 1NAKH 4GMTL 3WFEL 2FHFA 1QTYT 3BZFB 2C26A 5IROA 4WFFD 2KZWA 1CQYA 2Q20A 2GAZB 3KPSD 5DJ8A 1F4XL 4PJCE 5L0QC 1F4WH 5KN5B 1FAKT 3DVIA 3KLSA 1MHCA 5F7YC 2EXWC 4UNVA 3TO2B 4YHMH 4B53A 4K7FA 1E6OH 1UCTA 4GAJL 1UZ6F 3JV6A 2J12B 25C8L 5BZDB 2EDYA 2X9XA 4U05A 2WWMC 1T4KB 4JM2A 1JPTL 3UO1H 1JRHI 3O6FD 3V5HB 5TE4H 1I3RA 1XH3A 5KVEH 5D7IB 2QQQA 4MJIA 1WSST 2A6KA 3EHBC 1U95B 5GZOC 3M1BA 5BJTB 3CFKB 2XFXB 5DQJB 2W0FB 4ZDHB 2VSDA 3ULVD 3WNLA 1N0LA 2AK4D 4WFFE 5D7JB 3SKOA 3OHXB 4QGYA 5D7IE 1LD9B 3AY4C 3DRTB 3F7YB 3VRJB 3EYVA 5EBLA 1TXKA 3T3ME 1HYSC 1J10A 3GJFA 1MFBH 1OAYL 2IFFL 3TPUA 4JZJB 5JQHC 3BD4A 3PG2A 4WCYH 2FL5B 3CLFH 4GBXB 4NSKA 3H7BA 1CFQB 4PJBB 4PV9B 4KROC 3FO1B 4XVSL 1V8HA 3ZTJG 3VD9A 2H8PB 2B1AL 3OKNA 4S10A 3Q1SL 2AQ2A 3P3YA 1MJJB 2R2BB 2FJFB 5I18H 4PJBE 4RGNB 4NWUL 3L7EA 1K3ZA 3K8KA 3QJHA 3DYMA 2HTKD 1VGKA 1CD9B 4KMLB 4GW4A 4M1DH 3RVVC 1MF2L 2Q76B 3GSNB 1TCRB 4LGPB 5LQBL 1H8OA 1FNEB 1DR9A 2FYYB 5GGRY 4F15B 4U7KA 4Y2OA 1KJ2H 4RGNE 2HH0L 1FIEA 4E42A 4NKOB 3PGCA 1S8DA 2AAVA 4JPIB 2ICWB 3HC3L 1S7UA 5HHVH 2QHRL 3D85B 3BP6B 3QDGB 5FO8A 5E2TH 3DO7A 2DLFH 3VXOB 1MCRA 3GSNL 4KHXL 2SEBB 3KR3H 4GRWF 1H8SA 3RY5A 5HHMA 2CKBA 1UYWL 3IVKB 2NR6C 3O3AA 4JO3L 4L1HA 3KWWA 1YYMH 4L4TA 5F9AC 1DTUA 5E24E 3WCYA 3WO4B 1GRWA 1LO0L 4FG6C 3QDGE 2HWZH 3JVGA 4X5LA 3VXSD 3WL9B 4RIRB 1BD2B 3B2UC 2R2CA 1RZ7H 1NFDA 3VDAA 3UX9B 3MV8B 2XOTA 1UB5A 1U3HA 4HJJL 4EI6B 1YN7B 5GGVL 1K2DA 1BZ9A 5KW9H 3QNYA 4LASH 3E8UH 4P48A 3Q6GL 2JJUA 3MV7A 3RA7L 1BD2E 2ATKA 4GUPB 3GGWB 4PRNA 3O8XA 5EBWB 4EEEA 3MV8E 2R23A 5K33A 1BWMA 5IMLB 4KKAC 1I3GH 3ILQC 2I5YL 3PP3H 5SWQA 1W8NA 5D1ZA 4Z7UF 3X12A 4KJPD 3JUZA 4OZHB 4ZO8A 1B4RA 4M6MH 5CZKA 3QO1B 4M02A 2NY1D 3K1KC 1HE7A 4R4FL 3L3GA 4NUJA 4YHLL 5KOVC 1IRAY 5HYFA 1BVLB 1QSVA 2JJTA 1U8JB 3RPIB 3S97C 3V95A 5DD6A 5DJCB 5CZXC 2DKSA 2P8MA 4OZHE 1FV1A 4LDLB 3LRGA 4RGOL 3MOAH 4DZ8A 3BP4B 4QRPB 1MY7A 3N85H 1JN6B 4X0KB 1RULH 1M7IA 1S78D 2B4CL 4HH8A 4M00A 1A6TA 1ZLVH 3GSQB 4XNMA 4DN4L 5IFAH 5JHDD 4KK9D 3TM6A 2WIIB 5TFSH 2F8VA 3KPPB 4KK6C 1YEFH 4QRPE 5HPOA 4XNXL 4C56B 4JQIH 1L0QA 1NBVL 1UKTA 3ES6A 4XBGB 5IV2A 3MZTA 5DK0B 3STZA 4Z9KB 3MA9L 4NGHH 4IM8A 2XWTA 3DUUB 4JJ5B 3IDJA 4HLZH 1JNHA 4L8SA 4PJDA 3HG1A 5I73B 2CXGA 5K59F 2YRPA 1CQKA 4N8VA 4ORZC 3UEZA 4C56E 2EE2A 3RGVB 2OP4L 1Q0XH 4MAYB 5IM7B 4F9PC 1SMAA 3TVMA 1MHEB 3H9SA 4P5TB 3IGAA 2VISB 3SGDI 3FQNB 3OKEA 2AJYL 1SY6A 4UU9A 5ICXA 2D9QB 5ERWB 4F57H 3QIWD 4M93B 4XVJL 5DEGB 1OAKL 2LFGA 4PRBA 1LWRA 3ECBB 5IVNA 1G0DA 2J3SA 5GZND 5GRUH 4HGWB 2DBJA 4XNQB 4BQCA 2I60L 3HNTL 3IFOB 1K85A 5J6HA 3U0WL 5DJ2A 2ADFH 1RJLA 1YYLH 5F96L 4UDUA 3O3BB 4JN2B 5DC4B 5F9JB 4PJFF 3DRQA 3VXUD 1ADQA 3SCMD 1RJCA 4DCQA 1I7UB 5IB2A 5KS9B 1P5UA 4YR6A 2WY3A 4X98A 4EN3A 4J6RL 4PGDB 1RUQL 3SJVB 4Y4KB 1H3PL 4O4YL 4FXKB 1INEH 1IILE 5CMAB 5F6HJ 5IW1A 1JWSA 4WTXA 3RUGA 3SHSA 5ACZB 3BQUD 2HT4C 3K74B 3OXSA 3WJLC 4Z5RB 5KS9E 1WWBX 2NYYD 1KG0B 1VPOL 3BKJH 5T3XL 1QHOA 4XTRC 1QSEA 4LSPH 3SJVE 1C5BL 4XMLH 5EB9A 3CXDH 1RJYA 1UA6L 1T20A 4ZPTB 5HYSA 3BD3A 4DGYH 2Q3ZA 4YE4L 3ROOA 3ZE2F 1P6AB 4BKLA 4B50A 3PL6B 3HC0A 5D6CB 1W2KT 2MHAB 5IJKC 4ZNEA 1IM9A 3DYOA 3I3EA 2AGJL 4F7EB 2EDLA 5I2IB 5KSVB 8CGTA 1X7QB 1QBMH 4JLRA 4HX1B 2P24B 2PO6B 1KELL 5GGTA 1NCAH 2JB6B 3BH9B 2NY0C 1OP5K 1ZA6B 2VLJA 4ZOBA 3WIIL 3SDAA 3QHZL 5D5MB 4HG4J 1TZGL 4PJEB 3H9HA 1G9EA 1EHAA 2A77L 3DPBA 2BRRH 4MAUL 2ICWI 4JREB 2C4XA 1IAOB 3MV11 1AC6A 3STLA 1EA9C 2B2XH 4JFOB 4XPAH 1SYSA 5D5ME 4KK8D 4PJEE 2VKWA 1J1OL 2YUXA 4OGAC 5KVDL 4LQ1A 1FVCB 3MRCB 4PLKC 43C9A 4E5XB 4OZIA 4AH2A 1L8JA 2GIYA 1J7VR 3IS1X 4D9RE 4NC1C 2APTA 3TO4D 1JGEB 2DIAA 4JRYD 4PRID 3L3KA 4ISVA 1RZKC 1KC5L 3OGCA 3VG9B 4U1NB 3HZYB 4ZPVB 2RBLA 2VDNL 3GMNB 2NY3C 5F9OL 5IVOA 3GK8L 4MSWA 1KACB 4QRQA 5J9PA 3UZQA 1FC1A 2CGRH 5D1XD 1CICD 2H9GB 4J12A 2MOVA 3S34L 1P7QB 1DBAH 1A9BA 3D0LB 5IFJA 1E27B 4XWGL 5C0AA 1MHCB 3FQTA 4AM0B 2D7TL 1BX2A 4K7FB 2FCBA 1FNHA 3GSUA 3X13B 2QQNH 4LLAA 3JV6B 1OF2B 5MEOB 1JBJA 5GS3A 1RHHA 2F54D 3QWRA 1WZ1L 1JUFB 3FT3A 1I3RB 4HWZB 4RSVA 4MJIB 4ZS7L 3QDJD 3L6FA 3GMQB 4UQ2A 43CAA 1L9MA 3EOAA 2HG5A 3M1BB 4HGMA 1CGXA 4MNHA 1CE6A 5GJSL 1MPAH 4XPBH 4Z0XB 4P2RB 4TVPD 3L7FA 4JO2L 1T66C 1V3MA 2AERT 4MJIE 2DQUL 2EDWA 3OX8B 3ROLA 3EYVB 1QFPA 4MXWL 4OKVB 3TF7A 3GJFB 2DYPA 3BRDA 2WBWB 3RPKA 3WE6B 5TE6H 4RWHA 4P2RE 4H8WL 5HYJD 5T5FL 5IKCA 2IH1A 5E2WL 2VSCA 3BE1L 3CMGA 4KZEL 2W59A 1L7IH 1KNOB 4HJ0C 4P9HL 5CZVL 4RAUB 2VLRD 3W2DH 3VJ6A 2HAZA 4N0CC 4EOWL 3LB6C 4OM1L 5BS0B 4LCCC 3PHSA 5I1GL 4TVPE 1VGKB 3P11H 4I9WD 2DLHA 3RTQA 3Q6FA 3R8QA 5C07A 2OR7A 4NQDA 4M8QA 1MFAL 3NCCB 5J1TC 2OK0H 1CE1L 4FFVD 2NNAA 5BS0E 1MHPH 2P42B 1S8DB 1CGTA 1I1AD 4WW2B 1S7UB 3HTLX 4ZAKC 5IESH 2A6IB 4KI5E 5E2VL 4U0RB 2OS7A 4IRSD 2GFBA 3DIFB 3H3PL 4OFIA 3F12A 2CKBB 5CAYB 3KWWB 3ESUF 4JFYA 4QYOB 2P49B 4M61B 4XXCC 5MP6H 3IXTB 5TQ0H 5KVGL 3TA3D 4MWFB 5D7SL 3QCVH 2AV1A 2VLMD 4GW5A 4HXBL 5DURB 4IJ3B 3BGFB 1TQCB 2CKBL 3SY0B 5BV7H 1K2DB 1BZ9B 1MJ7L 3TIDB 1K8IB 3DSFL 3U1SL 3NACL 3E0GA 1YNKH 4JFPA 3O8XB 2CH8A 1U8IA 5EORH 4H26B 1HQRA 3IJSA 3IDUA 5D1ZB 3QXDB 3X12B 1TPXB 4ODVH 4KMQA 1FL3B 4LQFH 4LCIL 1M7DA 5C0NC 3OKMA 1U0QA 4CGTA 4R7DA 4NUJB 4ODXB 4PUBL 1ZMYA 3WXVL 2R56H 2XA3A 5DD6B 5B8CC 1OQXA 1XF1A 3Q5OA 2QKIA 1JNLL 2P8MB 3MUY1 3TBWA 4H5SA 5GISH 1KJMB 3K80A 5IEHB 4DZ8B 3S37X 4MD5A 2FLRT 3STBA 2I07A 1HXMA 1P84J 1UWEH 1M7IB 1A6TB 5TE7L 2ZCHH 3MNVB 2V9TA 4LIQE 5DXWA 3PDDA 4KRMB 1FORL 1ZV5A 2UVFA 4IEFB 4KKCD 4LIQL 5IBUB 3VWKA 4WJ5A 3GKZA 3CMOH 4GAGH 3N1PC 3LQAH 2DQIH 4PJGF 3STZB 1VGEH 2P5WB 3QUZC 5AWNL 3CX5K 3IDJB 2BJMH 3IJHB 3OAUL 4L8SB 3HG1B 2XZQL 5E2UH 4PJ8C 1C5CH 2YPKA 1G1CA 2E9JA 3TWCH 1Y18A 4EVNA 4NQUA 4PGCB 5FV2A 5MI0B 2YA0A 5HGHB 3QXVA 4Y16A 2P5WE 1D9KA 2DQJH 5ICXB 3HG1E 1T1XB 4NQVA 3WFHA 1EFQA 3D6GA 1Q0YL 5B4MD 4IOFD 3AREC 2QADC 3CLEH 2DQCL 3Q5TA 4GKOA 3RHWK 1QFOA 5HHPA 4MJ4A 3D3VA 4I48A 5J6HB 5DJ2B 1RJLB 1A3RH 2NZIA 4UDUB 1DQLH 3I3BA 5DUPH 3SE3C 1RIUL 3DRQB 3N50A 1HZHL 4G8GA 4DCQB 4JZNA 4MDJA 5T3ZH 3L5XL 3IDGA 4NRYB 4YR6B 1OARL 4X98B 5EULV 4YBQD 5L2KD 2A0LD 2ED9A 1I1FA 2F9BT 2RAMA 4MD0B 4JFEA 1EEYA 2FBOJ 4N0UB 1N6QH 4EDWL 4FXGB 1F3DJ 4NCC1 4G8IB 4PV8A 3UTQA 1DVFA 3HRZB 1RZKH 1ERNA 3RIFF 1FGVL 5I76A 2DMCA 5JORA 1ADQL 1UCBH 1AP2B 4OD1L 4HKBA 1C08A 1QSEB 3S36L 4F37K 4WDIA 1AGCA 4P4RA 1JWUB 3CNKA 4N0UE 4GG6B 1XGRB 1XGQA 1S7XA 1MJUH 3PHQB 4HKZA 4NRXB 3T2NH 5HYSB 3I75A 3QFJB 4NZUH 5TPWH 3P0YL 1Q38A 4IRZL 5D7JC 2X4QB 2X4NA 4IHOB 1YUHB 1J88A 1QSEE 3SKJH 3TBTA 1VFMA 1J05A 4BKLB 3L5WA 3GNMH 2UVEA 4GG6E 4JKLA 1P4BL 3MRDB 4NN6B 3TJHD 2IJ0C 4F80A 2N7BA 3QFJE 4JZJC 1HK6A 3DETC 2KZ1B 4AMKH 1B3JA 2IAMA 4XCNA 3OG6B 1PKQA 3BWUC 3TYGL 3TBYB 3ZYZA 4C59B 3RVWC 3BIAX 2C7UA 4JY6A 5TH2A 3NGBB 4UMGA 5HI5C 4MA3B 4YQXL 1JRHH 4HW6A 1ZHNA 2VDKH 3SDAB 1UH3A 4HUXA 3VE0A 3H9HB 4FQIL 2ESVD 4KXZI 2JF1A 4OAWA 4RGNC 4Z7WB 2BSRB 1MEXH 1V7NL 2BX5A 2UZXB 5HGBA 1G7HA 3V4VL 4R4ND 2PNDA 2XKNB 3MRIB 3VGAB 1DEEA 4G8FB 4L8BA 1FO0H 2LQRA 3HAEB 1NCWL 1UM6L 4F15C 5JR1H 4Z7WE 1MREH 1U8OA 5IVXB 4NQEB 1NDMA 2GYSA 1P4IH 3QUYD 3VFGH 2HTKC 5AAMA 1NFDF 5LAXB 3O9WA 4PJ7E 4ISVB 4ZXBA 4QRRA 3OGCB 2WQ8A 4HUVA 3BW9A 5EWIL 1WIUA 3ZHDA 5IVXE 5ID1B 4NQEE 3WO4C 3N9GH 1FJ1A 2NCMA 1FFOB 3BPNB 5DT1H 5IFJB 2GUOA 3ZYIA 3HUJA 4N90E 3X3FH 3P0VH 5C0AB 5TF1H 3EZ8A 3FQTB 5H94B 1H3TA 1K5NB 1ZHBA 5ABDE 5ELIA 2HVJB 3EFDH 1I8IB 4YDKH 4JO4H 2A6DA 3F5WB 5DFVC 2R4SL 2APFA 4S1RL 2DI8A 5DJ0B 3FT3B 4JFDB 3G9VA 5C0AE 5FYJH 1H0DA 1Q1JL 1KTLB 4MNHB 4S1SL 1GPOH 1CE6B 5ACMA 1F3DH 3FB8A 4HJGB 5IFHL 4LPWA 3ARXA 3MFGB 2HFFB 2B4CC 5JW4R 2ZNXA 1EMTH 3L7FB 1CTNA 4Y7MA 4JFDE 3KPSA 4K94H 5KTEH 4P4KD 1AIFA 4G7YL 2F74A 3HNSH 2WBJD 5EN2A 2AK1L 1YMHA 5L6YH 1ZGLA 1AO7D 5C2BH 5C8JA 2DYPB 2IBZX 4ODHL 4I0CC 2IEPA 3RDTB 4G3YL 1OP9A 1TJGH 3LS5H 4Q9BA 2IH1B 5INDA 3IKCB 4PJDF 3CCHB 4HWEH 4PJXB 3VU2A 2ARWA 3UROR 4OGYL 2P5EB 2HTLD 2ATPB 3MROA 3D5OF 2AK4A 5DS8B 1A22B 1IC7H 4G7VL 4Z0BL 1CLZL 1JCKA 5FYKH 5FHAL 1T2JA 1IGFL 4JGMA 3Q6FB 4PJXE 3HB3C 2DRUA 3BT2L 2MWCA 1U3YA 5C07B 2P5EE 1Z3GL 4JFZL 4NQDB 2IG2L 4U6HB 5KG9B 3RI5K 5ESVA 5I73C 2NNAB 2VTFA 1PYWB 4G9FD 5C6WH 4KPHH 2IAND 1G7LA 2GJZA 3KLDA 4MAYC 3VXQA 3QPXH 2GFBB 4HIIA 3DX6B 5C07E 4P5TC 2W60B 2W65A 4U31A 1WFNA 3F12B 4NQDE 5EBGA 4DZBA 1JYVA 4XPHL 1JFQH 4M93C 5DO2D 1D6EA 1CD1A 1CFVL 1J8HB 5JIIA 1FGNL 4M6OH 5I0ZA 2ICWJ 3EFFA 3O81A 4GW5B 4IRJA 2WP3O 3TP4A 5D72H 1O0VA 3WFEH 1J8HE 4FABL 1WZMA 4O51A 2HFEA 4AQ1B 1J87A 3K46A 5I1EL 4Y4KC 2P48B 1F58L 1QSFA 4HUKB 3IJSB 1G0YR 1TENA 3SGDH 4HXAH 1M7DB 4K71B 4R7DB 4ZOEA 3VXSA 5CP7A 3T1FB 4K2UH 1A6UL 1QPPA 1N8ZB 3WHXA 5JPNA 4H5SB 2XA8H 4V1DB 4N0RA 4NKDA 5C7XL 4CL7A 4BZ1H 3GI8L 1JZ2A 3IF1A 4TTDD 1YEEL 3SOBH 1NPUA 3LKRA 4MD5B 3O2DA 4P23D 3V5KA 4JZOA 1HXMB 5GSRA 3PL6C 4QF1A 4G43A 2IQAA 5EOCL 3RWGA 1L6XA 1PY4A 4L29B 3M07A 2Z4QB 3VRLF 4XP4H 4V1DE 1AI1H 4NHUA 1OAUH 4YGVB 2OMNA 3VWKB 4CDHA 2PO6C 4IMLB 3QRGH 3V52L 3BN9C 4LPVA 1ZSDA 2G75B 3HMWH 4MCYB 4YHIB 3WNKA 1GSMA 4XBEH 4Y5VB 2B1AH 4OZIF 3VMPA 3MRFA 2P8PB 1A1OA 4OQTH 5FKPB 2P7TA 4JREC 1HHGA 1QOKA 2FX7L 2XWBB 1IGML 4IOIA 1Y18B 4EVNB 2FHBA 1X5JA 3ULVH 1Q9WA 2VAAB 5B3JF 4HIHA 4Y16B 2F19L 1D9KB 1FP5A 4PTTA 1DLHB 4JDTH 4UZGA 5FCSH 5LQBH 35C8L 5JHDA 4U6TA 3RFZC 5FDYA 3C5SB 3QR2A 4GQPH 3PJSA 5SV3A 3WFHB 1J1PL 1QR1B 3VFMA 2H2PD 1HQ4B 1A9EA 3P9LB 1MAMH 4CVUA 2ZUTA 1EFXA 3VG9C 2V5YA 2YMXH 4G6AC 4KHXH 1XIWA 2NY5H 3TZVD 3HZKA 4FQ2L 4JO3H 2CMRH 5IROC 4JZNB 3CFDA 1HHIA 3HE6D 4H25A 2EXYD 1LO0H 1I1FB 3NZHL 1EEYB 2AW2A 4PV8B 4PLJC 3UTQB 3WN5B 3L3OA 3QIWA 2BVYA 4NT6B 4Y2DD 4JCLA 5DUML 5I9QB 2F15A 5JORB 4I77L 1FQ9C 4G5ZL 5B38G 3QQ3B 4YHNA 1N6VA 3RA7H 5JW5B 4WDIB 1AGCB 1XGQB 1DUYA 2X7LB 1S7XB 2HT3C 4IS6A 4HH9A 3QCUH 1VADA 2I5YH 3GIZL 1BQLL 4NNYA 1D5MA 1BAFL 2X4NB 3MV9D 5DDHB 5JNYA 5IEKA 1HOCA 1EZVY 1WIPA 4P9HC 5J4MA 3EDDA 2E7HA 4M1GH 1ZLUH 2R69L 4YHLH 2NY7H 1FSKB 2VO5A 3MRRA 4NJAL 3RVUD 2OZ4L 4AG4L 3LKSB 5B39G 3BH8B 4FXLA 1PKQB 2VLLA 1UQSA 4RGOH 5TH2B 4RA3A 2FGZA 1NDGA 2D4DA 2B4CH 2Y7QA 4XNYL 5DLML 4XBPA 3DTXA 5KSBF 3KLAB 3VE0B 1PKQE 5HI3D 3LS4L 1SEQH 2DQFA 3OKOA 2VXVL 5HGBB 3ZDZE 1G7HB 2E6PA 3QULA 5HYIA 3IU4H 4LLQA 2ZSWA 4KI5C 5I16B 4AIXA 3GMLA 2FWOA 4WWKB 5F7LB 3HFMH 4L8BB 3LRSA 3C9NB 4OLXH 5HGGS 5CJBA 3MA9H 1U8OB 3RL1A 4XMKL 4OD2A 1WT5A 4WW2C 1NDMB 2DKMA 2YSSA 3G6AA 5GXBB 4JR9L 4U0RC 1FL5B 2H3NA 9CGTA 3GBNH 3O9WB 2A1WL 2OP4H 3DMMD 3WIFB 2Q86A 4QRRB 5D2LF 2EIEA 1BHGA 4YPGB 4HEPG 4MXVE 2E8ZA 3KPLA 3SKUD 3CH1A 3JVGC 1T22A 2EYRA 4QRRE 1D5IL 2GUOB 3HUJB 3JV4B 4P59L 5GPRA 1FZOA 2G2RA 3LRHA 3AM8A 5DMKA 4IJ3C 3BGFC 5CFHA 1TQCC 6FABL 1CVSC 4LCWD 1FFNA 5F96H 4JN1L 1HSAA 3C8KA 1G6RB 1Y6MR 3MLWH 4AENA 5GS0L 3TO4A 3O8XC 3HUJE 1S7RA 4GQ9L 3P4LA 1IGIL 1GC1C 1H0DB 1RUQH 1RURL 1TVBA 1W0VA 1TPXC 3IU3B 5IT2L 1H3PH 4GSDH 3FB8B 1C5DA 2VDOH 3EDEA 5IG7B 5D1XA 4PGBA 1CICA 1G6RL 1NLDL 3JTTB 1AIFB 4LBEA 5DVLA 5I8CA 3BXNA 4LP4A 3GMOA 1YMHB 1C5BH 3HPLA 2B0SL 3OXRB 3FOLB 1EO8H 3BJLA 4TYUA 5FKAA 4WFGE 5IBLD 2E3VA 2F54A 3BPCA 4N0YL 3PV6A 3SEPA 1F5WA 4G59A 4YE4H 1OQOA 4PB9L 4ONFL 3QDJA 4LVNB 4RRPA 2VDRH 3O4LD 4MJ5B 1F90L 3HZMA 4YAQA 2EYSA 3LH2H 3GSXA 4D3CH 2ED7A 5FO7A 1KELH 2OJZH 1W0WB 4CUCA 4UV4L 1P7KA 1VDGA 5C6TL 5CGMA 4L8SC 4P5KA 4ODWA 5ESVB 1RJZB 3QHZH 3EYSL 4NZTH 3VRIA 5HYJA 1YC8A 5CEXA 1DEDA 2A77H 4MVBA 1G7LB 2RR3A 4ODSH 4P9ML 4HKJA 1QFWL 4LNRB 4KMTL 4BFBD 3BKYL 2VXQL 5MI0C 1F6FB 1BWWA 3RWCA 2DQTL 1UZ8B 5C0IB 3HI6H 1EPFA 1PSKL 4K7PX 1J1OH 3RP1A 4ENEC 1AQDA 5KVDH 1XF5A 4OZ4B 3FN0L 3L5JA 5EU5B 2BDNL 1T03L 1UH2A 3UPRA 4OV5B 4X6CA 4KRPD 4AY0A 3IDNB 4IRJB 3TCLA 3DLQR 3SDXF 2DN7A 2K1MA 5EU3A 1U8PB 2MTPA 1I1AA 1J0ZA 3GK8H 3GJEA 1SVCP 1JGLH 4O51B 5TDOA 5GJTL 1X5YA 1Z9OA 2FECL 4IRSA 1BVKA 3S34H 3MJ9L 3NAAH 4JG1L 5I1AB 1QSFB 2KL6A 4XWGH 1IKNA 4QO1A 4KRLB 4M7LL 2YZ1A 1N64L 5T1MA 1URLA 2YC1B 5K9QG 4JHZA 3LKQB 2IALA 1LEKA 2BOCA 2C3GA 4OZGA 5CP7B 1PLGL 4NOBA 1KT2A 3DARA 4UDTA 1QSFE 3TGXA 3S3SA 1E4JA 4ZS7H 1MUJB 2AJVH 5GJSH 2VZUA 1YEDB 4UT7H 1YC7A 4DAGL 5KZCB 3V5KB 4Z7OF 1IKFL 3SPVA 2WINB 1D7FA 4JO2H 2IQAB 4ZFOA 4YDIL 3H9YA 4NN6C 3RWGB 1NLBL 5L8JB 3O3DA 3GRWA 3L95B 2A73A 4D9QE 2DWDB 1CL7I 4MXQC 1JGVL 5EOQH 4W6YB 3QQNA 3NGBC 3ALXA 2PTTA 2IMNA 5FO9B 1A6PA 3ARPA 3BE1H 3EYOA 4NQCD 1RZJH 3ZKNC 2AJUH 3SDAC 4JM4L 1R3HA 4J1UB 3QO0B 3MRFB 4P9HH 5AD0A 3BMWA 1A1OB 3ESVF 3G6JA 1FZJA 1T80A 3V2AR 5DJXA 2A38A 3HN3A 3MNZA 4NQTA 4IOIB 1RUKL 4HUUB 3W9DB 3OZ9L 3VGAC 5GS2H 2EDDA 4YO0A 4TVPH 1F4YL 4YHOH 1S7SA 4J3SA 3PJSB 1MCJA 3CVHA 1T1WA 4M62L 4Z7NE 5ENWA 5E5UB 1D5XA 3F7VA 5CJOL 1R3IH 2BC4A 1CFNA 3WFDL 5LGHL 1P9MC 3UYPA 5JIPA 1EFXB 4LCUA 4UIKL 2G5RA 1XIWB 1AGEA 3T0EB 1WEJH 2BNQD 4GKNA 1HNGA 2WUBL 4K23L 4MJ6A 3DURA 3CFDB 3BPNC 4KXZH 1KLUB 4N9OB 3GBML 2GT9A 2LAGB 2FB4L 3PWLA 3T0EE 2NW2B 4KDTA 3L3OB 3ZE0E 2WUCH 1UT9A 1IEHA 3CFCL 5ICYB 4YHNB 3JWDH 1MAJA 3ARFD 1FLTX 5E6YA 3K2MC 1U91A 4JY4A 4D0BA 5EUOF 4W81A 2FSEA 4NO5A 2LTQB 1HN1A 3WD5L 5DD5H 1KB5H 2IBGA 1D5MB 3BZ4A 4NO2B 4U33A 4LCIH 4I4WB 1HXYA 1HOCB 4U1IA 2JJVA 1IFHL 5C0BA 5L2KA 1OTTD 1A47A 2NMSA 2NY2D 3MRRB 1JGDA 4L5FL 2CR3A 1HHHB 3ULVF 2BMKA 3WXVH 1OHQA 4OD3L 3WLWC 3S96A 1RU9H 1KTKE 3RDTC 4DEPC 1GC1H 2YD1A 1YZZA 4X4ME 4X80L 2HRLA 3V6ZB 3FONA 1BFVH 1NDGB 3V6FB 1AKJD 5CP3H 1GYAA 4WO4D 2V7NA 5E94A 3EOBA 5L7XH 1P1ZA 2GEEA 1HWGB 1S7VA 1I85C 2J88L 3N1MC 4LVOB 4LLQB 2ZSWB 3ULUD 4ZSOB 2FWOB 1CDGA 1HEZA 3UTPE 2HRPL 4HIJB 1SJVA 1DSFH 4ETQA 4IIQB 2FIKB 1EERB 1N5YH 5KANI 2I25N 3RL1B 1EO5A 4OD2B 2H41A 3E1F1 1X5LA 1AR1D 2XZQH 3RL2A 1A64A 1RVFL 3H9ZA 4ZSOE 4KY1L 1PG7W 2Q86B 1ONQA 5FXCH 2CO6B 2HKFL 1BQSA 3IFNL 2XQBL 3FQWA 1RD6A 5K93A 3OKDA 3B9AA 2IH3A 4DGVH 3U7WL 2V9RA 5IMKA 1T22B 2DTML 2YUZA 3GMRB 3QZWB 1Q72H 3Q3GB 1EJOH 3T0WA 1CDUA 3FFCA 1AQKL 3U6RA 3VW3L 3I6GA 2QQKL 3SGJA 1OCWL 1QBLH 4PJIA 3QUYA 4AENB 1HIML 4TSBH 2EDKA 2X10A 2N1KA 2XKSA 4FZ8H 3L5XH 1S7RB 5I1LA 1U93A 4OZHF 3RAJH 4M7JL 5CEYB 1W0VB 1MCCA 3H3BC 3MODL 4G80B 1C5DB 1DP0A 2APWA 4K71C 4Y19B 1Z9SA 5IB3A 3M8OL 4FP8L 5DK3A 4PGBB 2A9ML 1OLZA 2UWEF 1WBZA 3EGSB 1DBMH 2FD6L 3AS3A 3MRHA 3S36H 3GMOB 3HPLB 1IQDB 4M1CC 1HHJA 4JVWA 4CJ1A 1RK1B 4LVEA 4Y19E 3NA4A 4LFHG 1T04A 32C2B 1ZXQA 2WLZA 5DWUH 2DBLL 3PV6B 5AYUL 1S9WA 4FQ1H 1RUMH 5ADPL 3GKWL 4QHNA 5IGXL 3P4MB 1I8MA 3VWKC 5BRZB 4DKFL 3HZMB 1ZTXH 2EYSB 1A3QA 3TYGH 3VWJB 4P4KA 3EDKA 2EO1A 2YOCA 3EO9L 3OAYK 5HHNA 1TJIH 1OB1A 4W68A 5J8OA 2E7MA 2WBJA 4Y5VC 1UEYA 3SE8L 4YXHH 4YQXH 2OTUA 2XTJD 4ODWB 5EOTA 5BRZE 2E27L 3Q48A 3MOQA 3PWPA 4FQIH 4RMRA 2UUDH 1G7PA 2DJ4A 3DVGB 1T83A 4J4PC 3TEUA 4Q74A 4ZOCA 1KIUA 4Y16C 1D9KC 5BVPL 4OIIH 3NCMA 4XP1H 3MBED 5IB4A 3MFFA 2YWZA 1Q8MA 3ILPA 5ETUA 5FEBA 3MACL 2Y36L 5JHLL 3KLHC 2IMMA 1YN6A 5TJWK 2VIRA 1N3NA 2GY7B 3TLRA 5I1IH 3FRPG 1B6UA 4GXVL 5C6PB 5C0EA 4R90H 3C60B 4RQQB 4HV8B 1ZLWH 5J1AB 1HILA 2WLYA 1CU4H 4G9FA 2IANA 1G7QA 5J3HD 3GJEB 4UTBL 2Y06L 5TDOB 1UXSA 2YWYA 2AEWA 3FQUA 5DGQA 4GAYA 1PJ9A 4JO1H 3GMMA 3PABA 3S88H 1JFMA 5FGBC 2G60L 3WN5C 3VGFA 2Q8AL 2F8OA 5I9QC 1U8HA 3FKUS 2ITCA 3TIEB 4F58H 5T1MB 3TT3H 3WO3B 4ERSL 1LQVA 2GSIA 1LEKB 4DFIA 1KCSL 3ZT6A 1G6VK 4S1RH 3UCRA 4UDTB 5D1QB 5F1IA 5CINL 4I13B 2YR3A 1XGYL 1Z0MA 3BDBA 1DDHB 1SJEB 4S1SH 4I1NB 5JMOC 3PQYD 3QIBA 1TVHB 4BH7A 2VZ3A 2OJEA 4FS0A 5JOPE 4OM0H 3GMPB 3NFSL 5EOCJ 5A2IH 1RMFL 2AJSH 2EZ0C 1P2CB 1MCOH 4PRDA 1CG9B 5C71A 3O3DB 3JV0A 2A73B 1MRDL 1W8OA 3BUYA 4ODHH 3OQ3B 3WUWB 4G3YH 4GS7B 2FLBT 1YEGL 4WFHD 4YHYB 5D5MF 1FIGH 2XWJA 3P30H 4J3OC 5D4QA 4BZ2L 1T0NB 3QI9B 3MLYL 4GRLB 1R3HB 2EDRA 5ICZB 4R97B 5AD0B 4X99A 3U46A 3V7AE 3QXTA 3EZJB 3G6JB 4XC3H 4JHBA 3SKMA 5F3HA 2PCPA 4TUJA 3TNNB 5F6IB 1RZ8B 4P23A 3MYJA 4JAMA 4WWKC 4MDIB 4Z0BH 3FO9B 1GZQA 5DK2B 4YO0B 2XY2A 4LLVA 2X4OA 3OR7A 1IGFH 3G6JE 3RX8A 2Y25A 1Z3GH 3NIGF 3MGTA 4JFZH 4LSUH 5HDLA 4WW1A 1KGCD 4QLRA 2E7CA 4FQJL 5ECJE 2V9QA 2DOCA 1MCQA 1D5XB 4LHUG 3O9WC 5IK3A 4XCFH 2BC4B 1CFNB 4HK3J 3RY6A 1SM3H 4QHMA 4LCUB 2K7PA 3U4AA 3K4DA 1S9KC 1NEZB 1AGEB 4PJ5D 1GGUA 2J6EH 4XPHH 5GS0C 4XPFL 4GKNB 3CSYB 2OMBA 3DURB 1TMCB 1FN4A 4PJ9B 1ZANL 5DJ6B 2GTZA 4QRSA 2FX8L 3KGRA 4L9LB 5CGYD 2EDTA 2R0LH 3QAZB 1LE9A 2HJFA 5J13B 3MLUL 3P4OA 4M6NH 2YD6A 2J8UA 2G9HA 1MLCB 2QLVB 4Y1AB 3DGGB 1I8KB 4JHAL 4RFEA 2XIDA 3GUTA 5D7LD 5E2JA 4XNZB 3A6CL 2F58L 2X1WL 5I1EH 4JY4B 1U91B 4D0BB 1ZHLA 2FSEB 2Q87A 1F58H 5EO0A 4Z7VA 4Y1AE 4QRUA 3BZ4B 3HR5B 3QEGL 1G9NL 4U2YA 3HE6A 4U1IB 5T1DH 3IFLH 2C1PA 5C0BB 4TQEL 5GSVA 3MRQB 1U8KA 3HA0A 5FIEA 3S37L 4C83B 5T1LD 3S96B 2R39A 4GMSL 4Y2DA 2C3WA 1H15B 3FOMB 1OL0A 4L4VA 5DMIH 1YMMD 3FONB 5IR1A 5C0BE 5IP4A 1JF5A 3RQ3A 1LEGA 4F8QA 5EOCH 4YDVA 4L8DB 4LVNC 1ND0B 3VH8B 1A14L 1N59A 3EOBB 4BSJA 1OP3H 3ISWA 3C2AL 1L7TH 2YPVL 2R29L 2D2OA 3MV9A 3OJ2C 5C9KA 1HHKA 3SN6N 1UWGL 4MLIA 4GO6B 3GSVB 4S0SD 4ETQB 5GHWH 4YZFF 3DGCR 4WW2F 4MA8L 5FA4B 3ARBD 2EDOA 1MFNA 5J11B 3LZFH 3GZKA 1WK0A 5TQ2H 5KSUA 3RL2B 4X6CF 1DUZA 3B9KB 5BXFA 2Q7NA 1LNUB 4FFWC 4RMQA 3BAEH 1WAAA 1LO5B 2W91A 1HNFA 1NC4B 1ZA3A 4NKMB 5CKAA 1X4ZA 2ZPKH 3FMGL 2D0HA 4UNTA 5DEFA 1FNGB 5HY9B 3UPCA 4HBCL 4IRJC 5DR5L 1NGPL 4O02L 3FFCB 3U6RB 1ZT4A 3I6GB 5DHYB 5I75B 4BUHA 5KSAA 4FQ2H 1ORSA 4NCDA 4OZGF 3OPZL 1BQHA 3KDMB 5F9WB 3L3JB 3DMMA 5ID0B 1NFIA 1U93B 1T3FA 2HFTA 2E7BA 3FFCE 3VD7A 2H32B 2X42A 4ZFFA 4RMTA 1NGQH 1GGYA 3PV7A 3ZHLA 1A3LL 1XFPA 1MVUA 3QQ9C 4U6YB 5DUMH 1AH1A 5AUMA 1WBZB 2V7HA 4UT9L 1IEAA 1S3KL 1F11B 1KIRA 5AEAA 3DV6B 5CEZE 2GHWB 2O5YH 4M48H 4ZUSA 4OZFB 3F7PC 5CEZL 3QJFA 3GHEL 1BQLH 4I5BA 4LLDA 5HHXL 1BAFH 3DNKA 3MRMB 3MREA 4MQ7A 1QYGH 3MYZA 4CW1A 4PY7A 2A74A 4EIGB 1I8LA 4JQVC 3C5ZD 2V2TA 4QHNB 1I8MB 4ZO6A 1W72A 1KJVA 1ITCA 4KJWD 4HHAB 3MRBA 2X41A 5HHNB 4KQ3H 4OGZA 1OB1B 1WCBA 2OTPA 4P2OD 3MLRL 1FYTD 4ZTOL 1TZIA 3MJ7B 4XWOC 5ALBL 2MJWA 2HFGH 5DLMH 4OLZL 3C87A 3PWPB 1LO2H 1G7PB 2OQJB 4Q9CA 2VXVH 1LP9A 3H0TA 4L3ED 5IB4B 3WIHH 4G6ML 4JKWA 3N06B 2YN3A 4ZUUA 3ILPB 1J1XH 3CDCA 4PG9B 3PWPE 3O4LA 1ZLSL 2JIXD 2V2XA 1TTGA 4KHTL 4FFZH 2OCFD 4XMKH 4Z95H 2XRAL 5E99L 4ZFGL 1NJ9B 1CL7H 1MI5D 2Q7YB 3EUUA 1LK3H 4JR9H 4HT1H 4DFHA 2ID5A 3IKKA 3MXVH 4FNLL 1J5OH 3CFEA 3BDYL 1XIWC 4X4YB 5F7NC 3T0EC 1OAQH 2QEJA 3NH7H 1A4JB 1HILB 4R2GD 4X8JA 5F7DA 1IGJA 1A4KA 4M4PA 1G7QB 1DE4A 1UXSB 1R3KA 4HAFA 3FQUB 3EW3B 1H3UA 1D5IH 1R5VB 5I1JL 1MFEL 3NTCH 1U8HB 4N5ED 2O5XH 3TYFA 3V5DB 4LPXA 1A6VH 4F3FB 3OGOE 1FLRL 1X5KA 4HS6A 4Z8FL 4N0FB 3WS6A 3SDDD 1UVQB 1DLFL 5DVNA 5F1IB 1FZKB 3T8XA 4MA1B 3Q5YA 4KTEL 2LTQC 3VFNB 1CDIA 4HK3N 3KYAA 3QHTC 3HMXA 1TJHL 1MJ8L 3QIBB 3CK0L 4Y4HD 4BH7B 3CJJA 4K55A 5BZWA 4UOW0 3I6KA 5F88B 1G6RH 3U0TA 4PRDB 1E4XI 3H2WA 1KIQB 2B0SH 4LKXA 3ZTJH 1IT9L 2J7LA 5I17B 3O11A 3V6OE 3VG0L 1VFBA 1BVZA 3ARUA 3CD4A 3ZDYF 3LKPB 2XWJB 4AL8H 1N5AA 2CIIB 4ONFH 5C09A 1M6OB 5DD1L 2N56A 2AJZB 2BNUB 5HHQA 1KEGL 4LVOC 4QTHB 5F7MC 4PJ7F 3MOBL 5H2BA 1XAUA 4BFIA 4YXKH 4M7KH 4LLVB 2GQHA 5IVXF 3OR7B 4UV4H 2Z92A 4IIQC 1KENH 2FATL 3K3QA 4JDVB 1Q9OA 1EEZB 1WT5C 3ZKMD 2BXYA 1X6NA 4HMEA 1D5ZB 4X6BB 2CUHA 4JFHD 3MUHL 2ARJA 3K7UA 5IK3B 4TPRL 4NQCA 4EBQH 4YLQT 2VXQH 4ELMB 4GH7B 3X11B 1ODAA 4DQOL 4PJIF 2DQTH 1RUAL 2E5EA 2LVCA 2WV3A 3FT2A 3I6LE 4XXDA 3GDBA 1PSKH 4P2QD 1Y0LA 2BY3A 1NSNL 2YBRB 1A7QL 4OCYL 2JJWA 4ELME 2BDNH 4FQXB 1T03H 2EH7L 3AM8C 4HC1A 3P4OB 2J8UB 3MCG1 3X3GL 1OD9A 4Y8AA 1A6ZB 1FNSL 5FF6A 4F7TB 2D7OA 3FO2A 2AXGA 3SDCD 3PF2A 4RFEB 3GUTB 3G6DL 2FEDD 1D5BB 1KEML 2B7DT 3QH3A 3VGHA 5EUKB 3GB7B 1ZHLB 3MJ9H 3PIQA 2J8UE 5HHOD 3VXNA 3JV5A 5EO0B 1OSZB 4Z7VB 4RA0C 3QG6B 1WWCA 4MNGB 1T0MB 1YDPA 2L7UA 3BHBB 4TSAL 3MLTA 4ZYKA 4NJ9H 2ZJSH 1G7IB 4HS3B 1EH9A 4YDLB 5GSVB 3SGEI 5ESAB 4Z7VE 1NCDH 1MWAA 4Q0XH 3C5JA 4AEHL 4MNGE 3UDWA 4LNVA 3VA6A 3RNQA 2FX9L 2R0KL 4L4VB 3VI4E 3DXAD 5JQ6L 5IIEA 5IR1B 1KSRA 1IKFH 4AZ8A 3RIAF 3CZFA 5GGVY 4OJFL 2QQLL 2PW2A 2JJSA 3KPOB 4JG0L 4L4VE 4C58B 3VWJC 2I9LB 5EU7E 1JGVH 5DMGC 4BQBA 5DJYA 4R9HA 4Z77B 4QWWD 3REVB 3EJYC 2NXYB 1H3VA 3K8LA 1MELA 1CZ8H 1WZKA 2JCCA 4J23A 5L88L 3RIFK 2B1HH 4JM4H 2WWKT 3CFIC 1AGBB 1MCPH 4MVBC 1CS6A 1FZMB 3GJFK 3IETA 3PE9A 2EKJA 5BXFB 2D7QA 2W92A 4JHWH 2DQEL 1AKJA 1GIGH 2IADA 3U36B 2XXMB 4KDVA 3EJZC 5DD0L 4LSRH 1ES0B 3T2PA 2AI0H 4PG2A 4F9LA 4XAWL 2QL1A 4TOYL 2R0ZH 2Y5EA 1G7JA 2EXWD 3IXAA 5FOBA 2AABL 2ZG3A 1NGZA 2MQ0A 4NCC2 1IZJA 4UIKH 1WAAE 2NY6B 3C60C 1EGJA 1XCTA 1N0XH 5HVGB 5A2LH 3RBSA 5A3IC 5E8EB 4R6UA 5KSAB 1X5ZA 5F7WC 2LU3A 3VXRD 4MMZC 2APBA 5C08D 1BQHB 1J18A 2F5AL 2KUTA 1ZT7A 1A0QH 2PW1A 3EHBD 2NXZB 5GZOD 3ELAT 3I50H 4UV7L 2FB4H 4K07A 3IDIB 4ZFFB 1UJTA 2XN9A 1IKNC 5J7CC 1HH6B 1DFBL 3WEXB 1MVUB 4JFQA 5GGQH 5BO1H 1UJ3C 3CSGA 4NN5B 4S2SA 2WZPD 2VXUL 5D1QC 1KIRB 2FO4B 3KJ6L 3ARWA 5EO9A 1ED3B 1HYSD 4DW2L 4R7NA 2J8HA 4KROD 3WD5H 1N2RA 3LAFA 5INCA 3NIDF 5HI4C 4ODUA 3PWJB 4PY7B 2A74B 5E1HB 1IFHH 1MCHA 2Z31A 2V2TB 2ERJB 3MRPA 1B88A 4ZO7A 4POYA 4OLEA 3RVVD 1OP5H 3U7YL 3MRBB 4X80H 4BH8B 1UM4L 1MNUL 3JTSA 5F1OB 1A1MA 1WCBB 3QI9C 5IQ7H 4GRLC 4R97C 3RZWA 1TZIB 2NX5A 5AAWA 1HCVA 3VXMD 5F6IC 1MHHB 2GTWA 4O00A 1QFUL 3D39D 4M9PA 3H0TB 2D0GA 2NR6D 5E9DD 1WTGT 2HRPH 2F53A 1K4DB 2RFXA 1CGUA 3P4NB 1UC6A 4FG6D 3BYYA 4K3EH 1NQBA 1JWMA 3B2UD 1RVFH 3TBVA 1GGBL 3KPTA 3VCLA 1U92A 1DBKH 3VI3F 5E5RB 5L8KB 4KY1H 5IBUG 4H20L 3L5HA 1CFTB 1WBXA 3BWAA 2HKFH 3S4SB 5E1AB 2F5BL 5E8OB 3IFNH 4F7MB 5J12B 4HPYL 5F7DB 2XQBH 4PJ9C 3V4UL 1RIVL 1SBBA 4NC2B 3VXTA 5FCUH 4LDOB 3U82B 3QNXB 3VFOA 1R3KB 5BMFL 3CDGB 1N7ML 1R6VA 4L9LC 3VA2C 3QAZC 4NDMA 5IHUH 3HNVL 4KKAD 3ILQD 5J13C 4OCLC 3CFJA 5BW7A 1OGAD 3ULUH 4NM4L 1BEYL 3TC9A 2QQKH 2VL5B 2ADGA 2ZUYA 3SGKC 3C6LA 2PXYB 1Q9KA 1XR8B 1R0AL 5CZXD 4APQB 1MCFA 4FQHA 1EXUA 1GHFL 3T8XB 4WUUB 1S5HB 2WIMA 3O41A 1CBVL 2MCPL 5ANMB 4XP5L 5MENB 3GBLA 5C0CA 1TQBB 3M8OH 4FP8H 5BZWB 3TH4T 2X2YA 5E7FA 4WUUE 3IRPX 1KCVL 4OFPA 4PRPD 1DANT 2XV6B 3GO1L 3T04D 4XI5C 3K2UL 2DICA 4KK6D 5DMJB 3ZDZF 5ANME 1YY8A 2ZUWA 5CIPA 4AIZA 4Z7UA 2VR9A 5JTWA 5MENE 1YNLH 1GGCL 5KJRH 2JELL 1VFBB 1IM3A 3HMXL 1T7YA 3MV01 1AC0A 2DBLH 5AYUH 3CX5J 1KXVC 4G6JL 4LU5H 1M7XA 1N5AB 1DQJA 5C09B 4B0MM 1LILA 3I9GL 3B3IB 4POZC 3GKWH 1RIHL 2ADJB 3WS3A 1KTRL 3CUPB 3QBTB 3PQYA 1UM5L 4BFIB 3S7GA 3I2CL 1O7VA 5HDBF 2XXCB 5LVEA 5HYSG 5C09E 2UZYB 3LPFA 3WUZA 5GGSA 2BERA 3SE8H 1Q94A 5J11C 4P2YA 3S5LB 2D0FA 2ADIB 2CK2A 1TITA 2E27H 1T6WA 2P8LA 3KXFD 1BLNA 2ZNWA 3E2HA 1AXSA 3B9KC 5SWSA 3MLZL 3MGOB 4OT1L 1NBYB 2XZAL 4K7PL 4AYFA 1QO3A 4D0DA 3RJDA 5BVPH 1SVZA 5HVFB 1U58A 4XXDB 4NUGL 3HLAB 4UBDC 3MACH 2W0PA 2OL3A 1MFCL 4I0KA 4ZQKB 5IVZA 4WNQA 1IJ9A 3NCBB 1I9JH 3SE9H 3AROA 5I75C 5AG9A 1B2WL 2HYMA 2HT4D 4J3XA 3U0PB 4K9EL 2AXGB 5F9WC 4JEGB 4DVBA 4ACPA 4XTRD 3BMVA 2D3VA 4CAGA 2VJXA 3HAEG 4YHKH 5JW4M 4UTBH 4D8PA 3CFBB 1HSBA 1LQSR 3S8WA 1JZ6A 3PIQB 4PJ5A 3TBSB 3VFPA 2G60H 4LMQE 2X4UA 3QNZB 3MLTB 2YK1H 4N8CL 4ZYKB 5DVOA 1SYVA 4ERSH 1INQA 3ARDA 4A6YH 2VQTA 4NNXA 1MCSA 4UUJB 2VLKB 4AQOA 2AJ3A 3OAZK 4QXGH 3C5JB 2FEEL 4LSSL 1A7RL 2KPNA 4NO0D 5FECA 1XGYH 2NY0D 1PGRB 4PLOB 4XCEA 5D7LA 3PWVA 3U9PH 4GT7A 3QG7L 1CXLA 5IWLC 2VLKE 3NFSH 5CBEB 3PDOA 3JSSA 2PW2B 1JIBA 1G9MH 1WV7T 1LP9F 2V17L 1ITBB 2V5SA 4OCRL 3VGDA 1MRDH 2HKHL 1S7QA 4HCRH 4KDWA 4OFYD 4O9HL 1YY9C 1ETZA 4OGAD 3M17A 2JCCB 4M43L 4PLKD 3LD8B 4OF6A 5T1LA 4GFTB 3W0WB 1IVLA 3EO1A 3D2UA 1N6UA 1QRND 4TSCH 1ACZA 5MHSD 1T83C 2IPUK 3WKML 1YMMA 3UBXB 3P2TA 4KZDL 4E9LA 2BOBB 3ZE1E 1OT2A 4J2XA 3KYMB 5EZOL 2JCCE 4TVSa 3ORJA 2NY3D 1T1YA 3W0WE 1F8TH 4WIQA 4LFHD 5EIVA 1UB6A 2UYLA 1NAMA 3IXAB 1BREA 5FOBB 2R0WL 4S1DC 1FVDB 1NGZB 2WQRA 2DD8L 3BUTA 3IDXL 3KG5A 1G0XA 4HWBH 5JPMA 3LEXA 3MO1A 5FM5O 3NCYP 1J0YA 4HBQA 3PWUA 2GW5A 2RHEA 3KPRB 1ZT7B 2Z9TA 3L9RA 2PW1B 1AJ7L 4BM7A 3I02A 3A6BH 4EXKA 4LF3A 5T1KB 3FB7B 5F1KC 1L6ZA 2XN9B 4UIMB 1EHXA 2K3TA 5EZLB 2EKSA 4BFEA 4NHCL 1NCCH 1T66D 1MFDL 5IF0A 3FTGA 3KPRE 1RUPL 4O2CA 4OLWL 2FDBP 4D0CA 1KTDA 5EO9B 2XN9E 3A6CH 4MA1C 4LLYA 5DQDL 3G5YB 1SBSL