3MSHA

Crystal structure of hepatitis b x-interacting protein at high resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
b'MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatitis B virus X-interacting protein
molecule tags Protein binding
source organism Homo sapiens
publication title Structural Characterization of HBXIP: The Protein That Interacts with the Anti-Apoptotic Protein Survivin and the Oncogenic Viral Protein HBx.
pubmed doi rcsb
total genus 20
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16672 LAMTOR5 Ragulator complex protein LAMTOR5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3mshA00
1Z09A 2V8FA 2BTFP 1G5UA 5EM0A 1PRQA 1VETB 2VK3A 3NECA 3T1QB 5FEGA 3T1XA 3LEQA 1Y4OA 1VEUB 1CJFA 3T12B 1A0KA 3DAVA 2ZL1B 1CQAA 1D1JA 3LGOA 1YPRA 3CPTB 2ACGA 2PRFA 4QWOA 3UB5P 2V8CA 1VETA 1AWIA 2JKGA 4FTXA 4X1LA 1SZVA 1J3WA 1K0KA 1VEUA 3L9KA 2E8JA 2B95A 2HZ5A 5FDSA 4ESPA 4FUWA 1FIKA 1CF0A 1PFLA 3MSHA 1ACFA 2JKFA 5FEFA 5EVEA 4D60A 3MS6A 3CHWP 1FILA 3L7HA 2PAVP 4X25A 1HLUP 1SKOB 1SKOA 2PBDP 4X1MA 5EV0A 3D9YA 5EM1A 3NULA 1F2KA 3T1RA 3CPTA 3U4LP 3T1SA 2ZL1A 3KYEA 1PNEA
chains in the Genus database with same CATH superfamily
3M2JA 3U2AA 1VM1A 3F1OB 4KZ9A 1MKIA 2DCFA 2Z2LB 3OZHA 5IT5A 5GLBA 4K91A 5TBMA 3V39A 3GQZA 3O88A 1S0WA 4DKIA 2J8YA 4FTXA 2FFFB 4Q0JA 2E8JA 3KYZA 2QWSA 2WGVA 1N4OA 1KGFA 5CHMA 2A24A 2PR6A 2Y55A 4HBTA 3T1RA 5EPHA 2R9XA 1N9LA 1Q2QA 4GOGA 5DJTA 4M3KA 1NYYA 4MMNA 2NUTC 3QNBA 1P9WA 3B33A 3IX3A 1SZVA 5M19A 3S7PA 3LR4A 1LHYA 3OLOA 1EW0A 1BULA 5CTMA 4I3IA 4GD8A 3D9YA 5HAPA 5CECA 3IH9A 5G4YA 1ESUA 4YOFA 1HVBA 1I5QA 4R38A 3E2LA 4GB7A 4KZ4A 1D7EA 1V9YA 4B9OA 2IWCA 2WKEA 4BBVA 3VOYA 1YLYA 4BJPA 3P01A 5FAPA 2Y2PA 4L0LA 4FOFA 1KOUA 4BL2A 4DDYA 2VJWA 3W8KA 1K54C 3UB6A 4OOYA 1K38A 1DP6A 2XDMA 2OAP1 3PBNA 1NLZA 3H9WA 2V1ZA 5GHZA 3M2KA 2ZM0A 4X1LA 3PBSA 5KSCA 3A0SA 3P09A 5E43A 1KDSA 4ZRRA 4AFIA 3BECA 4EEUA 3G30A 4E3JA 1IEMA 3FWLA 2FH5A 2X01A 4OLDA 4ZAMA 1L0GA 3CAXA 4WYYA 1N9OA 4Y0OA 3PR6A 4G3WA 3NI9A 2CC1A 5TGFA 1UWNX 3Q7ZA 4KQQA 4WEJA 3BQ8A 4HOIA 2XSSA 5IS1A 3A3JA 2YKHA 2W3DA 2MJ6A 2QPNA 2I72A 3PBTA 3ZCZA 2GNXA 4LV2A 5A93A 5FAQA 2HJEA 4MLLA 1JNUA 3GMWA 3ULFA 3UB7A 2Y59A 2Z6DA 3MQ0A 4LLOB 2Y2QA 3UDFA 4EWFA 2ZJ9A 3VE4A 3NIAA 1VEUA 1PWGA 4UQIS 1HZOA 4HJ6A 1W63Q 2EWVA 3MS6A 3A3IA 4OPQA 2ZC5B 3NY4A 3RXXA 4HESA 5CEBA 5DKLA 3UPPA 1LLBA 4NXEA 5G18A 1CI8A 4K08A 2PAVP 5DF9A 3SH7A 4KZ3A 4HY8A 5EFWA 4LCMA 4O7DA 2HDSA 2OSUA 4S2JA 4MN7A 4NETA 2VGKA 3RXWA 5I94A 4P6ZS 2Z2MB 1E25A 1YQSA 3UE3A 5IU1A 3LCEA 1XA7A 4K0WA 3TJZC 1LT0A 4KG2A 1MXOA 2JC7A 2WGWB 3HLEA 2E8IA 4KZ5A 1H5XA 2Y2HA 3S22A 5EVEA 4WLAA 2JE5A 4GNUA 3IBJA 2ZMFA 4WEKA 2EXBA 4X6TA 4GHIA 1A0KA 4XT2B 4Y7PA 1SHVA 1ZG4A 4RX3A 2P9VA 5FDSA 1PI5A 1ALQA 2VGJA 3GTCA 3SH9A 5KZHA 3EWKA 3IXHA 2Q9MA 4O8GA 2ZC7A 1H8ZA 4IJGA 4U0TA 3BW6A 5FQJA 4L9GA 5HAQA 3I7JA 3ZHHA 1H0MA 4C75A 1YLWA 2UV0E 4OPRA 1K6RA 2PYPA 4BD0A 1ES2A 3WS2A 4UA7A 4MEZA 1UWPX 1K56A 4ZJ2A 3NOPC 5DFYA 2V8FA 2BTFP 2L1MA 2V8CA 5L07A 5HWWA 2J9PA 2XK1A 2KOIA 3F1NA 1PWCA 1Q2PA 4FH4A 3BM6A 4FD8A 3IXDA 4ETXA 3K3DA 1ZHHB 3C7VA 3VMAA 2I9VA 3ZDJA 1ZC2A 1AXBA 1S66L 3NOUC 4EW7A 3NDEA 3CI6A 1W7FA 4B88A 4P6BA 5AQ9A 3MXQA 3LIBA 3NHQA 3HJIA 5G4ZA 2ZQ8A 1IYSA 4GZBA 3LFVA 1NYMA 3ZVWA 1SKOB 4Q8IA 4GDBA 2B5RA 4PHTA 3UMDA 2G7UA 3H82B 1BTLA 4BENA 5JYOA 3PHYA 1M40A 3S7OA 1JWVA 1XJ2A 3CWFA 3E0YA 3UE6A 5F83A 2PR5A 3O3VA 2VEAA 1F5MA 3IHAA 4DE3A 4EESA 2XEPA 3D72A 1CI9A 5J3WA 1IFQA 4WUJA 3LYXA 2A49A 4KQOA 1OTBA 2O9AA 1N9BA 2GDNA 2V1AA 3ZVTA 3BLMA 3C5AA 3ZQ5A 2JHEA 3BWLA 2K31A 4IVIA 2XA7M 2H0YA 1D06A 1GHPA 3FG8A 4S2KA 3O86A 1E3UD 3IX8A 5FQQA 4D2OA 1E4DA 1KVMA 1YSQA 4CQHA 5FEGA 4ARZB 1OPXA 1D1JA 1P0ZA 2H5SA 3HLGA 4OQ0A 2WKRA 1W5DA 2QMIA 4JGOA 3ZG8B 1OT6A 3GVBA 3IF5A 1E3UA 3V5MA 1I2WA 1Y4OA 5AQ7A 4PKYA 3HUMA 3OCLA 3A3EA 2OWHA 5E2HA 1CF0A 3CUEA 4N1XA 4ZTKA 4JF5A 5HX9A 1GHIA 4GJ4A 5LBRA 4DE2A 5HWVA 4I39A 3UB8A 4PM9A 2PU4A 3UPNA 2ZC3B 4CLCD 1YLPA 3GR2A 1J3WA 4ESPA 2VLGA 4FUWA 3F1PB 4JGQA 2ZM2A 3N8RA 1MWUA 4I38A 3W4OA 3MMHA 4E3OA 4U3TA 1DJAA 2HDRA 4QHCA 3HLFA 2JKRM 3R7WB 3MXSA 3NC8A 1NRJA 1KE4A 2DRWA 4BWIA 3F1OA 5FASA 3IWIA 3N6IA 3CLOA 4MBHA 2EXAA 1ACFA 3T4KA 2V2FF 4EQ1A 3B3XA 3QP2A 1L0DA 5DTSA 5F68A 1T1AA 3EQUA 1ZKJA 3MFXA 3Q82A 1PWDA 3HUNA 1WA9A 2XFSA 1L0FA 3LIDA 1MC0A 3LI8A 4ZBEA 1K56D 1SDEA 5GLCA 2W1TA 1NZUA 1DRMA 1P9RA 3ZG7B 5EVIC 5MC7A 5IHVA 1YT4A 4QY6A 4N9LA 4DE1A 2PBYA 2PT7A 3LI9A 1JTGA 2LB9A 2ZQ9A 2Q0OA 5EVIA 5EVIB 4EU0A 4R3AA 1BSGA 3TW8A 4LRXC 5CEDA 4N1HA 2A3UA 2D02A 4GS9A 2IWBA 1U60A 2C5WB 2Y2KA 1ERMA 1FSWA 4EBNA 1SDNA 3ITAA 1ES4A 1G5UA 3CZDA 3NBLA 2H28A 2B02A 1TS7A 2WZZA 1K4FA 2WKHA 5EECA 5CGXA 5AJGA 3KSGA 3JVVA 3QP4A 3IF6A 4R1GA 1NZOA 4FSFA 4OONA 2H0TA 2VV6A 4KG5A 1XJ6A 3HBRA 3NECA 4OP8A 4DXCA 3UE1A 3PBOA 5HW3A 4R3BA 4C6YA 3UPOA 2WGIA 1JTDA 1M6KA 1S4SA 1FIKA 4PMAA 2XD1A 5HAIA 1X0OA 3PBQA 1VQQA 3K3CA 3PTEA 3Q7VA 4WF0A 3S4XA 3DAVA 2HPBA 4NXBA 3E4OA 2W3HA 3AGFA 4KZ7A 3ZFZA 4B93A 2Z6CA 1DJCA 1T1BA 2GZAA 2XA7S 2QKPA 4OQGA 3F1NB 1BZAA 5L09A 3ZNTA 3NULA 1CEGA 3Q7VB 3KO6A 5GL9A 5CERA 1GSWA 4HJ3A 5U47A 3MR0A 2ZD8A 5I5LA 1BYWA 2W27A 2DNSA 4IHQA 3LIEA 2M1CA 5F69A 3PYPA 1UGUA 3CHWP 3P98A 3VV4A 2R9WA 3N8LA 5HARA 3VP0A 4IUKA 4UEYA 1LL8A 4Z1WA 5E2FA 1JVJA 3LUQA 1PIOA 5DVAA 1IYPA 2VV7A 4BD1A 3DTEA 4LGWA 4I5SA 2A24B 2EX2A 4H8RA 3VOLA 2Y2JA 3MSHA 2HP5A 2JKFA 4GN2A 3OPRA 1LSWA 4R4SA 1SKOA 1FQGA 1W8QA 1XJ4A 4S2LA 3QP5A 4OPZA 4RYEA 4IBRA 1YM1A 2XH9A 5GLAA 5J4EA 1W63M 1YLZA 2ZMAA 5F5YA 1T18A 2W0NA 1FOFA 4S2NA 3W2ZA 1MWTA 3V67A 1LL9A 2VA0A 1ZTUA 2XRNA 3NJAA 3IS2A 4NEED 2BG1A 1K6SA 4FH2A 1S6RA 5CTNA 5FATA 3MQQA 3ZG9B 1KGEA 2V1BA 3NDGA 3ZYTA 4CLCB 1PW1A 4KZ8A 2PU2A 3DW0A 3WRTA 3UN7A 2P08A 5EVLA 4PAUA 5DKKA 3LEZA 2JBFA 2V9AA 3VFFA 4BBTA 4MNRA 3FKWA 1TS8A 4U0XA 2X02A 3ZG5A 3KYQA 2ZL1B 1G28A 1G6OA 3FV7A 2BLSA 1H3QA 2B95A 4NXFA 3EOIA 4JXVA 4Y17A 1YMSA 2WKIA 1EI5A 4NK3A 3S1YA 3V3RA 3BFDA 3C38A 1VETB 4WL9A 3CG5A 2QJ5A 2J3TC 2G2UA 4HIAA 3HL9A 3BRMA 3OPLA 3MXRA 3ZNYA 4EEPA 2XQZA 3N8SA 1G68A 2EX9A 4HBUA 4HQAA 2ZOIA 1Z6FA 2V0WA 5M1AA 3EGDC 2P74A 4M4XA 1MWSA 4Y2FA 4KQDA 5FAOA 5HPIA 3DTIA 1OMEA 2M7UA 4PM7A 4LPZA 1XP4A 3FC7A 1IKGA 2R78A 3G32A 4NXGA 1XGJA 2XFTA 3QP8A 4JGPA 5AQBA 4Y13A 3OPHA 3BFGA 4EETB 3GV9A 1H8YA 2VK3A 4JLFA 5EUAA 3QP1A 1OJGA 3CPTB 5FI7A 2PYRA 1ES3A 3IXGA 1VB6A 1KVLA 4ZJ3A 4K0XA 3TSGA 3WWXA 5FEFA 1H8MA 3VSLA 4DDSA 3DWKA 2JN7A 3WRZA 1Y28A 1K55C 2Y2OA 4BLMA 3IS2B 4DF6A 5TBMB 3IH8A 1K54A 3JYIA 4GS9B 1K57C 4N9KA 2JKTM 1LI9A 5E2GA 4L9FA 3UNWA 3WS0A 3V50A 4X68A 4EBPA 3G4PA 1F98A 1GA0A 3LO7A 4JPMA 4DJ3A 4IEDA 1NXYA 3M6BA 2W1RA 1EROA 2XD5A 4B4XA 5J8XA 5HDSA 3JPUA 3G6OA 2QZ6A 2ZBBA 2W3EA 2M7VA 4OP5A 3N4IA 4DE0A 2AVXA 2UWXA 3VP2A 4HH3A 4WM9A 5DF7A 3O5YA 1GA9A 1HTZA 3N7WA 2WKQA 3TRCA 4F3LB 1RP5A 1QMFA 1SCWA 3WS1A 5TFQA 1PNEA 5HD3A 5L2FA 2HJ9C 4PPRA 2ZC4B 3BY8A 5J7EA 4LCLA 3T4QA 1I2SA 4RVAA 1CK3A 1NLYA 3LR3A 4DMZA 1KE0A 4FCFA 1VETA 3K2NA 4X53A 3MZFA 1S4RA 4OOMA 2L0WA 3Q81A 1GCEA 2HF6A 4DN0A 4P0MA 4UHUA 1KE3A 4DRTA 4EBLA 1P97A 1IYQA 3B42A 1OT9A 1C3BA 4GDNA 4ETZA 4G3VA 5KIZA 3HLBA 3UDIA 4WMCA 4LRZE 2K2NA 4DJ2A 3BY9A 4ID4A 1MZUA 3IX4A 5FQIA 4HJ4A 2WK0A 3G35A 1OTEA 3MF0A 5A90A 2WGWA 1TS0A 3S7QA 4CLCA 1JWZA 2J3TD 4PM6A 4KZBA 1LSXA 2VGLS 3DTKA 4XUZA 4NKPA 2QYBA 3QNCA 4HI4A 4H6JA 3C4OA 4OVDA 1ESIA 3ZG0A 3ITBA 4OKPA 2ZC6B 3LGOA 3IWQA 2OV5A 3NCKA 1RCJA 3KSFA 4XT2A 1NWZA 2ZQDA 2WADA 3KSIA 3LY4A 2P9VB 2Y4AA 2XF3A 4MCWA 5A91A 5TR7A 4UA6A 4XUXA 2PDRA 4GKUA 4Y5FA 1K25A 3C7UA 1CJFA 2LB5A 2H10A 1YPRA 3OOVA 4LV3A 4LV1A 4PKYG 3VSKA 3SZTA 1FCMA 1F2KA 4E3KA 3MKFA 1TD5A 1VHMA 2OLVA 2ZLYA 1XKZA 3OCNA 3VE3A 3RTYA 1JWPA 2NUPC 1K4EA 5GLDA 3BYDA 3G2ZA 3SS5A 2HP6A 5F82A 4KZ6A 2VX8A 2B18A 1HLUP 1OTIA 5EV0A 5EM1A 4ZJ1A 4XXRA 2WKPA 4KQRA 5CXWA 1VEUB 3T12B 4HH2A 4PM5A 2Y2GA 3QHYA 1PFLA 5GHYA 1MBLA 3HLWA 3EGXC 1T19A 3VP3A 2ZL1A 4E3LA 1TDGA 1IKIA 3W4PA 4EQIA 1FCOA 3UE0A 4S2MA 2VGLM 3ICYA 5D3OA 3UB5P 4BMWA 4JF4A 4ZDXA 3FYZA 4JXGA 2W3GA 3BFFA 3QP6A 4KZAA 1XGIA 4KG6A 1OTDA 4G3KA 4EV4A 3T1SA 1YSPA 3MJQA 5GHXA 4JXWA 4QJGA 2OAQ1 1XXMA 3CITA 2BASA 1L3LA 3DWZA 2J9OA 3HUOA 3IF6B 2O9BA 3BEBA 2JKGA 3G2YA 1KGGA 4Q0HA 5FA7A 2P04A 1XJ3A 3HVFA 2PBDP 2CMNA 4UA9A 3IBRA 2O99A 5EVID 4O0PA 1ONHA 3MZEA 3WS4A 2Y91A 4IBXA 4YINA 3FPVA 1FCNA 5F1GA 2WAFA 3FPWA 5HDCA 3T4LA 4KUOA 2Q9NA 4BL3A 1LL5A 3D4FA 1PYYA 4A5RA 2XROA 2OOLA 3T1QB 2HV1A 5FI6A 1MWRA 2QHKA 1XFNA 4MDZA 2K7SA 4Y0UA 5FQ9A 4OPYA 1FR1A 3LICA 2Y2NA 4R6LA 2W3FA 3R4KA 4QPRA 3LIFA 4Y3IA 3SH8A 2KLIA 5C5KA 5AQAA 2J7VA 3A3DA 3B47A 3KYEA 4E3NA 1NJ4A 3C4PA 1K55A 1BT5A 4E04A 2L4RA 1MKMA 1LI0A 4WZ4A 2ZQAA 4OLGA 3GRJA 3PBRA 4X25A 2ZMVA 3HLCA 1BLCA 1DY6A 3T1XA 1XA1A 4CLCE 3LEQA 2INWA 3G34A 3T4OA 5DJUA 1AWIA 1YAXA 3L9KA 2PD7A 4R4RA 1S67L 2HDUA 3KSHA 4P87A 4D60A 3RJUA 2RL3A 3VOZA 1G6AA 4KUKA 1XX2A 1OTAA 5M18A 2JCHA 3E4PA 4E6XA 3KX0X 3LIAA 5DFXA 4EUVA 3CMZA 3A0VA 3M6HA 1MY8A 4GW9A 1YKDA 1YLTA 5KMWA 5F6AA 3UO9A 3DBAA 3BJNA 4HP4A 3LR0A 4QWOA 3MKEA 4WMCD 4R70A 2ZOHA 2GJ3A 5FQKA 2WAEA 3MZDA 5K5BA 5DF8A 4Y0TA 4X1MA 4F94A 2Y8HA 4EUZA 5CGSA 4F3LA 4R23A 1XPBA 2KDKA 3C30A 5EM0A 2Y2LA 2ZQCA 2EX6A 5CRFA 2EX8A 1CQAA 2EA9A 1IELA 3IF6C 1L2SA 1IOUA 1YMXA 4JBFA 2WZXA 1LSVA 3TE8A 4QB8A 1F9IA 1ONGA 3UMEA 3GECA 2PHYA 3MQOA 1PW8A 3RFBA 4II7A 3BFEA 2HDQA 2GX5A 5FI2A 2A2LA 2EFXA 4QY5A 3SS3A 3HREA 4B4ZA 2VV8A 1YLJA 4JF6A 2HZ5A 3BFCA 5CHUA 4DXBA 3V3SA 5HWTA 3FKVA 3SOIA 4WZ5A 3IXBA 4WN5A 3U4LP 3VP4A 4L9EA 4KENB 3CUEC 4RA7A 2HGVA 1PZOA 5EOOA 4HHDA 3P7NA 5CHJA 3IT9A 4GCZA 3TG9A 2X71A 3E2KA 1GHMA 5HL1A 3T50A 3F1PA 2WYXA 1RGZA 4QD4A 4MBKA 4UQIM 3C8CA 3CPTA 3HJKA 5AVFA 1FSYA 3DTMA 4H6JB 3EEAA 2ACGA 1TEMA 1STZA 4ME4A 5L8MA 2XR0A 3UDXA 4Q0IA 3OC2A 1PI4A 4GLQA 1BLPA 3LY3A 4UAAA 4LV0A 1BLHA 5CX7A 4BBUA 5HD5A 3D3OA 1W79A 4IUHA 3G31A 4LENA 5TJJA 1NY0A 2HP9A 1S1ZA 5A8BA 4CJNA 1TVFA 1RGYA 2EFUA 4QU3A 3UY6A 3MBZA 2D01A 2XGNA 5HSQA 1BUEA 5JYPA 4OQHA 3UB9A 2IA2A 4I3JA 3RH8B 3AGEA 4E3IA 4HP9A 5DTKA 3H7WA 2FFYA 1FILA 4S2NC 1W8YA 1ERQA 4OOLA 5BOHA 4LRYC 4WELA 2WUQA 3AGDA 4JGRA 1O7EA 1BLSA 3GSGA 3T4TA 3WS5A 4S2OA 4JXSA 4HEFA 2ZQ7A 2ZM8A 4N92A 3TOIA 4YNRA 2DMWA 4EERA 2QJ7A 2VZWA 4RX2A 4P85A 5DTTA 2W1TB 1K57A 2J3WA 4GHIB 4YWZA 4MBFA 2C6WB 1NRFA 1L0EA 4CLCC 3H82A 4WZ5C 2P7JA 5FSRA 4I3AA 1DP8A 4X56A 4X69A 1DJBA 2IWDA 5EE8A 2YKFA 3BLSA 4C3QA 2KX6A 1TDLA 1TF1A 1IYOA 4BQMA 3A0RA 3JVUA 1GSVA 3A3FA 4LFUA 2V20A 3T4JA 2O9CA 5FL3A 3PAGA 3W4QA 2Y2IA 3ZGAB 3PAEA 4OQIA 3EQVA 5HPFA 1OJ5A 1EWZA 4S2PA 4YFMA 4PM8A 1HD8A 2EWWA 4HNBA 4S2IA 3T4SA 1WYCA 3IWOA 3IHBA 1DP9A 1XFQA 5HDDA 3OPPA 4E6WA 4P6ZM 2JKTI 5HFOA 2JKRI 4Y15A 3R7WA 3SW1A 4WBGA 4JKTA 5F1FA 1Y54A 5AVEA 4Z9QA 3EEHA 5FQMA 2FZ0A 3GDIA 5L10A 3Q1FA 3VFHA 3H7WB 2V0UA 1CEFA 4CPKA 5FDHA 1S1YA 3E4QA 1T1CA 3O87A 5CGWA 3VP1A 3HLDA 2PRFA 5EOEA 1ES5A 3HCYA 2O0YA 4MN5A 2OWJA 5HL6A 1FR6A 4E3MA 3OBFA 1GSXA 1QMEA 3ISGA 4NG2A 4MN6A 1Z09A 1V9ZA 3FZCA 2OLUA 1O07A 3Q07A 3NOTC 2VKSA 4R3JA 2Y2MA 1K0KA 2Y79A 1J9MA 4OH0A 2J80A 4IVKA 3L7HA 3IQAA 4GD6A 1ZG6A 3SS4A 1KDWA 3C2WA 2XLNA 1SKFA 3PXPA 5E2EA 5A92A 1ODVA 1PRQA 5KSHA 2PD8A 2RCXA 1N9NA 3MFDA 4RQ9A 3LR5A 3E98A 4O01A 4R0QA 4EXOA 4X55A 2G2WA 3S7NA 3BQAA 1MPLA 1WYBA 1WE4A 5HZHA 1PZPA 4ARZA 1TS6A 3CJMA
chains in the Genus database with same CATH topology
1Z09A 2V8FA 2BTFP 1G5UA 5EM0A 1PRQA 1VETB 2VK3A 3NECA 3T1QB 5FEGA 3T1XA 3LEQA 1Y4OA 1VEUB 1CJFA 3T12B 1A0KA 3DAVA 2ZL1B 1CQAA 1D1JA 3LGOA 1YPRA 3CPTB 2ACGA 2PRFA 4QWOA 3UB5P 2V8CA 1VETA 1AWIA 2JKGA 4FTXA 4X1LA 1SZVA 1J3WA 1K0KA 1VEUA 3L9KA 2E8JA 2B95A 2HZ5A 5FDSA 4ESPA 4FUWA 1FIKA 1CF0A 1PFLA 3MSHA 1ACFA 2JKFA 5FEFA 5EVEA 4D60A 3MS6A 3CHWP 1FILA 3L7HA 2PAVP 4X25A 1HLUP 1SKOB 1SKOA 2PBDP 4X1MA 5EV0A 3D9YA 5EM1A 3NULA 1F2KA 3T1RA 3CPTA 3U4LP 3T1SA 2ZL1A 3KYEA 1PNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z09 A;  2V8F A;  2BTF P;  1G5U A;  5EM0 A;  1PRQ A;  1VET B;  2VK3 A;  3NEC A;  3T1Q B;  5FEG A;  3T1X A;  3LEQ A;  1Y4O A;  1VEU B;  1CJF A;  3T12 B;  1A0K A;  3DAV A;  2ZL1 B;  1CQA A;  1D1J A;  3LGO A;  1YPR A;  3CPT B;  2ACG A;  2PRF A;  4QWO A;  3UB5 P;  2V8C A;  1VET A;  1AWI A;  2JKG A;  4FTX A;  4X1L A;  1SZV A;  1J3W A;  1K0K A;  1VEU A;  3L9K A;  2E8J A;  2B95 A;  2HZ5 A;  5FDS A;  4ESP A;  4FUW A;  1FIK A;  1CF0 A;  1PFL A;  3MSH A;  1ACF A;  2JKF A;  5FEF A;  5EVE A;  4D60 A;  3MS6 A;  3CHW P;  1FIL A;  3L7H A;  2PAV P;  4X25 A;  1HLU P;  1SKO B;  1SKO A;  2PBD P;  4X1M A;  5EV0 A;  3D9Y A;  5EM1 A;  3NUL A;  1F2K A;  3T1R A;  3CPT A;  3U4L P;  3T1S A;  2ZL1 A;  3KYE A;  1PNE A; 
#chains in the Genus database with same CATH topology
 3M2J A;  3U2A A;  1VM1 A;  3F1O B;  4KZ9 A;  1MKI A;  2DCF A;  2Z2L B;  3OZH A;  5IT5 A;  5GLB A;  4K91 A;  5TBM A;  3V39 A;  3GQZ A;  3O88 A;  1S0W A;  4DKI A;  2J8Y A;  4FTX A;  2FFF B;  4Q0J A;  2E8J A;  3KYZ A;  2QWS A;  2WGV A;  1N4O A;  1KGF A;  5CHM A;  2A24 A;  2PR6 A;  2Y55 A;  4HBT A;  3T1R A;  5EPH A;  2R9X A;  1N9L A;  1Q2Q A;  4GOG A;  5DJT A;  4M3K A;  1NYY A;  4MMN A;  2NUT C;  3QNB A;  1P9W A;  3B33 A;  3IX3 A;  1SZV A;  5M19 A;  3S7P A;  3LR4 A;  1LHY A;  3OLO A;  1EW0 A;  1BUL A;  5CTM A;  4I3I A;  4GD8 A;  3D9Y A;  5HAP A;  5CEC A;  3IH9 A;  5G4Y A;  1ESU A;  4YOF A;  1HVB A;  1I5Q A;  4R38 A;  3E2L A;  4GB7 A;  4KZ4 A;  1D7E A;  1V9Y A;  4B9O A;  2IWC A;  2WKE A;  4BBV A;  3VOY A;  1YLY A;  4BJP A;  3P01 A;  5FAP A;  2Y2P A;  4L0L A;  4FOF A;  1KOU A;  4BL2 A;  4DDY A;  2VJW A;  3W8K A;  1K54 C;  3UB6 A;  4OOY A;  1K38 A;  1DP6 A;  2XDM A;  2OAP 1;  3PBN A;  1NLZ A;  3H9W A;  2V1Z A;  5GHZ A;  3M2K A;  2ZM0 A;  4X1L A;  3PBS A;  5KSC A;  3A0S A;  3P09 A;  5E43 A;  1KDS A;  4ZRR A;  4AFI A;  3BEC A;  4EEU A;  3G30 A;  4E3J A;  1IEM A;  3FWL A;  2FH5 A;  2X01 A;  4OLD A;  4ZAM A;  1L0G A;  3CAX A;  4WYY A;  1N9O A;  4Y0O A;  3PR6 A;  4G3W A;  3NI9 A;  2CC1 A;  5TGF A;  1UWN X;  3Q7Z A;  4KQQ A;  4WEJ A;  3BQ8 A;  4HOI A;  2XSS A;  5IS1 A;  3A3J A;  2YKH A;  2W3D A;  2MJ6 A;  2QPN A;  2I72 A;  3PBT A;  3ZCZ A;  2GNX A;  4LV2 A;  5A93 A;  5FAQ A;  2HJE A;  4MLL A;  1JNU A;  3GMW A;  3ULF A;  3UB7 A;  2Y59 A;  2Z6D A;  3MQ0 A;  4LLO B;  2Y2Q A;  3UDF A;  4EWF A;  2ZJ9 A;  3VE4 A;  3NIA A;  1VEU A;  1PWG A;  4UQI S;  1HZO A;  4HJ6 A;  1W63 Q;  2EWV A;  3MS6 A;  3A3I A;  4OPQ A;  2ZC5 B;  3NY4 A;  3RXX A;  4HES A;  5CEB A;  5DKL A;  3UPP A;  1LLB A;  4NXE A;  5G18 A;  1CI8 A;  4K08 A;  2PAV P;  5DF9 A;  3SH7 A;  4KZ3 A;  4HY8 A;  5EFW A;  4LCM A;  4O7D A;  2HDS A;  2OSU A;  4S2J A;  4MN7 A;  4NET A;  2VGK A;  3RXW A;  5I94 A;  4P6Z S;  2Z2M B;  1E25 A;  1YQS A;  3UE3 A;  5IU1 A;  3LCE A;  1XA7 A;  4K0W A;  3TJZ C;  1LT0 A;  4KG2 A;  1MXO A;  2JC7 A;  2WGW B;  3HLE A;  2E8I A;  4KZ5 A;  1H5X A;  2Y2H A;  3S22 A;  5EVE A;  4WLA A;  2JE5 A;  4GNU A;  3IBJ A;  2ZMF A;  4WEK A;  2EXB A;  4X6T A;  4GHI A;  1A0K A;  4XT2 B;  4Y7P A;  1SHV A;  1ZG4 A;  4RX3 A;  2P9V A;  5FDS A;  1PI5 A;  1ALQ A;  2VGJ A;  3GTC A;  3SH9 A;  5KZH A;  3EWK A;  3IXH A;  2Q9M A;  4O8G A;  2ZC7 A;  1H8Z A;  4IJG A;  4U0T A;  3BW6 A;  5FQJ A;  4L9G A;  5HAQ A;  3I7J A;  3ZHH A;  1H0M A;  4C75 A;  1YLW A;  2UV0 E;  4OPR A;  1K6R A;  2PYP A;  4BD0 A;  1ES2 A;  3WS2 A;  4UA7 A;  4MEZ A;  1UWP X;  1K56 A;  4ZJ2 A;  3NOP C;  5DFY A;  2V8F A;  2BTF P;  2L1M A;  2V8C A;  5L07 A;  5HWW A;  2J9P A;  2XK1 A;  2KOI A;  3F1N A;  1PWC A;  1Q2P A;  4FH4 A;  3BM6 A;  4FD8 A;  3IXD A;  4ETX A;  3K3D A;  1ZHH B;  3C7V A;  3VMA A;  2I9V A;  3ZDJ A;  1ZC2 A;  1AXB A;  1S66 L;  3NOU C;  4EW7 A;  3NDE A;  3CI6 A;  1W7F A;  4B88 A;  4P6B A;  5AQ9 A;  3MXQ A;  3LIB A;  3NHQ A;  3HJI A;  5G4Z A;  2ZQ8 A;  1IYS A;  4GZB A;  3LFV A;  1NYM A;  3ZVW A;  1SKO B;  4Q8I A;  4GDB A;  2B5R A;  4PHT A;  3UMD A;  2G7U A;  3H82 B;  1BTL A;  4BEN A;  5JYO A;  3PHY A;  1M40 A;  3S7O A;  1JWV A;  1XJ2 A;  3CWF A;  3E0Y A;  3UE6 A;  5F83 A;  2PR5 A;  3O3V A;  2VEA A;  1F5M A;  3IHA A;  4DE3 A;  4EES A;  2XEP A;  3D72 A;  1CI9 A;  5J3W A;  1IFQ A;  4WUJ A;  3LYX A;  2A49 A;  4KQO A;  1OTB A;  2O9A A;  1N9B A;  2GDN A;  2V1A A;  3ZVT A;  3BLM A;  3C5A A;  3ZQ5 A;  2JHE A;  3BWL A;  2K31 A;  4IVI A;  2XA7 M;  2H0Y A;  1D06 A;  1GHP A;  3FG8 A;  4S2K A;  3O86 A;  1E3U D;  3IX8 A;  5FQQ A;  4D2O A;  1E4D A;  1KVM A;  1YSQ A;  4CQH A;  5FEG A;  4ARZ B;  1OPX A;  1D1J A;  1P0Z A;  2H5S A;  3HLG A;  4OQ0 A;  2WKR A;  1W5D A;  2QMI A;  4JGO A;  3ZG8 B;  1OT6 A;  3GVB A;  3IF5 A;  1E3U A;  3V5M A;  1I2W A;  1Y4O A;  5AQ7 A;  4PKY A;  3HUM A;  3OCL A;  3A3E A;  2OWH A;  5E2H A;  1CF0 A;  3CUE A;  4N1X A;  4ZTK A;  4JF5 A;  5HX9 A;  1GHI A;  4GJ4 A;  5LBR A;  4DE2 A;  5HWV A;  4I39 A;  3UB8 A;  4PM9 A;  2PU4 A;  3UPN A;  2ZC3 B;  4CLC D;  1YLP A;  3GR2 A;  1J3W A;  4ESP A;  2VLG A;  4FUW A;  3F1P B;  4JGQ A;  2ZM2 A;  3N8R A;  1MWU A;  4I38 A;  3W4O A;  3MMH A;  4E3O A;  4U3T A;  1DJA A;  2HDR A;  4QHC A;  3HLF A;  2JKR M;  3R7W B;  3MXS A;  3NC8 A;  1NRJ A;  1KE4 A;  2DRW A;  4BWI A;  3F1O A;  5FAS A;  3IWI A;  3N6I A;  3CLO A;  4MBH A;  2EXA A;  1ACF A;  3T4K A;  2V2F F;  4EQ1 A;  3B3X A;  3QP2 A;  1L0D A;  5DTS A;  5F68 A;  1T1A A;  3EQU A;  1ZKJ A;  3MFX A;  3Q82 A;  1PWD A;  3HUN A;  1WA9 A;  2XFS A;  1L0F A;  3LID A;  1MC0 A;  3LI8 A;  4ZBE A;  1K56 D;  1SDE A;  5GLC A;  2W1T A;  1NZU A;  1DRM A;  1P9R A;  3ZG7 B;  5EVI C;  5MC7 A;  5IHV A;  1YT4 A;  4QY6 A;  4N9L A;  4DE1 A;  2PBY A;  2PT7 A;  3LI9 A;  1JTG A;  2LB9 A;  2ZQ9 A;  2Q0O A;  5EVI A;  5EVI B;  4EU0 A;  4R3A A;  1BSG A;  3TW8 A;  4LRX C;  5CED A;  4N1H A;  2A3U A;  2D02 A;  4GS9 A;  2IWB A;  1U60 A;  2C5W B;  2Y2K A;  1ERM A;  1FSW A;  4EBN A;  1SDN A;  3ITA A;  1ES4 A;  1G5U A;  3CZD A;  3NBL A;  2H28 A;  2B02 A;  1TS7 A;  2WZZ A;  1K4F A;  2WKH A;  5EEC A;  5CGX A;  5AJG A;  3KSG A;  3JVV A;  3QP4 A;  3IF6 A;  4R1G A;  1NZO A;  4FSF A;  4OON A;  2H0T A;  2VV6 A;  4KG5 A;  1XJ6 A;  3HBR A;  3NEC A;  4OP8 A;  4DXC A;  3UE1 A;  3PBO A;  5HW3 A;  4R3B A;  4C6Y A;  3UPO A;  2WGI A;  1JTD A;  1M6K A;  1S4S A;  1FIK A;  4PMA A;  2XD1 A;  5HAI A;  1X0O A;  3PBQ A;  1VQQ A;  3K3C A;  3PTE A;  3Q7V A;  4WF0 A;  3S4X A;  3DAV A;  2HPB A;  4NXB A;  3E4O A;  2W3H A;  3AGF A;  4KZ7 A;  3ZFZ A;  4B93 A;  2Z6C A;  1DJC A;  1T1B A;  2GZA A;  2XA7 S;  2QKP A;  4OQG A;  3F1N B;  1BZA A;  5L09 A;  3ZNT A;  3NUL A;  1CEG A;  3Q7V B;  3KO6 A;  5GL9 A;  5CER A;  1GSW A;  4HJ3 A;  5U47 A;  3MR0 A;  2ZD8 A;  5I5L A;  1BYW A;  2W27 A;  2DNS A;  4IHQ A;  3LIE A;  2M1C A;  5F69 A;  3PYP A;  1UGU A;  3CHW P;  3P98 A;  3VV4 A;  2R9W A;  3N8L A;  5HAR A;  3VP0 A;  4IUK A;  4UEY A;  1LL8 A;  4Z1W A;  5E2F A;  1JVJ A;  3LUQ A;  1PIO A;  5DVA A;  1IYP A;  2VV7 A;  4BD1 A;  3DTE A;  4LGW A;  4I5S A;  2A24 B;  2EX2 A;  4H8R A;  3VOL A;  2Y2J A;  3MSH A;  2HP5 A;  2JKF A;  4GN2 A;  3OPR A;  1LSW A;  4R4S A;  1SKO A;  1FQG A;  1W8Q A;  1XJ4 A;  4S2L A;  3QP5 A;  4OPZ A;  4RYE A;  4IBR A;  1YM1 A;  2XH9 A;  5GLA A;  5J4E A;  1W63 M;  1YLZ A;  2ZMA A;  5F5Y A;  1T18 A;  2W0N A;  1FOF A;  4S2N A;  3W2Z A;  1MWT A;  3V67 A;  1LL9 A;  2VA0 A;  1ZTU A;  2XRN A;  3NJA A;  3IS2 A;  4NEE D;  2BG1 A;  1K6S A;  4FH2 A;  1S6R A;  5CTN A;  5FAT A;  3MQQ A;  3ZG9 B;  1KGE A;  2V1B A;  3NDG A;  3ZYT A;  4CLC B;  1PW1 A;  4KZ8 A;  2PU2 A;  3DW0 A;  3WRT A;  3UN7 A;  2P08 A;  5EVL A;  4PAU A;  5DKK A;  3LEZ A;  2JBF A;  2V9A A;  3VFF A;  4BBT A;  4MNR A;  3FKW A;  1TS8 A;  4U0X A;  2X02 A;  3ZG5 A;  3KYQ A;  2ZL1 B;  1G28 A;  1G6O A;  3FV7 A;  2BLS A;  1H3Q A;  2B95 A;  4NXF A;  3EOI A;  4JXV A;  4Y17 A;  1YMS A;  2WKI A;  1EI5 A;  4NK3 A;  3S1Y A;  3V3R A;  3BFD A;  3C38 A;  1VET B;  4WL9 A;  3CG5 A;  2QJ5 A;  2J3T C;  2G2U A;  4HIA A;  3HL9 A;  3BRM A;  3OPL A;  3MXR A;  3ZNY A;  4EEP A;  2XQZ A;  3N8S A;  1G68 A;  2EX9 A;  4HBU A;  4HQA A;  2ZOI A;  1Z6F A;  2V0W A;  5M1A A;  3EGD C;  2P74 A;  4M4X A;  1MWS A;  4Y2F A;  4KQD A;  5FAO A;  5HPI A;  3DTI A;  1OME A;  2M7U A;  4PM7 A;  4LPZ A;  1XP4 A;  3FC7 A;  1IKG A;  2R78 A;  3G32 A;  4NXG A;  1XGJ A;  2XFT A;  3QP8 A;  4JGP A;  5AQB A;  4Y13 A;  3OPH A;  3BFG A;  4EET B;  3GV9 A;  1H8Y A;  2VK3 A;  4JLF A;  5EUA A;  3QP1 A;  1OJG A;  3CPT B;  5FI7 A;  2PYR A;  1ES3 A;  3IXG A;  1VB6 A;  1KVL A;  4ZJ3 A;  4K0X A;  3TSG A;  3WWX A;  5FEF A;  1H8M A;  3VSL A;  4DDS A;  3DWK A;  2JN7 A;  3WRZ A;  1Y28 A;  1K55 C;  2Y2O A;  4BLM A;  3IS2 B;  4DF6 A;  5TBM B;  3IH8 A;  1K54 A;  3JYI A;  4GS9 B;  1K57 C;  4N9K A;  2JKT M;  1LI9 A;  5E2G A;  4L9F A;  3UNW A;  3WS0 A;  3V50 A;  4X68 A;  4EBP A;  3G4P A;  1F98 A;  1GA0 A;  3LO7 A;  4JPM A;  4DJ3 A;  4IED A;  1NXY A;  3M6B A;  2W1R A;  1ERO A;  2XD5 A;  4B4X A;  5J8X A;  5HDS A;  3JPU A;  3G6O A;  2QZ6 A;  2ZBB A;  2W3E A;  2M7V A;  4OP5 A;  3N4I A;  4DE0 A;  2AVX A;  2UWX A;  3VP2 A;  4HH3 A;  4WM9 A;  5DF7 A;  3O5Y A;  1GA9 A;  1HTZ A;  3N7W A;  2WKQ A;  3TRC A;  4F3L B;  1RP5 A;  1QMF A;  1SCW A;  3WS1 A;  5TFQ A;  1PNE A;  5HD3 A;  5L2F A;  2HJ9 C;  4PPR A;  2ZC4 B;  3BY8 A;  5J7E A;  4LCL A;  3T4Q A;  1I2S A;  4RVA A;  1CK3 A;  1NLY A;  3LR3 A;  4DMZ A;  1KE0 A;  4FCF A;  1VET A;  3K2N A;  4X53 A;  3MZF A;  1S4R A;  4OOM A;  2L0W A;  3Q81 A;  1GCE A;  2HF6 A;  4DN0 A;  4P0M A;  4UHU A;  1KE3 A;  4DRT A;  4EBL A;  1P97 A;  1IYQ A;  3B42 A;  1OT9 A;  1C3B A;  4GDN A;  4ETZ A;  4G3V A;  5KIZ A;  3HLB A;  3UDI A;  4WMC A;  4LRZ E;  2K2N A;  4DJ2 A;  3BY9 A;  4ID4 A;  1MZU A;  3IX4 A;  5FQI A;  4HJ4 A;  2WK0 A;  3G35 A;  1OTE A;  3MF0 A;  5A90 A;  2WGW A;  1TS0 A;  3S7Q A;  4CLC A;  1JWZ A;  2J3T D;  4PM6 A;  4KZB A;  1LSX A;  2VGL S;  3DTK A;  4XUZ A;  4NKP A;  2QYB A;  3QNC A;  4HI4 A;  4H6J A;  3C4O A;  4OVD A;  1ESI A;  3ZG0 A;  3ITB A;  4OKP A;  2ZC6 B;  3LGO A;  3IWQ A;  2OV5 A;  3NCK A;  1RCJ A;  3KSF A;  4XT2 A;  1NWZ A;  2ZQD A;  2WAD A;  3KSI A;  3LY4 A;  2P9V B;  2Y4A A;  2XF3 A;  4MCW A;  5A91 A;  5TR7 A;  4UA6 A;  4XUX A;  2PDR A;  4GKU A;  4Y5F A;  1K25 A;  3C7U A;  1CJF A;  2LB5 A;  2H10 A;  1YPR A;  3OOV A;  4LV3 A;  4LV1 A;  4PKY G;  3VSK A;  3SZT A;  1FCM A;  1F2K A;  4E3K A;  3MKF A;  1TD5 A;  1VHM A;  2OLV A;  2ZLY A;  1XKZ A;  3OCN A;  3VE3 A;  3RTY A;  1JWP A;  2NUP C;  1K4E A;  5GLD A;  3BYD A;  3G2Z A;  3SS5 A;  2HP6 A;  5F82 A;  4KZ6 A;  2VX8 A;  2B18 A;  1HLU P;  1OTI A;  5EV0 A;  5EM1 A;  4ZJ1 A;  4XXR A;  2WKP A;  4KQR A;  5CXW A;  1VEU B;  3T12 B;  4HH2 A;  4PM5 A;  2Y2G A;  3QHY A;  1PFL A;  5GHY A;  1MBL A;  3HLW A;  3EGX C;  1T19 A;  3VP3 A;  2ZL1 A;  4E3L A;  1TDG A;  1IKI A;  3W4P A;  4EQI A;  1FCO A;  3UE0 A;  4S2M A;  2VGL M;  3ICY A;  5D3O A;  3UB5 P;  4BMW A;  4JF4 A;  4ZDX A;  3FYZ A;  4JXG A;  2W3G A;  3BFF A;  3QP6 A;  4KZA A;  1XGI A;  4KG6 A;  1OTD A;  4G3K A;  4EV4 A;  3T1S A;  1YSP A;  3MJQ A;  5GHX A;  4JXW A;  4QJG A;  2OAQ 1;  1XXM A;  3CIT A;  2BAS A;  1L3L A;  3DWZ A;  2J9O A;  3HUO A;  3IF6 B;  2O9B A;  3BEB A;  2JKG A;  3G2Y A;  1KGG A;  4Q0H A;  5FA7 A;  2P04 A;  1XJ3 A;  3HVF A;  2PBD P;  2CMN A;  4UA9 A;  3IBR A;  2O99 A;  5EVI D;  4O0P A;  1ONH A;  3MZE A;  3WS4 A;  2Y91 A;  4IBX A;  4YIN A;  3FPV A;  1FCN A;  5F1G A;  2WAF A;  3FPW A;  5HDC A;  3T4L A;  4KUO A;  2Q9N A;  4BL3 A;  1LL5 A;  3D4F A;  1PYY A;  4A5R A;  2XRO A;  2OOL A;  3T1Q B;  2HV1 A;  5FI6 A;  1MWR A;  2QHK A;  1XFN A;  4MDZ A;  2K7S A;  4Y0U A;  5FQ9 A;  4OPY A;  1FR1 A;  3LIC A;  2Y2N A;  4R6L A;  2W3F A;  3R4K A;  4QPR A;  3LIF A;  4Y3I A;  3SH8 A;  2KLI A;  5C5K A;  5AQA A;  2J7V A;  3A3D A;  3B47 A;  3KYE A;  4E3N A;  1NJ4 A;  3C4P A;  1K55 A;  1BT5 A;  4E04 A;  2L4R A;  1MKM A;  1LI0 A;  4WZ4 A;  2ZQA A;  4OLG A;  3GRJ A;  3PBR A;  4X25 A;  2ZMV A;  3HLC A;  1BLC A;  1DY6 A;  3T1X A;  1XA1 A;  4CLC E;  3LEQ A;  2INW A;  3G34 A;  3T4O A;  5DJU A;  1AWI A;  1YAX A;  3L9K A;  2PD7 A;  4R4R A;  1S67 L;  2HDU A;  3KSH A;  4P87 A;  4D60 A;  3RJU A;  2RL3 A;  3VOZ A;  1G6A A;  4KUK A;  1XX2 A;  1OTA A;  5M18 A;  2JCH A;  3E4P A;  4E6X A;  3KX0 X;  3LIA A;  5DFX A;  4EUV A;  3CMZ A;  3A0V A;  3M6H A;  1MY8 A;  4GW9 A;  1YKD A;  1YLT A;  5KMW A;  5F6A A;  3UO9 A;  3DBA A;  3BJN A;  4HP4 A;  3LR0 A;  4QWO A;  3MKE A;  4WMC D;  4R70 A;  2ZOH A;  2GJ3 A;  5FQK A;  2WAE A;  3MZD A;  5K5B A;  5DF8 A;  4Y0T A;  4X1M A;  4F94 A;  2Y8H A;  4EUZ A;  5CGS A;  4F3L A;  4R23 A;  1XPB A;  2KDK A;  3C30 A;  5EM0 A;  2Y2L A;  2ZQC A;  2EX6 A;  5CRF A;  2EX8 A;  1CQA A;  2EA9 A;  1IEL A;  3IF6 C;  1L2S A;  1IOU A;  1YMX A;  4JBF A;  2WZX A;  1LSV A;  3TE8 A;  4QB8 A;  1F9I A;  1ONG A;  3UME A;  3GEC A;  2PHY A;  3MQO A;  1PW8 A;  3RFB A;  4II7 A;  3BFE A;  2HDQ A;  2GX5 A;  5FI2 A;  2A2L A;  2EFX A;  4QY5 A;  3SS3 A;  3HRE A;  4B4Z A;  2VV8 A;  1YLJ A;  4JF6 A;  2HZ5 A;  3BFC A;  5CHU A;  4DXB A;  3V3S A;  5HWT A;  3FKV A;  3SOI A;  4WZ5 A;  3IXB A;  4WN5 A;  3U4L P;  3VP4 A;  4L9E A;  4KEN B;  3CUE C;  4RA7 A;  2HGV A;  1PZO A;  5EOO A;  4HHD A;  3P7N A;  5CHJ A;  3IT9 A;  4GCZ A;  3TG9 A;  2X71 A;  3E2K A;  1GHM A;  5HL1 A;  3T50 A;  3F1P A;  2WYX A;  1RGZ A;  4QD4 A;  4MBK A;  4UQI M;  3C8C A;  3CPT A;  3HJK A;  5AVF A;  1FSY A;  3DTM A;  4H6J B;  3EEA A;  2ACG A;  1TEM A;  1STZ A;  4ME4 A;  5L8M A;  2XR0 A;  3UDX A;  4Q0I A;  3OC2 A;  1PI4 A;  4GLQ A;  1BLP A;  3LY3 A;  4UAA A;  4LV0 A;  1BLH A;  5CX7 A;  4BBU A;  5HD5 A;  3D3O A;  1W79 A;  4IUH A;  3G31 A;  4LEN A;  5TJJ A;  1NY0 A;  2HP9 A;  1S1Z A;  5A8B A;  4CJN A;  1TVF A;  1RGY A;  2EFU A;  4QU3 A;  3UY6 A;  3MBZ A;  2D01 A;  2XGN A;  5HSQ A;  1BUE A;  5JYP A;  4OQH A;  3UB9 A;  2IA2 A;  4I3J A;  3RH8 B;  3AGE A;  4E3I A;  4HP9 A;  5DTK A;  3H7W A;  2FFY A;  1FIL A;  4S2N C;  1W8Y A;  1ERQ A;  4OOL A;  5BOH A;  4LRY C;  4WEL A;  2WUQ A;  3AGD A;  4JGR A;  1O7E A;  1BLS A;  3GSG A;  3T4T A;  3WS5 A;  4S2O A;  4JXS A;  4HEF A;  2ZQ7 A;  2ZM8 A;  4N92 A;  3TOI A;  4YNR A;  2DMW A;  4EER A;  2QJ7 A;  2VZW A;  4RX2 A;  4P85 A;  5DTT A;  2W1T B;  1K57 A;  2J3W A;  4GHI B;  4YWZ A;  4MBF A;  2C6W B;  1NRF A;  1L0E A;  4CLC C;  3H82 A;  4WZ5 C;  2P7J A;  5FSR A;  4I3A A;  1DP8 A;  4X56 A;  4X69 A;  1DJB A;  2IWD A;  5EE8 A;  2YKF A;  3BLS A;  4C3Q A;  2KX6 A;  1TDL A;  1TF1 A;  1IYO A;  4BQM A;  3A0R A;  3JVU A;  1GSV A;  3A3F A;  4LFU A;  2V20 A;  3T4J A;  2O9C A;  5FL3 A;  3PAG A;  3W4Q A;  2Y2I A;  3ZGA B;  3PAE A;  4OQI A;  3EQV A;  5HPF A;  1OJ5 A;  1EWZ A;  4S2P A;  4YFM A;  4PM8 A;  1HD8 A;  2EWW A;  4HNB A;  4S2I A;  3T4S A;  1WYC A;  3IWO A;  3IHB A;  1DP9 A;  1XFQ A;  5HDD A;  3OPP A;  4E6W A;  4P6Z M;  2JKT I;  5HFO A;  2JKR I;  4Y15 A;  3R7W A;  3SW1 A;  4WBG A;  4JKT A;  5F1F A;  1Y54 A;  5AVE A;  4Z9Q A;  3EEH A;  5FQM A;  2FZ0 A;  3GDI A;  5L10 A;  3Q1F A;  3VFH A;  3H7W B;  2V0U A;  1CEF A;  4CPK A;  5FDH A;  1S1Y A;  3E4Q A;  1T1C A;  3O87 A;  5CGW A;  3VP1 A;  3HLD A;  2PRF A;  5EOE A;  1ES5 A;  3HCY A;  2O0Y A;  4MN5 A;  2OWJ A;  5HL6 A;  1FR6 A;  4E3M A;  3OBF A;  1GSX A;  1QME A;  3ISG A;  4NG2 A;  4MN6 A;  1Z09 A;  1V9Z A;  3FZC A;  2OLU A;  1O07 A;  3Q07 A;  3NOT C;  2VKS A;  4R3J A;  2Y2M A;  1K0K A;  2Y79 A;  1J9M A;  4OH0 A;  2J80 A;  4IVK A;  3L7H A;  3IQA A;  4GD6 A;  1ZG6 A;  3SS4 A;  1KDW A;  3C2W A;  2XLN A;  1SKF A;  3PXP A;  5E2E A;  5A92 A;  1ODV A;  1PRQ A;  5KSH A;  2PD8 A;  2RCX A;  1N9N A;  3MFD A;  4RQ9 A;  3LR5 A;  3E98 A;  4O01 A;  4R0Q A;  4EXO A;  4X55 A;  2G2W A;  3S7N A;  3BQA A;  1MPL A;  1WYB A;  1WE4 A;  5HZH A;  1PZP A;  4ARZ A;  1TS6 A;  3CJM A; 
#chains in the Genus database with same CATH homology
 1Z09 A;  2V8F A;  2BTF P;  1G5U A;  5EM0 A;  1PRQ A;  1VET B;  2VK3 A;  3NEC A;  3T1Q B;  5FEG A;  3T1X A;  3LEQ A;  1Y4O A;  1VEU B;  1CJF A;  3T12 B;  1A0K A;  3DAV A;  2ZL1 B;  1CQA A;  1D1J A;  3LGO A;  1YPR A;  3CPT B;  2ACG A;  2PRF A;  4QWO A;  3UB5 P;  2V8C A;  1VET A;  1AWI A;  2JKG A;  4FTX A;  4X1L A;  1SZV A;  1J3W A;  1K0K A;  1VEU A;  3L9K A;  2E8J A;  2B95 A;  2HZ5 A;  5FDS A;  4ESP A;  4FUW A;  1FIK A;  1CF0 A;  1PFL A;  3MSH A;  1ACF A;  2JKF A;  5FEF A;  5EVE A;  4D60 A;  3MS6 A;  3CHW P;  1FIL A;  3L7H A;  2PAV P;  4X25 A;  1HLU P;  1SKO B;  1SKO A;  2PBD P;  4X1M A;  5EV0 A;  3D9Y A;  5EM1 A;  3NUL A;  1F2K A;  3T1R A;  3CPT A;  3U4L P;  3T1S A;  2ZL1 A;  3KYE A;  1PNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...