3MSHA

Crystal structure of hepatitis b x-interacting protein at high resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
b'MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatitis B virus X-interacting protein
publication title Structural Characterization of HBXIP: The Protein That Interacts with the Anti-Apoptotic Protein Survivin and the Oncogenic Viral Protein HBx.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 20
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16672 LAMTOR5 Ragulator complex protein LAMTOR5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3mshA00
3T12B 1SKOB 4X25A 5EM1A 2E8JA 1CF0A 1A0KA 5EV0A 2ZL1B 4D60A 1PNEA 3KYEA 2HZ5A 1FIKA 3DAVA 2JKGA 4ESPA 1K0KA 3CPTA 1PFLA 1FILA 2B95A 4FUWA 3T1QB 1VETA 3LGOA 2PBDP 2BTFP 3D9YA 5FEFA 1YPRA 1SZVA 3T1RA 4FTXA 1D1JA 1PRQA 3L9KA 4X1MA 3U4LP 2PRFA 2VK3A 1VEUA 2ZL1A 1AWIA 3MS6A 3UB5P 1ACFA 2ACGA 1VETB 2PAVP 3LEQA 5EVEA 4X1LA 3T1SA 1CJFA 1CQAA 3NECA 1SKOA 3L7HA 3NULA 2V8FA 1HLUP 2V8CA 3MSHA 3CPTB 1VEUB 1J3WA 2JKFA 5EM0A 1F2KA 5FEGA 5FDSA 1G5UA 3CHWP 3T1XA 1Y4OA 1Z09A 4QWOA
chains in the Genus database with same CATH superfamily
1YSPA 2QHKA 4LV2A 4OPQA 3LIAA 4GS9A 4ARZA 3G34A 4HH3A 4I38A 5GLCA 3FZCA 1PWCA 2HZ5A 1NLZA 2ZC5B 3QP5A 1TDLA 4ME4A 2NUPC 2HGVA 1M6KA 2D02A 5L09A 3C5AA 1MC0A 5F69A 3A3FA 2JKGA 3HLEA 3R7WB 4LV0A 2OWHA 3CPTA 4OQIA 1BLCA 2O9AA 3DW0A 5C5KA 4JLFA 3WS2A 3HLGA 2V2FF 4GDBA 2W1RA 1NJ4A 3WS1A 5CTMA 4JKTA 3PTEA 3MKEA 5A93A 3H7WA 3LY4A 4CLCD 3PBTA 3RTYA 4S2PA 4H8RA 2XGNA 4E3MA 2HDUA 3JVUA 1N4OA 2UWXA 4JPMA 3ULFA 4GNUA 1NRFA 1YMSA 4HESA 2WZXA 3N8LA 4ZJ2A 4E3OA 2ACGA 2XRNA 3SZTA 5K5BA 3G31A 3MQOA 3C8CA 4WMCA 2P04A 1PZOA 4MN6A 1YLTA 3Q82A 3HLWA 3O86A 4BENA 1K56D 3NHQA 2VX8A 3UE6A 4HBUA 3UO9A 4FCFA 2KLIA 5J8XA 1W79A 1BTLA 5HW3A 3GECA 5EVIA 4ZBEA 2J3TD 1Y4OA 3PBRA 4Z1WA 2R9XA 2VA0A 2QZ6A 5TGFA 3S1YA 4WELA 4Y0UA 4DN0A 1N9NA 1NYYA 3VOLA 4D2OA 5J4EA 4OVDA 5AVEA 3PAGA 4HJ4A 4FD8A 5FAQA 3TE8A 2HP9A 1TS0A 1HD8A 1K55A 3KSGA 3NC8A 4PM8A 5GLAA 2LB5A 1T1BA 5E2EA 4LV1A 3LCEA 1E4DA 3G30A 4HQAA 1PFLA 5E2HA 3HLDA 4EEPA 4OPZA 1TVFA 3KX0X 4AFIA 1D06A 1QMFA 1J9MA 2P9VA 2WKHA 3QNCA 2Y2IA 5HAQA 1JTDA 2JKTI 4E04A 5IT5A 5FI2A 5F1GA 1BLPA 3I7JA 5TR7A 3GVBA 1ONGA 5CEDA 2IA2A 4X1MA 3T4TA 1XJ6A 2OAP1 3ICYA 3C4OA 4R0QA 2JC7A 2V20A 4Y13A 1XGJA 5GLDA 4XT2B 3T4SA 4Q0JA 3UPNA 3MKFA 3T4KA 2L1MA 3OZHA 1KE0A 1XGIA 3Q1FA 1XXMA 2XQZA 1L0FA 3B33A 3QP6A 4IJGA 4FSFA 3MQ0A 2JKFA 4RYEA 3CAXA 5HD5A 3N4IA 4JXVA 4OOMA 4WZ5C 5TBMB 3WRZA 3LR3A 2JBFA 2L4RA 1NXYA 4P0MA 4UHUA 3KO6A 1TS7A 5DTKA 1SKFA 2ZMFA 1FCOA 5BOHA 1RGZA 4H6JB 3IX4A 4KZ3A 3G6OA 3AGEA 1A0KA 3LIFA 3C38A 3OLOA 3V50A 2NUTC 3M2JA 1P97A 2H5SA 4B4ZA 3V3RA 5DVAA 4X6TA 2EX9A 5L10A 1JWPA 4NXEA 2A24A 2VJWA 4KZ4A 2Y2MA 3RJUA 2VV6A 2XROA 1OTIA 1NYMA 5EE8A 3UY6A 1DRMA 1LT0A 3CWFA 4RX3A 3MF0A 1PWDA 1YMXA 5DFXA 5HL6A 1IFQA 1V9YA 3R4KA 4MN7A 4IBRA 1EROA 3E4OA 1ESUA 4N1HA 1GCEA 3A0SA 3QP4A 3U4LP 2J3WA 5A8BA 2PRFA 4CPKA 1GA0A 3CUEC 3TJZC 4DE1A 3HREA 4L9GA 2CC1A 3D72A 3S7OA 2H0TA 4RQ9A 2O0YA 4JF4A 1PW8A 4NG2A 1GHPA 4JF5A 2VGKA 1VQQA 3S7QA 2J9PA 2XD5A 2M1CA 3CMZA 4CLCC 3BFGA 3PBOA 2QWSA 3WRTA 4M4XA 5D3OA 3VSLA 5FEGA 2GJ3A 4GKUA 3F1NB 4N92A 5CX7A 1OJ5A 4BD0A 2WADA 3EQVA 1KGFA 4R70A 3ZG0A 3OPRA 5GHYA 3V39A 1AXBA 4S2MA 2V1BA 2G2WA 4G3WA 1DJAA 1MZUA 3IX8A 3EEAA 4MNRA 5M18A 4UQIM 4OQ0A 3RXWA 4N9LA 4E3JA 1Y28A 5JYPA 3IS2B 4OQHA 4E3LA 4GZBA 5FSRA 2JCHA 3MZEA 1N9OA 4HIAA 2GX5A 2MJ6A 4ETXA 3KSFA 3NOUC 3OBFA 3E0YA 4UA6A 1RCJA 3MFXA 1TS8A 4MLLA 4BBTA 4F3LA 4LRZE 2X01A 3PBQA 3UDFA 5HSQA 5FEFA 5EOOA 1SZVA 2QJ7A 3FKWA 2XF3A 1XA1A 4KUKA 4B88A 2K7SA 3IBJA 4OQGA 4QJGA 3PYPA 4R4RA 2OLUA 2IWDA 2ZC3B 1AWIA 5JYOA 3IH8A 1ES3A 1MPLA 5J3WA 2EX2A 3MMHA 3ZNTA 4R38A 2V8FA 2Q0OA 3ZCZA 1KDSA 3MJQA 1STZA 1PW1A 3F1OB 1PZPA 2WKEA 3LIEA 4EUZA 1G5UA 2P08A 3H82A 3HCYA 4IVKA 1DP6A 3A0VA 4S2LA 1VHMA 2GNXA 1S66L 4E3IA 5E2FA 5CGWA 3Q81A 5EM1A 2Y59A 3LY3A 1XJ4A 4IHQA 4I3JA 4RA7A 2PU2A 4Y7PA 3BQ8A 1XFQA 3NBLA 3AGFA 4WYYA 2JE5A 2K2NA 1CF0A 3Q7VA 1K4EA 5CXWA 5FASA 3V5MA 3S22A 2M7VA 4DE2A 4FH2A 4Y15A 1LLBA 4ZRRA 3UE0A 2HJEA 4K08A 1S4SA 1UWPX 2HDSA 1ONHA 3BRMA 1XP4A 1GHIA 3QP1A 2M7UA 3NIAA 2WAFA 4HP4A 2PBDP 4KG5A 5FAPA 4XUXA 1YLJA 3LIDA 1F98A 4KQDA 4EW7A 4UQIS 4FTXA 4IEDA 3BQAA 3E98A 2PR5A 3UB8A 2ZL1A 1N9BA 5DFYA 5E2GA 5EVEA 4LPZA 3IH9A 4O8GA 1W7FA 3BFDA 1G68A 1BZAA 1P9WA 1KVLA 2C5WB 2A3UA 3UMEA 4NXGA 4U3TA 3IQAA 5CGSA 4PM9A 1YKDA 1H5XA 1ZG6A 4E6WA 2V1ZA 1YAXA 3UB6A 1WA9A 5FI6A 1TEMA 4R6LA 4R23A 1KE4A 4LCMA 1FCMA 4OP5A 2V9AA 3UDXA 1LL8A 2K31A 5IU1A 5EV0A 3VP4A 2WYXA 2Y2PA 4MN5A 3T4LA 1LL9A 1NZOA 4II7A 3O3VA 4P6BA 4WEJA 1G28A 2OSUA 3IF6C 3ZFZA 1JNUA 1ODVA 2RCXA 4HNBA 1JWVA 4GS9B 4ARZB 3T1QB 4HEFA 1K54A 2XR0A 4Q0HA 2RL3A 2J9OA 3B3XA 2JKRI 2Y8HA 3C7VA 1YM1A 3VP0A 1CEGA 1KE3A 1H8MA 5CTNA 5F5YA 3TG9A 4GHIB 4LV3A 5KIZA 2PBYA 3WS0A 3DTIA 2WGWA 3GV9A 3IXBA 3LEQA 2V0WA 4X56A 3MXQA 4E3NA 3T1SA 4DJ2A 1F5MA 5L2FA 3R7WA 3MR0A 4NK3A 1K6SA 4DXBA 1HLUP 2HDRA 3S4XA 1J3WA 1H8ZA 4X53A 1K57C 4WL9A 5HARA 1BSGA 3LR0A 3BECA 4OKPA 5HWVA 3KSIA 1KDWA 4PMAA 5DKLA 3SOIA 1BT5A 1K54C 3F1PA 1OTAA 1E3UD 1TD5A 3K3CA 1IKIA 3QP2A 1JVJA 3N8RA 2OWJA 2EWWA 1GSVA 3VMAA 1LI9A 4D60A 3BFCA 4JGOA 3HLCA 4OONA 4C75A 2ZQAA 1LSWA 4HHDA 4MMNA 1EI5A 5HPFA 4Y0OA 4PM6A 3LEZA 2VEAA 2ZC7A 5J7EA 4NETA 4GD8A 4KUOA 4XUZA 2Y2JA 4GN2A 1L0GA 4RX2A 1W5DA 2Y2HA 2D01A 5CHMA 5CECA 1OMEA 4BLMA 4JGRA 1YPRA 2JKTM 5CRFA 4PM7A 5EVLA 4EBPA 4ZAMA 1D1JA 1OPXA 3KYZA 5L07A 5MC7A 1ERMA 1SDNA 2VK3A 3CI6A 4WZ5A 5I5LA 1K4FA 3BM6A 3LI8A 4HBTA 3MXSA 3ZDJA 1BULA 1IEMA 3UE1A 4PKYG 2WKIA 4BQMA 4BL3A 2PDRA 4KG6A 1DJBA 3NULA 1L2SA 2R9WA 3N6IA 3ZVWA 3P01A 2L0WA 4YINA 5FDSA 2BASA 4KZAA 3MXRA 1DJCA 4KENB 4QHCA 3EGDC 3UPPA 4GW9A 3G32A 5AVFA 2B02A 4MBKA 3E4PA 3CITA 4YFMA 1G6OA 2J80A 4XT2A 4R4SA 2EX6A 4NEED 4P87A 5FQQA 4WF0A 1H0MA 2HPBA 4WBGA 3CUEA 1HVBA 2OAQ1 2VZWA 3IWOA 1K25A 2W0NA 3ZG9B 4DJ3A 2ZOIA 2W1TB 2KOIA 1HTZA 5FQKA 1VETA 4L0LA 1D7EA 1ES5A 5HAIA 1XFNA 1ZHHB 2EXAA 2X71A 2QMIA 4DF6A 2P74A 3NJAA 1X0OA 4QY5A 3T4JA 4CLCA 3A0RA 4G3VA 1CK3A 3L9KA 5G4ZA 1XKZA 4WZ4A 2EX8A 4XXRA 1PWGA 2Y91A 3P98A 3HLBA 4ETZA 4HH2A 1Q2QA 3SS5A 5CEBA 1PIOA 1WE4A 3IHAA 3T4OA 3P7NA 3HVFA 3E4QA 1K38A 4IUKA 5G4YA 4Q8IA 1K56A 4KZ9A 3QNBA 1U60A 5DF8A 4JF6A 4KZBA 3UE3A 1BUEA 1L0EA 4OP8A 3EOIA 4S2KA 4OPYA 2Z2LB 4YOFA 4G3KA 4ID4A 4O7DA 5FQIA 3CLOA 1T19A 4IUHA 3IWQA 4KZ5A 2IWBA 3B42A 1K6RA 3FPWA 3OPLA 3IXGA 2BG1A 5FAOA 1FR1A 5CHUA 4YWZA 1Z6FA 4DE3A 4IVIA 5FDHA 1FIKA 4HOIA 4O0PA 3DWZA 4LGWA 2ZC4B 4PM5A 2VGLS 4P6ZM 4OH0A 2KDKA 3FV7A 3C7UA 3EQUA 3PBNA 4GOGA 4E6XA 1RP5A 1T1AA 2WK0A 3F1NA 3VFHA 3ZNYA 3KSHA 1IELA 4N1XA 1YLPA 1S67L 1YQSA 4EBLA 4WM9A 3ITAA 5FATA 2J3TC 3JVVA 1WYCA 5KSHA 2IWCA 5DTSA 3FKVA 5F1FA 2DNSA 3OCLA 3NOTC 4F3LB 3IS2A 4JXSA 1QMEA 1CJFA 3NECA 3LICA 4LRXC 1SKOA 3L7HA 3D3OA 2WKRA 2WGVA 3MSHA 3EGXC 3BY8A 3ISGA 2EFXA 1S0WA 2I72A 2AVXA 4LFUA 2PYRA 3GRJA 1TF1A 5EFWA 4ZJ3A 1ES2A 2VV8A 4Q0IA 3LR5A 3M6BA 1CI9A 3SH9A 3EWKA 3BLMA 4X25A 4HJ6A 2VV7A 4Y2FA 5U47A 2ZMVA 4UA7A 1UGUA 3OCNA 5IS1A 4S2OA 2EFUA 5LBRA 1NWZA 5A91A 3H82B 3H9WA 3N7WA 2HF6A 2XDMA 3A3EA 4DDSA 1MWSA 2VLGA 3E2KA 1G6AA 2G2UA 3P09A 3NCKA 3AGDA 4HY8A 2B95A 2BLSA 4L9FA 3F1OA 3Q7VB 2G7UA 3GDIA 4LCLA 2DMWA 1BYWA 2YKHA 4GB7A 2Z2MB 5DF9A 4ZTKA 3MZFA 4GJ4A 5KSCA 3IXHA 3MZDA 2A2LA 4GLQA 4MCWA 4ZDXA 2XH9A 1VEUA 3OOVA 4LLOB 4P6ZS 3GSGA 5HD3A 2Y2OA 4C3QA 2ZQ8A 4NKPA 4RVAA 4NXBA 4WMCD 2ZOHA 2A49A 3GTCA 5KMWA 3PR6A 3BWLA 4UEYA 3LYXA 1JWZA 1XJ2A 2V8CA 3B47A 3ZQ5A 5HWWA 2J7VA 1CEFA 3KYQA 4EUVA 4CJNA 5EVID 1KGEA 2FZ0A 3IF5A 4R3JA 1TDGA 4EERA 4X68A 3FYZA 3VV4A 3IF6A 3T1XA 4M3KA 2WKPA 1Z09A 2Q9NA 3BW6A 2Y2NA 1O07A 3T12B 3BFEA 2Z6DA 1T1CA 3G2YA 5DTTA 5DJUA 1ZKJA 4MEZA 1FSWA 5GHZA 5EPHA 1S6RA 2JHEA 5DKKA 3VP2A 5AQAA 3TSGA 5GHXA 1I5QA 1KVMA 3JYIA 3V3SA 4QD4A 3VFFA 5HPIA 2QPNA 4R1GA 1VB6A 4U0XA 4EETB 2PD7A 2H0YA 1YT4A 4S2NC 2V1AA 1LHYA 3WS5A 1PRQA 3HUNA 3SS4A 1ZTUA 2JKRM 2PT7A 1K57A 3ZG7B 3ITBA 4QU3A 3K2NA 3TW8A 1L3LA 1MY8A 2PAVP 3MBZA 4FH4A 5I94A 5HDDA 4MBFA 3NI9A 3PXPA 5A92A 2B18A 3N8SA 3CPTB 4BD1A 4OOYA 1SHVA 1P9RA 1SDEA 4QPRA 1RGYA 1FCNA 2WGWB 3CHWP 4JXWA 3O87A 1ES4A 1LL5A 3GMWA 3H7WB 1ALQA 4B93A 4KQQA 1S1YA 3W4QA 3C2WA 5F83A 4GHIA 5FQJA 2EWVA 1OTEA 4NXFA 5TJJA 1MXOA 1EWZA 1CI8A 2XA7S 4OPRA 3DWKA 5TFQA 1PNEA 3KYEA 1ESIA 1V9ZA 2O9BA 4EWFA 3TOIA 1GHMA 2J8YA 3C30A 4B9OA 4DRTA 2VKSA 1SCWA 2V0UA 2ZC6B 3A3IA 3DAVA 3F1PB 4Y5FA 2YKFA 1PI5A 5FQMA 4Y3IA 3NOPC 3OPPA 3DBAA 3LGOA 5FA7A 3CJMA 4GD6A 5EVIB 5HL1A 2BTFP 4WN5A 3WWXA 1TS6A 2ZQ7A 4E3KA 3JPUA 2ZQ9A 1Y54A 2W27A 5CHJA 2ZM2A 3VE3A 3BYDA 4I3IA 3FG8A 1OT9A 2Y79A 4CLCE 3HBRA 2XSSA 1EW0A 1MWTA 2PD8A 3OPHA 2P7JA 3ZHHA 4OLGA 5DF7A 1FQGA 4UA9A 1MBLA 1FR6A 2Y4AA 3UPOA 4C6YA 4FOFA 5FQ9A 2P9VB 3W4PA 4BL2A 2FH5A 4Y17A 1P0ZA 1XJ3A 4DE0A 5KZHA 3SH7A 4YNRA 2GZAA 4BJPA 3VP1A 3LUQA 1WYBA 2E8JA 5IHVA 2EA9A 2ZM8A 4R3AA 2VGLM 2JN7A 3D4FA 5FL3A 2O9CA 2Z6CA 4EBNA 3CG5A 3EEHA 5EVIC 3E2LA 2OLVA 1IYQA 3VP3A 4ESPA 4WUJA 2E8IA 3PHYA 2DCFA 4Y0TA 3A3JA 4BMWA 5AJGA 4O01A 3O5YA 3ZGAB 3RFBA 1LSVA 2ZD8A 4HP9A 4I3AA 1I2SA 3M6HA 3W4OA 4PAUA 4U0TA 2ZLYA 5AQBA 4EQIA 2XFSA 2XEPA 3PAEA 2Y2LA 1NLYA 3SH8A 3T1RA 4N9KA 3HJKA 1K55C 4IBXA 1MWRA 3BFFA 3G4PA 5HWTA 5F6AA 3S7NA 1MKIA 1OJGA 1HZOA 5M1AA 3NY4A 3RH8B 1M40A 1VETB 5TBMA 5HFOA 3SW1A 3VOYA 1XX2A 1IKGA 2GDNA 4KZ6A 2KX6A 4R3BA 4CLCB 2OV5A 4KQOA 4JGPA 4K0XA 2A24B 2W1TA 3UB7A 4H6JA 3IHBA 1BLHA 2XK1A 2Y55A 1PI4A 4S2IA 2WAEA 4X55A 5HX9A 1YSQA 2EXBA 1YLYA 2R78A 4KG2A 2W3EA 2X02A 2Q9MA 3QHYA 2O99A 1GSWA 4LRYC 2PU4A 4QB8A 4JGQA 1E3UA 2QKPA 3HUOA 2W3DA 2WKQA 1MKMA 1C3BA 1H8YA 1S4RA 3G35A 1Q2PA 2HV1A 4K0WA 1UWNX 2OOLA 3Q7ZA 3DTMA 4DMZA 1IYSA 2XD1A 1FSYA 2Y2QA 4A5RA 4F94A 2C6WB 4KQRA 3GQZA 3UN7A 3UMDA 2WZZA 3ZVTA 2FFYA 2ZBBA 1K0KA 5HDSA 1YLZA 3HJIA 3G2ZA 1FILA 3LFVA 1MWUA 4S2JA 4PPRA 3LO7A 4QY6A 1F9IA 1DP8A 1KGGA 1ZG4A 1XA7A 4MBHA 1DP9A 3FWLA 3LIBA 1OT6A 4WLAA 1T18A 3GR2A 2HP5A 5EUAA 1GA9A 3RXXA 4DXCA 5GL9A 2W3FA 1O7EA 1DY6A 3UB5P 3BLSA 3VE4A 3T50A 4K91A 3C4PA 3UNWA 5CERA 2FFFB 3T4QA 1CQAA 1S1ZA 1W63M 3U2AA 1L0DA 3MFDA 5HAPA 2LB9A 4I39A 3IBRA 3FPVA 3LI9A 4X69A 5EM0A 1F2KA 4PHTA 3VOZA 5E43A 2ZJ9A 1IYPA 4BWIA 4JBFA 2I9VA 4QWOA 1IYOA 2ZQDA 1SKOB 4B4XA 5A90A 3BY9A 3UDIA 3NDEA 2DRWA 3A3DA 4I5SA 4P85A 4EXOA 3LR4A 3HL9A 4PKYA 4Z9QA 5AQ7A 3DTEA 4EU0A 4EQ1A 1ERQA 1E25A 1I2WA 4FUWA 5G18A 1LSXA 4KZ8A 1OTDA 4LENA 5AQ9A 5HDCA 3VSKA 4DKIA 3ZG5A 2WGIA 4L9EA 3W8KA 4CQHA 4WEKA 3WS4A 3MS6A 1ACFA 4UAAA 3PBSA 5DJTA 4GCZA 3IT9A 5F68A 3TRCA 2PHYA 3S7PA 3ZG8B 2XLNA 1FOFA 1VEUB 4OOLA 2PYPA 1VM1A 2HJ9C 1LI0A 2ZMAA 3CZDA 1IOUA 2CMNA 2HDQA 5CGXA 1NZUA 2XA7M 5L8MA 5EECA 3W2ZA 1PYYA 1W8YA 2VGJA 2W3GA 2ZL1B 5HZHA 4S2NA 3BEBA 3UB9A 3IF6B 3Q07A 5EOEA 2H10A 1W8QA 3QP8A 4JXGA 4EESA 5M19A 3IX3A 4GDNA 3SS3A 1JTGA 2W3HA 1N9LA 2WUQA 3FC7A 1OTBA 1NRJA 1BLSA 3D9YA 2UV0E 5F82A 1ZC2A 4OLDA 2QYBA 3IWIA 1W63Q 4HJ3A 2ZM0A 2XFTA 3DTKA 4HI4A 4MDZA 4ZJ1A 2Y2KA 1XPBA 1YLWA 4EV4A 1NY0A 3ZYTA 4X1LA 3M2KA 2H28A 5FI7A 3HUMA 4DDYA 1H3QA 3IXDA 2HP6A 4EEUA 2Y2GA 3O88A 3K3DA 3OC2A 2ZQCA 1KOUA 3MQQA 5GLBA 3BJNA 2QJ5A 4KZ7A 2PR6A 2INWA 1GSXA 4BBUA 2B5RA 3NDGA 3V67A 3HLFA 4BBVA
chains in the Genus database with same CATH topology
3T12B 1SKOB 4X25A 5EM1A 2E8JA 1CF0A 1A0KA 5EV0A 2ZL1B 4D60A 1PNEA 3KYEA 2HZ5A 1FIKA 3DAVA 2JKGA 4ESPA 1K0KA 3CPTA 1PFLA 1FILA 2B95A 4FUWA 3T1QB 1VETA 3LGOA 2PBDP 2BTFP 3D9YA 5FEFA 1YPRA 1SZVA 3T1RA 4FTXA 1D1JA 1PRQA 3L9KA 4X1MA 3U4LP 2PRFA 2VK3A 1VEUA 2ZL1A 1AWIA 3MS6A 3UB5P 1ACFA 2ACGA 1VETB 2PAVP 3LEQA 5EVEA 4X1LA 3T1SA 1CJFA 1CQAA 3NECA 1SKOA 3L7HA 3NULA 2V8FA 1HLUP 2V8CA 3MSHA 3CPTB 1VEUB 1J3WA 2JKFA 5EM0A 1F2KA 5FEGA 5FDSA 1G5UA 3CHWP 3T1XA 1Y4OA 1Z09A 4QWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T12 B;  1SKO B;  4X25 A;  5EM1 A;  2E8J A;  1CF0 A;  1A0K A;  5EV0 A;  2ZL1 B;  4D60 A;  1PNE A;  3KYE A;  2HZ5 A;  1FIK A;  3DAV A;  2JKG A;  4ESP A;  1K0K A;  3CPT A;  1PFL A;  1FIL A;  2B95 A;  4FUW A;  3T1Q B;  1VET A;  3LGO A;  2PBD P;  2BTF P;  3D9Y A;  5FEF A;  1YPR A;  1SZV A;  3T1R A;  4FTX A;  1D1J A;  1PRQ A;  3L9K A;  4X1M A;  3U4L P;  2PRF A;  2VK3 A;  1VEU A;  2ZL1 A;  1AWI A;  3MS6 A;  3UB5 P;  1ACF A;  2ACG A;  1VET B;  2PAV P;  3LEQ A;  5EVE A;  4X1L A;  3T1S A;  1CJF A;  1CQA A;  3NEC A;  1SKO A;  3L7H A;  3NUL A;  2V8F A;  1HLU P;  2V8C A;  3MSH A;  3CPT B;  1VEU B;  1J3W A;  2JKF A;  5EM0 A;  1F2K A;  5FEG A;  5FDS A;  1G5U A;  3CHW P;  3T1X A;  1Y4O A;  1Z09 A;  4QWO A; 
#chains in the Genus database with same CATH topology
 1YSP A;  2QHK A;  4LV2 A;  4OPQ A;  3LIA A;  4GS9 A;  4ARZ A;  3G34 A;  4HH3 A;  4I38 A;  5GLC A;  3FZC A;  1PWC A;  2HZ5 A;  1NLZ A;  2ZC5 B;  3QP5 A;  1TDL A;  4ME4 A;  2NUP C;  2HGV A;  1M6K A;  2D02 A;  5L09 A;  3C5A A;  1MC0 A;  5F69 A;  3A3F A;  2JKG A;  3HLE A;  3R7W B;  4LV0 A;  2OWH A;  3CPT A;  4OQI A;  1BLC A;  2O9A A;  3DW0 A;  5C5K A;  4JLF A;  3WS2 A;  3HLG A;  2V2F F;  4GDB A;  2W1R A;  1NJ4 A;  3WS1 A;  5CTM A;  4JKT A;  3PTE A;  3MKE A;  5A93 A;  3H7W A;  3LY4 A;  4CLC D;  3PBT A;  3RTY A;  4S2P A;  4H8R A;  2XGN A;  4E3M A;  2HDU A;  3JVU A;  1N4O A;  2UWX A;  4JPM A;  3ULF A;  4GNU A;  1NRF A;  1YMS A;  4HES A;  2WZX A;  3N8L A;  4ZJ2 A;  4E3O A;  2ACG A;  2XRN A;  3SZT A;  5K5B A;  3G31 A;  3MQO A;  3C8C A;  4WMC A;  2P04 A;  1PZO A;  4MN6 A;  1YLT A;  3Q82 A;  3HLW A;  3O86 A;  4BEN A;  1K56 D;  3NHQ A;  2VX8 A;  3UE6 A;  4HBU A;  3UO9 A;  4FCF A;  2KLI A;  5J8X A;  1W79 A;  1BTL A;  5HW3 A;  3GEC A;  5EVI A;  4ZBE A;  2J3T D;  1Y4O A;  3PBR A;  4Z1W A;  2R9X A;  2VA0 A;  2QZ6 A;  5TGF A;  3S1Y A;  4WEL A;  4Y0U A;  4DN0 A;  1N9N A;  1NYY A;  3VOL A;  4D2O A;  5J4E A;  4OVD A;  5AVE A;  3PAG A;  4HJ4 A;  4FD8 A;  5FAQ A;  3TE8 A;  2HP9 A;  1TS0 A;  1HD8 A;  1K55 A;  3KSG A;  3NC8 A;  4PM8 A;  5GLA A;  2LB5 A;  1T1B A;  5E2E A;  4LV1 A;  3LCE A;  1E4D A;  3G30 A;  4HQA A;  1PFL A;  5E2H A;  3HLD A;  4EEP A;  4OPZ A;  1TVF A;  3KX0 X;  4AFI A;  1D06 A;  1QMF A;  1J9M A;  2P9V A;  2WKH A;  3QNC A;  2Y2I A;  5HAQ A;  1JTD A;  2JKT I;  4E04 A;  5IT5 A;  5FI2 A;  5F1G A;  1BLP A;  3I7J A;  5TR7 A;  3GVB A;  1ONG A;  5CED A;  2IA2 A;  4X1M A;  3T4T A;  1XJ6 A;  2OAP 1;  3ICY A;  3C4O A;  4R0Q A;  2JC7 A;  2V20 A;  4Y13 A;  1XGJ A;  5GLD A;  4XT2 B;  3T4S A;  4Q0J A;  3UPN A;  3MKF A;  3T4K A;  2L1M A;  3OZH A;  1KE0 A;  1XGI A;  3Q1F A;  1XXM A;  2XQZ A;  1L0F A;  3B33 A;  3QP6 A;  4IJG A;  4FSF A;  3MQ0 A;  2JKF A;  4RYE A;  3CAX A;  5HD5 A;  3N4I A;  4JXV A;  4OOM A;  4WZ5 C;  5TBM B;  3WRZ A;  3LR3 A;  2JBF A;  2L4R A;  1NXY A;  4P0M A;  4UHU A;  3KO6 A;  1TS7 A;  5DTK A;  1SKF A;  2ZMF A;  1FCO A;  5BOH A;  1RGZ A;  4H6J B;  3IX4 A;  4KZ3 A;  3G6O A;  3AGE A;  1A0K A;  3LIF A;  3C38 A;  3OLO A;  3V50 A;  2NUT C;  3M2J A;  1P97 A;  2H5S A;  4B4Z A;  3V3R A;  5DVA A;  4X6T A;  2EX9 A;  5L10 A;  1JWP A;  4NXE A;  2A24 A;  2VJW A;  4KZ4 A;  2Y2M A;  3RJU A;  2VV6 A;  2XRO A;  1OTI A;  1NYM A;  5EE8 A;  3UY6 A;  1DRM A;  1LT0 A;  3CWF A;  4RX3 A;  3MF0 A;  1PWD A;  1YMX A;  5DFX A;  5HL6 A;  1IFQ A;  1V9Y A;  3R4K A;  4MN7 A;  4IBR A;  1ERO A;  3E4O A;  1ESU A;  4N1H A;  1GCE A;  3A0S A;  3QP4 A;  3U4L P;  2J3W A;  5A8B A;  2PRF A;  4CPK A;  1GA0 A;  3CUE C;  3TJZ C;  4DE1 A;  3HRE A;  4L9G A;  2CC1 A;  3D72 A;  3S7O A;  2H0T A;  4RQ9 A;  2O0Y A;  4JF4 A;  1PW8 A;  4NG2 A;  1GHP A;  4JF5 A;  2VGK A;  1VQQ A;  3S7Q A;  2J9P A;  2XD5 A;  2M1C A;  3CMZ A;  4CLC C;  3BFG A;  3PBO A;  2QWS A;  3WRT A;  4M4X A;  5D3O A;  3VSL A;  5FEG A;  2GJ3 A;  4GKU A;  3F1N B;  4N92 A;  5CX7 A;  1OJ5 A;  4BD0 A;  2WAD A;  3EQV A;  1KGF A;  4R70 A;  3ZG0 A;  3OPR A;  5GHY A;  3V39 A;  1AXB A;  4S2M A;  2V1B A;  2G2W A;  4G3W A;  1DJA A;  1MZU A;  3IX8 A;  3EEA A;  4MNR A;  5M18 A;  4UQI M;  4OQ0 A;  3RXW A;  4N9L A;  4E3J A;  1Y28 A;  5JYP A;  3IS2 B;  4OQH A;  4E3L A;  4GZB A;  5FSR A;  2JCH A;  3MZE A;  1N9O A;  4HIA A;  2GX5 A;  2MJ6 A;  4ETX A;  3KSF A;  3NOU C;  3OBF A;  3E0Y A;  4UA6 A;  1RCJ A;  3MFX A;  1TS8 A;  4MLL A;  4BBT A;  4F3L A;  4LRZ E;  2X01 A;  3PBQ A;  3UDF A;  5HSQ A;  5FEF A;  5EOO A;  1SZV A;  2QJ7 A;  3FKW A;  2XF3 A;  1XA1 A;  4KUK A;  4B88 A;  2K7S A;  3IBJ A;  4OQG A;  4QJG A;  3PYP A;  4R4R A;  2OLU A;  2IWD A;  2ZC3 B;  1AWI A;  5JYO A;  3IH8 A;  1ES3 A;  1MPL A;  5J3W A;  2EX2 A;  3MMH A;  3ZNT A;  4R38 A;  2V8F A;  2Q0O A;  3ZCZ A;  1KDS A;  3MJQ A;  1STZ A;  1PW1 A;  3F1O B;  1PZP A;  2WKE A;  3LIE A;  4EUZ A;  1G5U A;  2P08 A;  3H82 A;  3HCY A;  4IVK A;  1DP6 A;  3A0V A;  4S2L A;  1VHM A;  2GNX A;  1S66 L;  4E3I A;  5E2F A;  5CGW A;  3Q81 A;  5EM1 A;  2Y59 A;  3LY3 A;  1XJ4 A;  4IHQ A;  4I3J A;  4RA7 A;  2PU2 A;  4Y7P A;  3BQ8 A;  1XFQ A;  3NBL A;  3AGF A;  4WYY A;  2JE5 A;  2K2N A;  1CF0 A;  3Q7V A;  1K4E A;  5CXW A;  5FAS A;  3V5M A;  3S22 A;  2M7V A;  4DE2 A;  4FH2 A;  4Y15 A;  1LLB A;  4ZRR A;  3UE0 A;  2HJE A;  4K08 A;  1S4S A;  1UWP X;  2HDS A;  1ONH A;  3BRM A;  1XP4 A;  1GHI A;  3QP1 A;  2M7U A;  3NIA A;  2WAF A;  4HP4 A;  2PBD P;  4KG5 A;  5FAP A;  4XUX A;  1YLJ A;  3LID A;  1F98 A;  4KQD A;  4EW7 A;  4UQI S;  4FTX A;  4IED A;  3BQA A;  3E98 A;  2PR5 A;  3UB8 A;  2ZL1 A;  1N9B A;  5DFY A;  5E2G A;  5EVE A;  4LPZ A;  3IH9 A;  4O8G A;  1W7F A;  3BFD A;  1G68 A;  1BZA A;  1P9W A;  1KVL A;  2C5W B;  2A3U A;  3UME A;  4NXG A;  4U3T A;  3IQA A;  5CGS A;  4PM9 A;  1YKD A;  1H5X A;  1ZG6 A;  4E6W A;  2V1Z A;  1YAX A;  3UB6 A;  1WA9 A;  5FI6 A;  1TEM A;  4R6L A;  4R23 A;  1KE4 A;  4LCM A;  1FCM A;  4OP5 A;  2V9A A;  3UDX A;  1LL8 A;  2K31 A;  5IU1 A;  5EV0 A;  3VP4 A;  2WYX A;  2Y2P A;  4MN5 A;  3T4L A;  1LL9 A;  1NZO A;  4II7 A;  3O3V A;  4P6B A;  4WEJ A;  1G28 A;  2OSU A;  3IF6 C;  3ZFZ A;  1JNU A;  1ODV A;  2RCX A;  4HNB A;  1JWV A;  4GS9 B;  4ARZ B;  3T1Q B;  4HEF A;  1K54 A;  2XR0 A;  4Q0H A;  2RL3 A;  2J9O A;  3B3X A;  2JKR I;  2Y8H A;  3C7V A;  1YM1 A;  3VP0 A;  1CEG A;  1KE3 A;  1H8M A;  5CTN A;  5F5Y A;  3TG9 A;  4GHI B;  4LV3 A;  5KIZ A;  2PBY A;  3WS0 A;  3DTI A;  2WGW A;  3GV9 A;  3IXB A;  3LEQ A;  2V0W A;  4X56 A;  3MXQ A;  4E3N A;  3T1S A;  4DJ2 A;  1F5M A;  5L2F A;  3R7W A;  3MR0 A;  4NK3 A;  1K6S A;  4DXB A;  1HLU P;  2HDR A;  3S4X A;  1J3W A;  1H8Z A;  4X53 A;  1K57 C;  4WL9 A;  5HAR A;  1BSG A;  3LR0 A;  3BEC A;  4OKP A;  5HWV A;  3KSI A;  1KDW A;  4PMA A;  5DKL A;  3SOI A;  1BT5 A;  1K54 C;  3F1P A;  1OTA A;  1E3U D;  1TD5 A;  3K3C A;  1IKI A;  3QP2 A;  1JVJ A;  3N8R A;  2OWJ A;  2EWW A;  1GSV A;  3VMA A;  1LI9 A;  4D60 A;  3BFC A;  4JGO A;  3HLC A;  4OON A;  4C75 A;  2ZQA A;  1LSW A;  4HHD A;  4MMN A;  1EI5 A;  5HPF A;  4Y0O A;  4PM6 A;  3LEZ A;  2VEA A;  2ZC7 A;  5J7E A;  4NET A;  4GD8 A;  4KUO A;  4XUZ A;  2Y2J A;  4GN2 A;  1L0G A;  4RX2 A;  1W5D A;  2Y2H A;  2D01 A;  5CHM A;  5CEC A;  1OME A;  4BLM A;  4JGR A;  1YPR A;  2JKT M;  5CRF A;  4PM7 A;  5EVL A;  4EBP A;  4ZAM A;  1D1J A;  1OPX A;  3KYZ A;  5L07 A;  5MC7 A;  1ERM A;  1SDN A;  2VK3 A;  3CI6 A;  4WZ5 A;  5I5L A;  1K4F A;  3BM6 A;  3LI8 A;  4HBT A;  3MXS A;  3ZDJ A;  1BUL A;  1IEM A;  3UE1 A;  4PKY G;  2WKI A;  4BQM A;  4BL3 A;  2PDR A;  4KG6 A;  1DJB A;  3NUL A;  1L2S A;  2R9W A;  3N6I A;  3ZVW A;  3P01 A;  2L0W A;  4YIN A;  5FDS A;  2BAS A;  4KZA A;  3MXR A;  1DJC A;  4KEN B;  4QHC A;  3EGD C;  3UPP A;  4GW9 A;  3G32 A;  5AVF A;  2B02 A;  4MBK A;  3E4P A;  3CIT A;  4YFM A;  1G6O A;  2J80 A;  4XT2 A;  4R4S A;  2EX6 A;  4NEE D;  4P87 A;  5FQQ A;  4WF0 A;  1H0M A;  2HPB A;  4WBG A;  3CUE A;  1HVB A;  2OAQ 1;  2VZW A;  3IWO A;  1K25 A;  2W0N A;  3ZG9 B;  4DJ3 A;  2ZOI A;  2W1T B;  2KOI A;  1HTZ A;  5FQK A;  1VET A;  4L0L A;  1D7E A;  1ES5 A;  5HAI A;  1XFN A;  1ZHH B;  2EXA A;  2X71 A;  2QMI A;  4DF6 A;  2P74 A;  3NJA A;  1X0O A;  4QY5 A;  3T4J A;  4CLC A;  3A0R A;  4G3V A;  1CK3 A;  3L9K A;  5G4Z A;  1XKZ A;  4WZ4 A;  2EX8 A;  4XXR A;  1PWG A;  2Y91 A;  3P98 A;  3HLB A;  4ETZ A;  4HH2 A;  1Q2Q A;  3SS5 A;  5CEB A;  1PIO A;  1WE4 A;  3IHA A;  3T4O A;  3P7N A;  3HVF A;  3E4Q A;  1K38 A;  4IUK A;  5G4Y A;  4Q8I A;  1K56 A;  4KZ9 A;  3QNB A;  1U60 A;  5DF8 A;  4JF6 A;  4KZB A;  3UE3 A;  1BUE A;  1L0E A;  4OP8 A;  3EOI A;  4S2K A;  4OPY A;  2Z2L B;  4YOF A;  4G3K A;  4ID4 A;  4O7D A;  5FQI A;  3CLO A;  1T19 A;  4IUH A;  3IWQ A;  4KZ5 A;  2IWB A;  3B42 A;  1K6R A;  3FPW A;  3OPL A;  3IXG A;  2BG1 A;  5FAO A;  1FR1 A;  5CHU A;  4YWZ A;  1Z6F A;  4DE3 A;  4IVI A;  5FDH A;  1FIK A;  4HOI A;  4O0P A;  3DWZ A;  4LGW A;  2ZC4 B;  4PM5 A;  2VGL S;  4P6Z M;  4OH0 A;  2KDK A;  3FV7 A;  3C7U A;  3EQU A;  3PBN A;  4GOG A;  4E6X A;  1RP5 A;  1T1A A;  2WK0 A;  3F1N A;  3VFH A;  3ZNY A;  3KSH A;  1IEL A;  4N1X A;  1YLP A;  1S67 L;  1YQS A;  4EBL A;  4WM9 A;  3ITA A;  5FAT A;  2J3T C;  3JVV A;  1WYC A;  5KSH A;  2IWC A;  5DTS A;  3FKV A;  5F1F A;  2DNS A;  3OCL A;  3NOT C;  4F3L B;  3IS2 A;  4JXS A;  1QME A;  1CJF A;  3NEC A;  3LIC A;  4LRX C;  1SKO A;  3L7H A;  3D3O A;  2WKR A;  2WGV A;  3MSH A;  3EGX C;  3BY8 A;  3ISG A;  2EFX A;  1S0W A;  2I72 A;  2AVX A;  4LFU A;  2PYR A;  3GRJ A;  1TF1 A;  5EFW A;  4ZJ3 A;  1ES2 A;  2VV8 A;  4Q0I A;  3LR5 A;  3M6B A;  1CI9 A;  3SH9 A;  3EWK A;  3BLM A;  4X25 A;  4HJ6 A;  2VV7 A;  4Y2F A;  5U47 A;  2ZMV A;  4UA7 A;  1UGU A;  3OCN A;  5IS1 A;  4S2O A;  2EFU A;  5LBR A;  1NWZ A;  5A91 A;  3H82 B;  3H9W A;  3N7W A;  2HF6 A;  2XDM A;  3A3E A;  4DDS A;  1MWS A;  2VLG A;  3E2K A;  1G6A A;  2G2U A;  3P09 A;  3NCK A;  3AGD A;  4HY8 A;  2B95 A;  2BLS A;  4L9F A;  3F1O A;  3Q7V B;  2G7U A;  3GDI A;  4LCL A;  2DMW A;  1BYW A;  2YKH A;  4GB7 A;  2Z2M B;  5DF9 A;  4ZTK A;  3MZF A;  4GJ4 A;  5KSC A;  3IXH A;  3MZD A;  2A2L A;  4GLQ A;  4MCW A;  4ZDX A;  2XH9 A;  1VEU A;  3OOV A;  4LLO B;  4P6Z S;  3GSG A;  5HD3 A;  2Y2O A;  4C3Q A;  2ZQ8 A;  4NKP A;  4RVA A;  4NXB A;  4WMC D;  2ZOH A;  2A49 A;  3GTC A;  5KMW A;  3PR6 A;  3BWL A;  4UEY A;  3LYX A;  1JWZ A;  1XJ2 A;  2V8C A;  3B47 A;  3ZQ5 A;  5HWW A;  2J7V A;  1CEF A;  3KYQ A;  4EUV A;  4CJN A;  5EVI D;  1KGE A;  2FZ0 A;  3IF5 A;  4R3J A;  1TDG A;  4EER A;  4X68 A;  3FYZ A;  3VV4 A;  3IF6 A;  3T1X A;  4M3K A;  2WKP A;  1Z09 A;  2Q9N A;  3BW6 A;  2Y2N A;  1O07 A;  3T12 B;  3BFE A;  2Z6D A;  1T1C A;  3G2Y A;  5DTT A;  5DJU A;  1ZKJ A;  4MEZ A;  1FSW A;  5GHZ A;  5EPH A;  1S6R A;  2JHE A;  5DKK A;  3VP2 A;  5AQA A;  3TSG A;  5GHX A;  1I5Q A;  1KVM A;  3JYI A;  3V3S A;  4QD4 A;  3VFF A;  5HPI A;  2QPN A;  4R1G A;  1VB6 A;  4U0X A;  4EET B;  2PD7 A;  2H0Y A;  1YT4 A;  4S2N C;  2V1A A;  1LHY A;  3WS5 A;  1PRQ A;  3HUN A;  3SS4 A;  1ZTU A;  2JKR M;  2PT7 A;  1K57 A;  3ZG7 B;  3ITB A;  4QU3 A;  3K2N A;  3TW8 A;  1L3L A;  1MY8 A;  2PAV P;  3MBZ A;  4FH4 A;  5I94 A;  5HDD A;  4MBF A;  3NI9 A;  3PXP A;  5A92 A;  2B18 A;  3N8S A;  3CPT B;  4BD1 A;  4OOY A;  1SHV A;  1P9R A;  1SDE A;  4QPR A;  1RGY A;  1FCN A;  2WGW B;  3CHW P;  4JXW A;  3O87 A;  1ES4 A;  1LL5 A;  3GMW A;  3H7W B;  1ALQ A;  4B93 A;  4KQQ A;  1S1Y A;  3W4Q A;  3C2W A;  5F83 A;  4GHI A;  5FQJ A;  2EWV A;  1OTE A;  4NXF A;  5TJJ A;  1MXO A;  1EWZ A;  1CI8 A;  2XA7 S;  4OPR A;  3DWK A;  5TFQ A;  1PNE A;  3KYE A;  1ESI A;  1V9Z A;  2O9B A;  4EWF A;  3TOI A;  1GHM A;  2J8Y A;  3C30 A;  4B9O A;  4DRT A;  2VKS A;  1SCW A;  2V0U A;  2ZC6 B;  3A3I A;  3DAV A;  3F1P B;  4Y5F A;  2YKF A;  1PI5 A;  5FQM A;  4Y3I A;  3NOP C;  3OPP A;  3DBA A;  3LGO A;  5FA7 A;  3CJM A;  4GD6 A;  5EVI B;  5HL1 A;  2BTF P;  4WN5 A;  3WWX A;  1TS6 A;  2ZQ7 A;  4E3K A;  3JPU A;  2ZQ9 A;  1Y54 A;  2W27 A;  5CHJ A;  2ZM2 A;  3VE3 A;  3BYD A;  4I3I A;  3FG8 A;  1OT9 A;  2Y79 A;  4CLC E;  3HBR A;  2XSS A;  1EW0 A;  1MWT A;  2PD8 A;  3OPH A;  2P7J A;  3ZHH A;  4OLG A;  5DF7 A;  1FQG A;  4UA9 A;  1MBL A;  1FR6 A;  2Y4A A;  3UPO A;  4C6Y A;  4FOF A;  5FQ9 A;  2P9V B;  3W4P A;  4BL2 A;  2FH5 A;  4Y17 A;  1P0Z A;  1XJ3 A;  4DE0 A;  5KZH A;  3SH7 A;  4YNR A;  2GZA A;  4BJP A;  3VP1 A;  3LUQ A;  1WYB A;  2E8J A;  5IHV A;  2EA9 A;  2ZM8 A;  4R3A A;  2VGL M;  2JN7 A;  3D4F A;  5FL3 A;  2O9C A;  2Z6C A;  4EBN A;  3CG5 A;  3EEH A;  5EVI C;  3E2L A;  2OLV A;  1IYQ A;  3VP3 A;  4ESP A;  4WUJ A;  2E8I A;  3PHY A;  2DCF A;  4Y0T A;  3A3J A;  4BMW A;  5AJG A;  4O01 A;  3O5Y A;  3ZGA B;  3RFB A;  1LSV A;  2ZD8 A;  4HP9 A;  4I3A A;  1I2S A;  3M6H A;  3W4O A;  4PAU A;  4U0T A;  2ZLY A;  5AQB A;  4EQI A;  2XFS A;  2XEP A;  3PAE A;  2Y2L A;  1NLY A;  3SH8 A;  3T1R A;  4N9K A;  3HJK A;  1K55 C;  4IBX A;  1MWR A;  3BFF A;  3G4P A;  5HWT A;  5F6A A;  3S7N A;  1MKI A;  1OJG A;  1HZO A;  5M1A A;  3NY4 A;  3RH8 B;  1M40 A;  1VET B;  5TBM A;  5HFO A;  3SW1 A;  3VOY A;  1XX2 A;  1IKG A;  2GDN A;  4KZ6 A;  2KX6 A;  4R3B A;  4CLC B;  2OV5 A;  4KQO A;  4JGP A;  4K0X A;  2A24 B;  2W1T A;  3UB7 A;  4H6J A;  3IHB A;  1BLH A;  2XK1 A;  2Y55 A;  1PI4 A;  4S2I A;  2WAE A;  4X55 A;  5HX9 A;  1YSQ A;  2EXB A;  1YLY A;  2R78 A;  4KG2 A;  2W3E A;  2X02 A;  2Q9M A;  3QHY A;  2O99 A;  1GSW A;  4LRY C;  2PU4 A;  4QB8 A;  4JGQ A;  1E3U A;  2QKP A;  3HUO A;  2W3D A;  2WKQ A;  1MKM A;  1C3B A;  1H8Y A;  1S4R A;  3G35 A;  1Q2P A;  2HV1 A;  4K0W A;  1UWN X;  2OOL A;  3Q7Z A;  3DTM A;  4DMZ A;  1IYS A;  2XD1 A;  1FSY A;  2Y2Q A;  4A5R A;  4F94 A;  2C6W B;  4KQR A;  3GQZ A;  3UN7 A;  3UMD A;  2WZZ A;  3ZVT A;  2FFY A;  2ZBB A;  1K0K A;  5HDS A;  1YLZ A;  3HJI A;  3G2Z A;  1FIL A;  3LFV A;  1MWU A;  4S2J A;  4PPR A;  3LO7 A;  4QY6 A;  1F9I A;  1DP8 A;  1KGG A;  1ZG4 A;  1XA7 A;  4MBH A;  1DP9 A;  3FWL A;  3LIB A;  1OT6 A;  4WLA A;  1T18 A;  3GR2 A;  2HP5 A;  5EUA A;  1GA9 A;  3RXX A;  4DXC A;  5GL9 A;  2W3F A;  1O7E A;  1DY6 A;  3UB5 P;  3BLS A;  3VE4 A;  3T50 A;  4K91 A;  3C4P A;  3UNW A;  5CER A;  2FFF B;  3T4Q A;  1CQA A;  1S1Z A;  1W63 M;  3U2A A;  1L0D A;  3MFD A;  5HAP A;  2LB9 A;  4I39 A;  3IBR A;  3FPV A;  3LI9 A;  4X69 A;  5EM0 A;  1F2K A;  4PHT A;  3VOZ A;  5E43 A;  2ZJ9 A;  1IYP A;  4BWI A;  4JBF A;  2I9V A;  4QWO A;  1IYO A;  2ZQD A;  1SKO B;  4B4X A;  5A90 A;  3BY9 A;  3UDI A;  3NDE A;  2DRW A;  3A3D A;  4I5S A;  4P85 A;  4EXO A;  3LR4 A;  3HL9 A;  4PKY A;  4Z9Q A;  5AQ7 A;  3DTE A;  4EU0 A;  4EQ1 A;  1ERQ A;  1E25 A;  1I2W A;  4FUW A;  5G18 A;  1LSX A;  4KZ8 A;  1OTD A;  4LEN A;  5AQ9 A;  5HDC A;  3VSK A;  4DKI A;  3ZG5 A;  2WGI A;  4L9E A;  3W8K A;  4CQH A;  4WEK A;  3WS4 A;  3MS6 A;  1ACF A;  4UAA A;  3PBS A;  5DJT A;  4GCZ A;  3IT9 A;  5F68 A;  3TRC A;  2PHY A;  3S7P A;  3ZG8 B;  2XLN A;  1FOF A;  1VEU B;  4OOL A;  2PYP A;  1VM1 A;  2HJ9 C;  1LI0 A;  2ZMA A;  3CZD A;  1IOU A;  2CMN A;  2HDQ A;  5CGX A;  1NZU A;  2XA7 M;  5L8M A;  5EEC A;  3W2Z A;  1PYY A;  1W8Y A;  2VGJ A;  2W3G A;  2ZL1 B;  5HZH A;  4S2N A;  3BEB A;  3UB9 A;  3IF6 B;  3Q07 A;  5EOE A;  2H10 A;  1W8Q A;  3QP8 A;  4JXG A;  4EES A;  5M19 A;  3IX3 A;  4GDN A;  3SS3 A;  1JTG A;  2W3H A;  1N9L A;  2WUQ A;  3FC7 A;  1OTB A;  1NRJ A;  1BLS A;  3D9Y A;  2UV0 E;  5F82 A;  1ZC2 A;  4OLD A;  2QYB A;  3IWI A;  1W63 Q;  4HJ3 A;  2ZM0 A;  2XFT A;  3DTK A;  4HI4 A;  4MDZ A;  4ZJ1 A;  2Y2K A;  1XPB A;  1YLW A;  4EV4 A;  1NY0 A;  3ZYT A;  4X1L A;  3M2K A;  2H28 A;  5FI7 A;  3HUM A;  4DDY A;  1H3Q A;  3IXD A;  2HP6 A;  4EEU A;  2Y2G A;  3O88 A;  3K3D A;  3OC2 A;  2ZQC A;  1KOU A;  3MQQ A;  5GLB A;  3BJN A;  2QJ5 A;  4KZ7 A;  2PR6 A;  2INW A;  1GSX A;  4BBU A;  2B5R A;  3NDG A;  3V67 A;  3HLF A;  4BBV A; 
#chains in the Genus database with same CATH homology
 3T12 B;  1SKO B;  4X25 A;  5EM1 A;  2E8J A;  1CF0 A;  1A0K A;  5EV0 A;  2ZL1 B;  4D60 A;  1PNE A;  3KYE A;  2HZ5 A;  1FIK A;  3DAV A;  2JKG A;  4ESP A;  1K0K A;  3CPT A;  1PFL A;  1FIL A;  2B95 A;  4FUW A;  3T1Q B;  1VET A;  3LGO A;  2PBD P;  2BTF P;  3D9Y A;  5FEF A;  1YPR A;  1SZV A;  3T1R A;  4FTX A;  1D1J A;  1PRQ A;  3L9K A;  4X1M A;  3U4L P;  2PRF A;  2VK3 A;  1VEU A;  2ZL1 A;  1AWI A;  3MS6 A;  3UB5 P;  1ACF A;  2ACG A;  1VET B;  2PAV P;  3LEQ A;  5EVE A;  4X1L A;  3T1S A;  1CJF A;  1CQA A;  3NEC A;  1SKO A;  3L7H A;  3NUL A;  2V8F A;  1HLU P;  2V8C A;  3MSH A;  3CPT B;  1VEU B;  1J3W A;  2JKF A;  5EM0 A;  1F2K A;  5FEG A;  5FDS A;  1G5U A;  3CHW P;  3T1X A;  1Y4O A;  1Z09 A;  4QWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...