3MSHA

Crystal structure of hepatitis b x-interacting protein at high resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatitis B virus X-interacting protein
publication title Structural Characterization of HBXIP: The Protein That Interacts with the Anti-Apoptotic Protein Survivin and the Oncogenic Viral Protein HBx.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 20
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16672 LAMTOR5 Ragulator complex protein LAMTOR5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3mshA00
4X1LA 1SKOA 1K0KA 2V8CA 1HLUP 3MSHA 3CPTB 1CJFA 4QWOA 3L7HA 5FEGA 4ESPA 3T1RA 2E8JA 1AWIA 1FIKA 5FEFA 3CPTA 3DAVA 5EVEA 1PNEA 3T12B 1PFLA 1SZVA 1VETB 2ACGA 2PBDP 2BTFP 1J3WA 1PRQA 3T1SA 2B95A 3T1XA 4D60A 5FDSA 1VEUB 1VETA 3LEQA 5EV0A 1FILA 3NULA 2HZ5A 1VEUA 3D9YA 3U4LP 1Z09A 2PRFA 3CHWP 2PAVP 1F2KA 2ZL1B 1CF0A 4FTXA 3NECA 3MS6A 2V8FA 2VK3A 1A0KA 4FUWA 2JKGA 2ZL1A 1ACFA 1YPRA 3L9KA 5EM1A 1Y4OA 1D1JA 3LGOA 3KYEA 3UB5P 1SKOB 4X25A 1CQAA 5EM0A 4X1MA 3T1QB 1G5UA 2JKFA
chains in the Genus database with same CATH superfamily
5EVIC 3VSLA 4FOFA 5J8XA 2RCXA 4EW7A 4E6WA 3HLCA 5CGXA 5HAQA 3NC8A 5CEDA 1LI9A 5M1AA 5CTNA 3T4LA 4X69A 1XXMA 2P9VB 2OOLA 3UB8A 4OPRA 4LCMA 3UE1A 2WZXA 1PWDA 4LENA 4P6ZM 3SS3A 5A90A 3F1NB 4IUKA 3ITBA 2VV8A 3T12B 2P9VA 5FAQA 2XA7S 1SDEA 1L0GA 4E3OA 2PU2A 3BLSA 5HWTA 3EQVA 1EWZA 3KSGA 3NDGA 4R0QA 1IYOA 1YMSA 5EVLA 1YSPA 1TDGA 5CGWA 4HP4A 1MWUA 5A92A 3NDEA 1TS0A 2ZM8A 3IBJA 3Q7VB 4JF5A 2JC7A 5G4ZA 3TG9A 2VGLS 4HQAA 2PAVP 4ZDXA 1BLHA 4KZ5A 4EUVA 3Q7VA 2M7VA 4OLGA 3HCYA 4GJ4A 3MS6A 3V3SA 2EWVA 2J8YA 3IF6B 1NLYA 1ESUA 3MJQA 5G4YA 4I38A 3QP6A 3S4XA 1J9MA 3LR0A 1ES3A 1SKOB 2OWJA 3VP0A 3IF6A 2W3EA 4Q0HA 3IXBA 1OPXA 2OAP1 3T1QB 1DJAA 4S2IA 3IXHA 4CLCC 1SKOA 3NJAA 4HEFA 3ZG8B 1S4RA 1XJ2A 1T18A 3GDIA 2VA0A 2WKRA 3ZVTA 1D06A 5C5KA 1N9BA 1K4EA 1GCEA 5CXWA 4XUZA 4Y0TA 5A8BA 4JPMA 1KE4A 4LV0A 3IX4A 4GDNA 5TFQA 1YLWA 1PFLA 4O7DA 3IH8A 4BBVA 3P09A 1UWPX 1KGFA 4S2OA 3P7NA 2D02A 3HLWA 5HW3A 4OLDA 5J4EA 1GSWA 5FI7A 1BYWA 1GHPA 3BFFA 2HP9A 2ZJ9A 4Y17A 2X02A 5E2GA 1LT0A 1GHIA 1ALQA 1DP6A 5GLDA 5TR7A 1IELA 3UB9A 2JKRM 4DJ2A 4RX3A 3W4OA 4EBNA 2Y59A 1A0KA 2Y8HA 1TS7A 5L2FA 4BBTA 1PYYA 2KDKA 5HAPA 3D4FA 2FFFB 4JGOA 1F5MA 4B88A 3DWKA 1NLZA 5EM1A 3AGDA 1L0EA 4QPRA 2M1CA 2WZZA 4RA7A 4WLAA 4HIAA 4JF4A 3A3DA 4PMAA 1FCOA 4EBLA 1ONHA 3RXXA 2J80A 3CJMA 3N8SA 4WZ5C 3ZNTA 1K54C 5AQAA 3CWFA 3UPNA 3KYQA 4GDBA 2AVXA 3EEAA 4HESA 1KVLA 2IWDA 2HDRA 2W27A 1MBLA 4UA6A 1L3LA 5HD3A 3A3EA 3BFGA 3CPTB 4X68A 4GW9A 1W8QA 4X56A 2Y2IA 1JTGA 3G32A 3CPTA 2L1MA 4WELA 5AQ9A 1I5QA 4P85A 1TS6A 3K3CA 3OLOA 4LV2A 4D60A 3UN7A 3A0SA 4E6XA 3N8LA 2WUQA 1V9YA 1W7FA 2EX9A 2JBFA 4JLFA 4WN5A 3BJNA 4BMWA 1T19A 1OT6A 4NETA 3D9YA 5L8MA 3IWIA 4JGQA 2W3DA 5HDCA 5GL9A 1S1ZA 3VP2A 4NXBA 5I5LA 1PW1A 5M18A 5TBMB 2K31A 1BTLA 5FQMA 2G2WA 4FTXA 3AGFA 2VK3A 1NRJA 4R23A 3ZVWA 5TBMA 2G2UA 1YPRA 1XP4A 3ZFZA 3L9KA 4L9EA 3BEBA 2H5SA 3UB7A 4ZTKA 2INWA 4NXGA 1IKGA 2QJ7A 4IBXA 1SCWA 3Q1FA 2VZWA 1CQAA 3W4QA 1IFQA 4DDSA 4IVIA 2K2NA 2ZC4B 1ESIA 3HLGA 1JWVA 1GSXA 4DF6A 1K0KA 2Y2NA 1P9WA 1HLUP 2WKPA 4E04A 4EUZA 4KZ9A 4R4RA 1CJFA 1N4OA 4ETXA 1UGUA 1MWRA 2XH9A 4KZBA 5I94A 2QKPA 3PBSA 3UE3A 2V2FF 3M6BA 1N9LA 4MMNA 1Q2QA 3BY8A 4EERA 3KO6A 2ZQ9A 3HL9A 5E2EA 3CLOA 4JBFA 2OAQ1 3EWKA 5HDDA 3HUNA 4N9LA 5FQIA 5FDSA 3OPRA 2WK0A 1VEUB 5FL3A 2A24B 3ZCZA 4R38A 5FA7A 3WRZA 1HTZA 1BLSA 5IHVA 3OBFA 1DJCA 1VEUA 2A24A 2O9BA 2W1TB 4OH0A 3W2ZA 1XX2A 3WS2A 2O9CA 1UWNX 3U2AA 4K08A 5JYOA 4IHQA 5F82A 4P6ZS 4XUXA 4E3IA 4LRYC 3S7QA 3JYIA 3GQZA 3QNBA 3LY4A 5DFXA 1H0MA 4KG6A 4CQHA 4KQQA 4LRZE 1G28A 2B18A 5DKKA 3T4JA 4G3KA 5EM0A 2G7UA 2O9AA 5JYPA 3DWZA 1VB6A 5CX7A 5GLCA 1K57C 5FQJA 4JXWA 4Y7PA 1LHYA 4X1LA 1XFNA 1Q2PA 4LLOB 1S6RA 2Y2MA 2ZM2A 2WKEA 2WGVA 2H10A 5DFYA 3G30A 2Y2OA 3NCKA 4LCLA 4KZAA 3WS1A 2EA9A 2XSSA 3UO9A 3SW1A 1X0OA 1DJBA 2FFYA 2HJ9C 4GKUA 4KQDA 1EI5A 5F83A 2E8JA 3CUEA 1VQQA 3A0VA 3HLFA 5CERA 5DKLA 1U60A 4P6BA 4EWFA 2WGWB 2J9OA 3BFDA 2HP6A 2ZC6B 4K91A 2HDSA 3HLEA 3WWXA 4KENB 1ES4A 4LGWA 1V9ZA 1T1AA 2WGWA 1K55C 3FPWA 4NEED 1FCMA 1OTEA 1CK3A 5HAIA 1Y54A 1PW8A 1YLTA 4BBUA 4XT2B 3VE4A 2R9WA 2PD8A 4BL3A 3MXQA 1NXYA 4DXBA 2KOIA 4XT2A 4EXOA 1JVJA 3DTEA 4S2NA 5DF8A 3PAGA 4HOIA 4S2MA 2JKGA 3SH9A 4K0WA 1ACFA 1G6AA 5J7EA 3MQOA 2L4RA 2XFTA 2PT7A 3LCEA 1F98A 2BASA 5HZHA 2B02A 1CEGA 4UAAA 3IF6C 4B4XA 1TDLA 3ZG7B 5DVAA 1GHMA 4YNRA 4OONA 2Q9MA 3EGXC 4UQIS 5FQQA 3NOTC 2JKRI 3K3DA 4QY6A 1KOUA 2VKSA 4U0TA 4KUKA 5KSCA 1VHMA 4JGRA 4DMZA 3FWLA 4IJGA 3NY4A 2WKQA 1WE4A 3NI9A 4NK3A 1SZVA 1YLYA 3JVVA 1J3WA 1KGEA 2WAFA 1F9IA 2WYXA 1SHVA 3BQ8A 2O0YA 1I2WA 3TW8A 4YFMA 3R4KA 2J7VA 4HJ6A 3F1OA 3KSHA 3ITAA 4WF0A 4PM8A 1YT4A 4KZ7A 2HZ5A 5EOEA 5HPIA 4ME4A 3LIFA 2YKHA 3LIDA 2MJ6A 2ZL1B 5CGSA 3OPLA 5E43A 2K7SA 3NHQA 2ZC3B 4IBRA 2LB9A 4PM9A 5HD5A 2JCHA 3IT9A 3VFFA 1RP5A 2ZL1A 4UEYA 5G18A 5FI6A 3CZDA 3S7NA 3UNWA 2WGIA 3QHYA 1L0DA 4X1MA 2DRWA 2I72A 2Y2JA 2A2LA 2O99A 2OLUA 1SKFA 3B3XA 4HHDA 4IUHA 2IWBA 2GZAA 4Y15A 2PU4A 2OSUA 1ONGA 4WMCA 3CAXA 2ZMAA 3BW6A 3MFXA 4ESPA 4G3VA 1AWIA 4K0XA 4PPRA 4FD8A 3HVFA 4O01A 1YLZA 2M7UA 2ACGA 2PBDP 3H7WA 4GS9B 2PR5A 2UV0E 3O5YA 3T4TA 1YLJA 1G68A 1S0WA 4CLCE 5DTSA 4CJNA 4CPKA 1LL5A 1H8ZA 2GX5A 3NBLA 4GS9A 1TVFA 2J9PA 3Q07A 3E98A 3SH8A 5F5YA 1BZAA 2R9XA 3D3OA 5A91A 3U4LP 1HZOA 3VV4A 1S4SA 2XR0A 5GHYA 3I7JA 4YWZA 4WUJA 2QMIA 2ZQDA 3ULFA 1JWPA 2X71A 3LEZA 4MN7A 1W79A 3G34A 4Z1WA 4EEPA 4S2LA 3IH9A 3ZDJA 2WADA 2XK1A 3ISGA 3LIBA 3PBTA 1NYMA 3G6OA 4GD8A 1D7EA 3QNCA 4ZBEA 5FASA 2PD7A 3N7WA 3CITA 4MN5A 3KX0X 4FSFA 4S2KA 1KDSA 4KQRA 4I39A 4GLQA 3O86A 2ZMVA 1G6OA 1K25A 4Y0OA 4WMCD 3ZG9B 3IWQA 4N92A 4HY8A 3WS0A 3EEHA 3AGEA 3PTEA 3NIAA 3T1RA 4KZ6A 1IOUA 4JXVA 1SDNA 3MKEA 2V1ZA 1KE0A 4Y5FA 1NZOA 2W3FA 2J3TC 4UHUA 2XD5A 2ZC5B 1XA1A 3A0RA 3LFVA 3UMDA 1S1YA 4HJ4A 2PR6A 2GNXA 3QP8A 4DXCA 5AVFA 1IEMA 5AQBA 2HJEA 3TRCA 1LSXA 4RQ9A 2XA7M 1NZUA 1WA9A 3O3VA 2Y2QA 4CLCB 4WL9A 2W0NA 1CF0A 3VP1A 1ZC2A 1BSGA 1K4FA 4LRXC 4CLCA 4N9KA 3C38A 4PHTA 1QMFA 1KVMA 3OC2A 3MZFA 2PYPA 3EOIA 3MBZA 2DNSA 5F1GA 1K56A 3LGOA 4E3KA 3A3FA 3UB5P 3M6HA 2WKHA 4EETB 3FZCA 2EFUA 3IXGA 1W63M 3HUMA 5GHZA 3PR6A 4I3AA 5TJJA 1MXOA 1OTDA 1QMEA 1XJ4A 2VV6A 4QJGA 1ZKJA 1W63Q 5F69A 1XGIA 5FSRA 2XLNA 3HBRA 3LO7A 3FKVA 1MZUA 2BG1A 1MWSA 5IS1A 2ZMFA 1ZTUA 4FCFA 5EUAA 1E25A 2HV1A 1LSWA 1Y28A 3ZNYA 1KE3A 5E2HA 4ZRRA 3Q7ZA 3C2WA 2B95A 4OPZA 4I3IA 2Y55A 1S66L 4HP9A 2V1BA 3SS5A 2WAEA 1NYYA 2IWCA 4F3LB 3T4KA 3EGDC 4X55A 1GA9A 3PBQA 2WKIA 1FQGA 4EQIA 3JVUA 3KSFA 4U3TA 2HDUA 1P0ZA 4F3LA 2QHKA 2XF3A 2A3UA 3MXSA 2XQZA 1DRMA 2V0WA 1XJ3A 1LI0A 3BYDA 1TS8A 4MDZA 4AFIA 2XD1A 1DY6A 3SS4A 4MN6A 3G2YA 4WZ5A 1XA7A 1FSYA 1K54A 3IX8A 4BD1A 1FR6A 3DTMA 4CLCD 3IHAA 4GCZA 2FZ0A 4DE2A 4QD4A 4FH2A 2QPNA 4JF6A 2ZQCA 4WEKA 4LV3A 4NXEA 3IXDA 5FAPA 2DMWA 4C75A 4OOMA 1K56D 4JKTA 5D3OA 5DJUA 4DDYA 2ZD8A 2QJ5A 4R6LA 1ODVA 1YMXA 3G2ZA 3KYZA 4GN2A 3VP4A 4BJPA 2EXAA 2FH5A 2V9AA 2W3GA 3GVBA 3S1YA 4PM7A 2EWWA 4JXSA 3VOYA 4Y2FA 3KSIA 5BOHA 1MY8A 1W5DA 4DE1A 2CC1A 3A3JA 3MSHA 1FR1A 1PI5A 1MWTA 3RH8B 1JNUA 1ES5A 3B42A 3G4PA 4OOYA 2XGNA 2H0TA 1GA0A 1I2SA 4Y3IA 4GB7A 3LIAA 1TD5A 1MPLA 5EVEA 4L9FA 3FYZA 1HVBA 2QYBA 4IVKA 3D72A 4R1GA 4I3JA 2CMNA 3UE0A 5FI2A 3WRTA 4E3MA 3LEQA 3UB6A 4ARZA 3LR5A 3GTCA 4NKPA 4MBKA 2C5WB 1CEFA 1N9OA 2OWHA 2JKTI 4JXGA 2OV5A 2H28A 1NY0A 3MFDA 4Y0UA 3V3RA 2PHYA 1Z09A 5AVEA 5DJTA 4KUOA 3BM6A 5CECA 2V0UA 4M4XA 2P74A 4YINA 3ZYTA 3H9WA 4PKYA 4O0PA 3CI6A 3OOVA 1H8YA 4OKPA 4WM9A 3HLBA 3LICA 3GRJA 5EE8A 1RGYA 4R3BA 3CMZA 3B47A 5TGFA 4Q8IA 5HL1A 1NWZA 1AXBA 4RVAA 2EFXA 1G5UA 2JKFA 4UA7A 2H0YA 1E3UA 3IS2A 2Y2PA 4II7A 1P9RA 5HDSA 3N8RA 4GD6A 5CHUA 2EXBA 3NOPC 1E4DA 1OTBA 2X01A 2XEPA 4EESA 3OPHA 3S22A 3N4IA 3TE8A 3M2KA 1OTAA 2EX8A 3DBAA 4MLLA 3BRMA 3PBNA 4PKYG 3FKWA 5KIZA 5HARA 1WYCA 5A93A 3QP5A 3IWOA 1W8YA 5KSHA 3C8CA 3Q82A 4OP8A 2Z2MB 3NOUC 3F1OB 5FQ9A 3H82B 2VLGA 3CHWP 1H8MA 3ICYA 2EX6A 3T4SA 3UDIA 4Q0IA 1K57A 3LYXA 2V8FA 3H82A 1T1CA 1CI8A 2GDNA 5GLBA 4BLMA 3FG8A 3V5MA 5IT5A 4X53A 3W8KA 4Q0JA 1JTDA 2GJ3A 1D1JA 2VV7A 3IX3A 2I9VA 3UMEA 3MKFA 5E2FA 4UA9A 3C4PA 3OCNA 3LUQA 5GLAA 4OQGA 3LR4A 1IKIA 4M3KA 3FV7A 1E3UD 4I5SA 3MZEA 1ZG6A 3C7UA 1ERQA 2L0WA 2V1AA 3OPPA 2PYRA 3F1NA 2VGJA 1K55A 3BFCA 4HBTA 5U47A 2Z6CA 3SZTA 1K38A 1FIKA 1EW0A 4HH3A 1K6RA 3HJIA 1PNEA 2HGVA 4MNRA 4GOGA 1PI4A 5IU1A 4QHCA 4P0MA 2NUTC 1S67L 2ZOIA 5F1FA 3G35A 4B9OA 1OT9A 2JKTM 4KG5A 4QY5A 3T1XA 3MZDA 1WYBA 4DE3A 3H7WB 3FPVA 5HPFA 2Y2HA 4B93A 1NRFA 3VOZA 2J3WA 1C3BA 5K5BA 5L09A 4E3JA 3VOLA 2W3HA 1N9NA 3G31A 2JHEA 1H3QA 4S2PA 5HX9A 4DRTA 4BL2A 2VJWA 5L07A 1FOFA 5FDHA 3UY6A 2UWXA 4WBGA 3P01A 4OOLA 4E3NA 4PAUA 4P87A 4Y13A 5KZHA 5EOOA 3OZHA 2IA2A 4R3JA 3GR2A 2VX8A 3GECA 3S7OA 4U0XA 5EVIB 4X25A 4KZ3A 3UDFA 2C6WB 2XDMA 3HREA 3IF5A 3UE6A 4HJ3A 1PZPA 5EVIA 3GV9A 3WS5A 4H8RA 3V67A 4PM5A 3BQAA 2HPBA 3GMWA 5EECA 4OQIA 3UPPA 1XPBA 2Q9NA 3Q81A 2ZC7A 3BWLA 4WYYA 5MC7A 4A5RA 4MBHA 3T4QA 4UQIM 3DAVA 4DKIA 2QZ6A 3C4OA 4R3AA 5DF9A 2HP5A 2Y2GA 4GHIB 4ZJ3A 1FSWA 5FATA 4N1XA 3MF0A 1MKIA 2V20A 1BLPA 1XFQA 3MXRA 5EV0A 4XXRA 4GHIA 4KZ4A 2XROA 3M2JA 4D2OA 3MR0A 4QU3A 3DTIA 2HDQA 3UPOA 4HH2A 4EQ1A 3FC7A 4G3WA 4OPYA 1F2KA 2D01A 3GSGA 5CHMA 2ZOHA 3E2LA 3S7PA 5M19A 3K2NA 5HWVA 1YQSA 2Y2LA 3IBRA 3F1PB 1TEMA 3SOIA 3PHYA 2YKFA 2RL3A 2LB5A 3TSGA 4ZJ1A 1GSVA 1LLBA 3F1PA 1Z6FA 2ZQAA 3PBOA 4Z9QA 1CI9A 4DN0A 2OLVA 4ID4A 1PWCA 5EVID 1KGGA 3O88A 2Y4AA 2VEAA 2V8CA 3RTYA 3VE3A 3O87A 1P97A 2VGLM 3CG5A 1MC0A 3L7HA 3LI8A 4F94A 3RJUA 5FEGA 1K6SA 2A49A 3RXWA 4YOFA 5EPHA 3JPUA 2ZLYA 1YSQA 2P08A 3N6IA 2BTFP 1PRQA 4O8GA 5HFOA 2XRNA 4N1HA 1VM1A 3ZG5A 4NXFA 1T1BA 4BENA 1YM1A 2VGKA 4KQOA 5EFWA 3E0YA 4OQ0A 5AJGA 2E8IA 3CUEC 1FILA 3LIEA 1M40A 1DP8A 3QP2A 5DTKA 1PIOA 3DW0A 4OP5A 3VFHA 3T50A 3LI9A 4OVDA 4GNUA 2B5RA 4FUWA 5CHJA 4KZ8A 5J3WA 5DF7A 3MQ0A 3TJZC 4QB8A 3IQAA 1PWGA 3W4PA 1L2SA 3B33A 1OTIA 3HJKA 3T4OA 1ERMA 2P7JA 2Y2KA 3BLMA 2BLSA 1LL8A 3C7VA 4S2NC 3R7WB 4DJ3A 5LBRA 1XJ6A 1BLCA 5DTTA 3E2KA 5CRFA 3VMAA 2ZQ7A 4ZJ2A 3R7WA 1XKZA 5HL6A 2QWSA 4LPZA 1FCNA 4E3LA 4L0LA 3E4OA 2KX6A 1JWZA 1YLPA 3PXPA 1IYPA 3C30A 5AQ7A 3LR3A 2Y79A 2PDRA 4KG2A 2P04A 1RCJA 3BFEA 1YKDA 3DTKA 2W1TA 1BUEA 4R4SA 4WZ4A 1NJ4A 4BD0A 2EX2A 3NULA 3PBRA 3IHBA 1L0FA 4ARZB 1LSVA 2PRFA 3WS4A 4HNBA 2ZM0A 3NECA 4C6YA 1O7EA 3V39A 3TOIA 4R70A 3VSKA 1OJ5A 5HWWA 3UDXA 4EU0A 4B4ZA 5CEBA 4EV4A 2ZQ8A 1OJGA 2Q0OA 3EQUA 3HUOA 4BWIA 1HD8A 4EEUA 5HSQA 3PAEA 2W1RA 4OPQA 1KDWA 3ZGAB 4H6JB 1ES2A 5CTMA 4FH4A 2J3TD 1LL9A 3A3IA 4X6TA 5F68A 1BULA 1ZHHB 4QWOA 1IYSA 4H6JA 2Z6DA 4C3QA 2DCFA 5FQKA 4WEJA 1IYQA 3IS2B 1OMEA 4GZBA 3V50A 2R78A 3MMHA 4DE0A 1MKMA 1DP9A 1BT5A 5FEFA 4HBUA 4L9GA 2Z2LB 3P98A 3QP1A 1VETB 3SH7A 5F6AA 3ZG0A 3T1SA 4MCWA 4NG2A 2NUPC 2ZBBA 2Y91A 3PYPA 3C5AA 4IEDA 4ZAMA 3BECA 3RFBA 3VP3A 1XGJA 3BY9A 4RYEA 1VETA 4MBFA 4MEZA 1PZOA 4LFUA 3OCLA 1STZA 2PBYA 1O07A 2JE5A 3MQQA 1ZG4A 5KMWA 1M6KA 3LY3A 5FAOA 4EBPA 1H5XA 2JN7A 1EROA 2KLIA 4RX2A 4LV1A 1TF1A 4JGPA 2HF6A 4PM6A 4OQHA 3ZHHA 4HI4A 3E4PA 4BQMA 4S2JA 3HLDA 3E4QA 2XFSA 1Y4OA 3KYEA 5GHXA 1YAXA 1RGZA 3QP4A 3ZQ5A 4ETZA 5L10A
chains in the Genus database with same CATH topology
4X1LA 1SKOA 1K0KA 2V8CA 1HLUP 3MSHA 3CPTB 1CJFA 4QWOA 3L7HA 5FEGA 4ESPA 3T1RA 2E8JA 1AWIA 1FIKA 5FEFA 3CPTA 3DAVA 5EVEA 1PNEA 3T12B 1PFLA 1SZVA 1VETB 2ACGA 2PBDP 2BTFP 1J3WA 1PRQA 3T1SA 2B95A 3T1XA 4D60A 5FDSA 1VEUB 1VETA 3LEQA 5EV0A 1FILA 3NULA 2HZ5A 1VEUA 3D9YA 3U4LP 1Z09A 2PRFA 3CHWP 2PAVP 1F2KA 2ZL1B 1CF0A 4FTXA 3NECA 3MS6A 2V8FA 2VK3A 1A0KA 4FUWA 2JKGA 2ZL1A 1ACFA 1YPRA 3L9KA 5EM1A 1Y4OA 1D1JA 3LGOA 3KYEA 3UB5P 1SKOB 4X25A 1CQAA 5EM0A 4X1MA 3T1QB 1G5UA 2JKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X1L A;  1SKO A;  1K0K A;  2V8C A;  1HLU P;  3MSH A;  3CPT B;  1CJF A;  4QWO A;  3L7H A;  5FEG A;  4ESP A;  3T1R A;  2E8J A;  1AWI A;  1FIK A;  5FEF A;  3CPT A;  3DAV A;  5EVE A;  1PNE A;  3T12 B;  1PFL A;  1SZV A;  1VET B;  2ACG A;  2PBD P;  2BTF P;  1J3W A;  1PRQ A;  3T1S A;  2B95 A;  3T1X A;  4D60 A;  5FDS A;  1VEU B;  1VET A;  3LEQ A;  5EV0 A;  1FIL A;  3NUL A;  2HZ5 A;  1VEU A;  3D9Y A;  3U4L P;  1Z09 A;  2PRF A;  3CHW P;  2PAV P;  1F2K A;  2ZL1 B;  1CF0 A;  4FTX A;  3NEC A;  3MS6 A;  2V8F A;  2VK3 A;  1A0K A;  4FUW A;  2JKG A;  2ZL1 A;  1ACF A;  1YPR A;  3L9K A;  5EM1 A;  1Y4O A;  1D1J A;  3LGO A;  3KYE A;  3UB5 P;  1SKO B;  4X25 A;  1CQA A;  5EM0 A;  4X1M A;  3T1Q B;  1G5U A;  2JKF A; 
#chains in the Genus database with same CATH topology
 5EVI C;  3VSL A;  4FOF A;  5J8X A;  2RCX A;  4EW7 A;  4E6W A;  3HLC A;  5CGX A;  5HAQ A;  3NC8 A;  5CED A;  1LI9 A;  5M1A A;  5CTN A;  3T4L A;  4X69 A;  1XXM A;  2P9V B;  2OOL A;  3UB8 A;  4OPR A;  4LCM A;  3UE1 A;  2WZX A;  1PWD A;  4LEN A;  4P6Z M;  3SS3 A;  5A90 A;  3F1N B;  4IUK A;  3ITB A;  2VV8 A;  3T12 B;  2P9V A;  5FAQ A;  2XA7 S;  1SDE A;  1L0G A;  4E3O A;  2PU2 A;  3BLS A;  5HWT A;  3EQV A;  1EWZ A;  3KSG A;  3NDG A;  4R0Q A;  1IYO A;  1YMS A;  5EVL A;  1YSP A;  1TDG A;  5CGW A;  4HP4 A;  1MWU A;  5A92 A;  3NDE A;  1TS0 A;  2ZM8 A;  3IBJ A;  3Q7V B;  4JF5 A;  2JC7 A;  5G4Z A;  3TG9 A;  2VGL S;  4HQA A;  2PAV P;  4ZDX A;  1BLH A;  4KZ5 A;  4EUV A;  3Q7V A;  2M7V A;  4OLG A;  3HCY A;  4GJ4 A;  3MS6 A;  3V3S A;  2EWV A;  2J8Y A;  3IF6 B;  1NLY A;  1ESU A;  3MJQ A;  5G4Y A;  4I38 A;  3QP6 A;  3S4X A;  1J9M A;  3LR0 A;  1ES3 A;  1SKO B;  2OWJ A;  3VP0 A;  3IF6 A;  2W3E A;  4Q0H A;  3IXB A;  1OPX A;  2OAP 1;  3T1Q B;  1DJA A;  4S2I A;  3IXH A;  4CLC C;  1SKO A;  3NJA A;  4HEF A;  3ZG8 B;  1S4R A;  1XJ2 A;  1T18 A;  3GDI A;  2VA0 A;  2WKR A;  3ZVT A;  1D06 A;  5C5K A;  1N9B A;  1K4E A;  1GCE A;  5CXW A;  4XUZ A;  4Y0T A;  5A8B A;  4JPM A;  1KE4 A;  4LV0 A;  3IX4 A;  4GDN A;  5TFQ A;  1YLW A;  1PFL A;  4O7D A;  3IH8 A;  4BBV A;  3P09 A;  1UWP X;  1KGF A;  4S2O A;  3P7N A;  2D02 A;  3HLW A;  5HW3 A;  4OLD A;  5J4E A;  1GSW A;  5FI7 A;  1BYW A;  1GHP A;  3BFF A;  2HP9 A;  2ZJ9 A;  4Y17 A;  2X02 A;  5E2G A;  1LT0 A;  1GHI A;  1ALQ A;  1DP6 A;  5GLD A;  5TR7 A;  1IEL A;  3UB9 A;  2JKR M;  4DJ2 A;  4RX3 A;  3W4O A;  4EBN A;  2Y59 A;  1A0K A;  2Y8H A;  1TS7 A;  5L2F A;  4BBT A;  1PYY A;  2KDK A;  5HAP A;  3D4F A;  2FFF B;  4JGO A;  1F5M A;  4B88 A;  3DWK A;  1NLZ A;  5EM1 A;  3AGD A;  1L0E A;  4QPR A;  2M1C A;  2WZZ A;  4RA7 A;  4WLA A;  4HIA A;  4JF4 A;  3A3D A;  4PMA A;  1FCO A;  4EBL A;  1ONH A;  3RXX A;  2J80 A;  3CJM A;  3N8S A;  4WZ5 C;  3ZNT A;  1K54 C;  5AQA A;  3CWF A;  3UPN A;  3KYQ A;  4GDB A;  2AVX A;  3EEA A;  4HES A;  1KVL A;  2IWD A;  2HDR A;  2W27 A;  1MBL A;  4UA6 A;  1L3L A;  5HD3 A;  3A3E A;  3BFG A;  3CPT B;  4X68 A;  4GW9 A;  1W8Q A;  4X56 A;  2Y2I A;  1JTG A;  3G32 A;  3CPT A;  2L1M A;  4WEL A;  5AQ9 A;  1I5Q A;  4P85 A;  1TS6 A;  3K3C A;  3OLO A;  4LV2 A;  4D60 A;  3UN7 A;  3A0S A;  4E6X A;  3N8L A;  2WUQ A;  1V9Y A;  1W7F A;  2EX9 A;  2JBF A;  4JLF A;  4WN5 A;  3BJN A;  4BMW A;  1T19 A;  1OT6 A;  4NET A;  3D9Y A;  5L8M A;  3IWI A;  4JGQ A;  2W3D A;  5HDC A;  5GL9 A;  1S1Z A;  3VP2 A;  4NXB A;  5I5L A;  1PW1 A;  5M18 A;  5TBM B;  2K31 A;  1BTL A;  5FQM A;  2G2W A;  4FTX A;  3AGF A;  2VK3 A;  1NRJ A;  4R23 A;  3ZVW A;  5TBM A;  2G2U A;  1YPR A;  1XP4 A;  3ZFZ A;  3L9K A;  4L9E A;  3BEB A;  2H5S A;  3UB7 A;  4ZTK A;  2INW A;  4NXG A;  1IKG A;  2QJ7 A;  4IBX A;  1SCW A;  3Q1F A;  2VZW A;  1CQA A;  3W4Q A;  1IFQ A;  4DDS A;  4IVI A;  2K2N A;  2ZC4 B;  1ESI A;  3HLG A;  1JWV A;  1GSX A;  4DF6 A;  1K0K A;  2Y2N A;  1P9W A;  1HLU P;  2WKP A;  4E04 A;  4EUZ A;  4KZ9 A;  4R4R A;  1CJF A;  1N4O A;  4ETX A;  1UGU A;  1MWR A;  2XH9 A;  4KZB A;  5I94 A;  2QKP A;  3PBS A;  3UE3 A;  2V2F F;  3M6B A;  1N9L A;  4MMN A;  1Q2Q A;  3BY8 A;  4EER A;  3KO6 A;  2ZQ9 A;  3HL9 A;  5E2E A;  3CLO A;  4JBF A;  2OAQ 1;  3EWK A;  5HDD A;  3HUN A;  4N9L A;  5FQI A;  5FDS A;  3OPR A;  2WK0 A;  1VEU B;  5FL3 A;  2A24 B;  3ZCZ A;  4R38 A;  5FA7 A;  3WRZ A;  1HTZ A;  1BLS A;  5IHV A;  3OBF A;  1DJC A;  1VEU A;  2A24 A;  2O9B A;  2W1T B;  4OH0 A;  3W2Z A;  1XX2 A;  3WS2 A;  2O9C A;  1UWN X;  3U2A A;  4K08 A;  5JYO A;  4IHQ A;  5F82 A;  4P6Z S;  4XUX A;  4E3I A;  4LRY C;  3S7Q A;  3JYI A;  3GQZ A;  3QNB A;  3LY4 A;  5DFX A;  1H0M A;  4KG6 A;  4CQH A;  4KQQ A;  4LRZ E;  1G28 A;  2B18 A;  5DKK A;  3T4J A;  4G3K A;  5EM0 A;  2G7U A;  2O9A A;  5JYP A;  3DWZ A;  1VB6 A;  5CX7 A;  5GLC A;  1K57 C;  5FQJ A;  4JXW A;  4Y7P A;  1LHY A;  4X1L A;  1XFN A;  1Q2P A;  4LLO B;  1S6R A;  2Y2M A;  2ZM2 A;  2WKE A;  2WGV A;  2H10 A;  5DFY A;  3G30 A;  2Y2O A;  3NCK A;  4LCL A;  4KZA A;  3WS1 A;  2EA9 A;  2XSS A;  3UO9 A;  3SW1 A;  1X0O A;  1DJB A;  2FFY A;  2HJ9 C;  4GKU A;  4KQD A;  1EI5 A;  5F83 A;  2E8J A;  3CUE A;  1VQQ A;  3A0V A;  3HLF A;  5CER A;  5DKL A;  1U60 A;  4P6B A;  4EWF A;  2WGW B;  2J9O A;  3BFD A;  2HP6 A;  2ZC6 B;  4K91 A;  2HDS A;  3HLE A;  3WWX A;  4KEN B;  1ES4 A;  4LGW A;  1V9Z A;  1T1A A;  2WGW A;  1K55 C;  3FPW A;  4NEE D;  1FCM A;  1OTE A;  1CK3 A;  5HAI A;  1Y54 A;  1PW8 A;  1YLT A;  4BBU A;  4XT2 B;  3VE4 A;  2R9W A;  2PD8 A;  4BL3 A;  3MXQ A;  1NXY A;  4DXB A;  2KOI A;  4XT2 A;  4EXO A;  1JVJ A;  3DTE A;  4S2N A;  5DF8 A;  3PAG A;  4HOI A;  4S2M A;  2JKG A;  3SH9 A;  4K0W A;  1ACF A;  1G6A A;  5J7E A;  3MQO A;  2L4R A;  2XFT A;  2PT7 A;  3LCE A;  1F98 A;  2BAS A;  5HZH A;  2B02 A;  1CEG A;  4UAA A;  3IF6 C;  4B4X A;  1TDL A;  3ZG7 B;  5DVA A;  1GHM A;  4YNR A;  4OON A;  2Q9M A;  3EGX C;  4UQI S;  5FQQ A;  3NOT C;  2JKR I;  3K3D A;  4QY6 A;  1KOU A;  2VKS A;  4U0T A;  4KUK A;  5KSC A;  1VHM A;  4JGR A;  4DMZ A;  3FWL A;  4IJG A;  3NY4 A;  2WKQ A;  1WE4 A;  3NI9 A;  4NK3 A;  1SZV A;  1YLY A;  3JVV A;  1J3W A;  1KGE A;  2WAF A;  1F9I A;  2WYX A;  1SHV A;  3BQ8 A;  2O0Y A;  1I2W A;  3TW8 A;  4YFM A;  3R4K A;  2J7V A;  4HJ6 A;  3F1O A;  3KSH A;  3ITA A;  4WF0 A;  4PM8 A;  1YT4 A;  4KZ7 A;  2HZ5 A;  5EOE A;  5HPI A;  4ME4 A;  3LIF A;  2YKH A;  3LID A;  2MJ6 A;  2ZL1 B;  5CGS A;  3OPL A;  5E43 A;  2K7S A;  3NHQ A;  2ZC3 B;  4IBR A;  2LB9 A;  4PM9 A;  5HD5 A;  2JCH A;  3IT9 A;  3VFF A;  1RP5 A;  2ZL1 A;  4UEY A;  5G18 A;  5FI6 A;  3CZD A;  3S7N A;  3UNW A;  2WGI A;  3QHY A;  1L0D A;  4X1M A;  2DRW A;  2I72 A;  2Y2J A;  2A2L A;  2O99 A;  2OLU A;  1SKF A;  3B3X A;  4HHD A;  4IUH A;  2IWB A;  2GZA A;  4Y15 A;  2PU4 A;  2OSU A;  1ONG A;  4WMC A;  3CAX A;  2ZMA A;  3BW6 A;  3MFX A;  4ESP A;  4G3V A;  1AWI A;  4K0X A;  4PPR A;  4FD8 A;  3HVF A;  4O01 A;  1YLZ A;  2M7U A;  2ACG A;  2PBD P;  3H7W A;  4GS9 B;  2PR5 A;  2UV0 E;  3O5Y A;  3T4T A;  1YLJ A;  1G68 A;  1S0W A;  4CLC E;  5DTS A;  4CJN A;  4CPK A;  1LL5 A;  1H8Z A;  2GX5 A;  3NBL A;  4GS9 A;  1TVF A;  2J9P A;  3Q07 A;  3E98 A;  3SH8 A;  5F5Y A;  1BZA A;  2R9X A;  3D3O A;  5A91 A;  3U4L P;  1HZO A;  3VV4 A;  1S4S A;  2XR0 A;  5GHY A;  3I7J A;  4YWZ A;  4WUJ A;  2QMI A;  2ZQD A;  3ULF A;  1JWP A;  2X71 A;  3LEZ A;  4MN7 A;  1W79 A;  3G34 A;  4Z1W A;  4EEP A;  4S2L A;  3IH9 A;  3ZDJ A;  2WAD A;  2XK1 A;  3ISG A;  3LIB A;  3PBT A;  1NYM A;  3G6O A;  4GD8 A;  1D7E A;  3QNC A;  4ZBE A;  5FAS A;  2PD7 A;  3N7W A;  3CIT A;  4MN5 A;  3KX0 X;  4FSF A;  4S2K A;  1KDS A;  4KQR A;  4I39 A;  4GLQ A;  3O86 A;  2ZMV A;  1G6O A;  1K25 A;  4Y0O A;  4WMC D;  3ZG9 B;  3IWQ A;  4N92 A;  4HY8 A;  3WS0 A;  3EEH A;  3AGE A;  3PTE A;  3NIA A;  3T1R A;  4KZ6 A;  1IOU A;  4JXV A;  1SDN A;  3MKE A;  2V1Z A;  1KE0 A;  4Y5F A;  1NZO A;  2W3F A;  2J3T C;  4UHU A;  2XD5 A;  2ZC5 B;  1XA1 A;  3A0R A;  3LFV A;  3UMD A;  1S1Y A;  4HJ4 A;  2PR6 A;  2GNX A;  3QP8 A;  4DXC A;  5AVF A;  1IEM A;  5AQB A;  2HJE A;  3TRC A;  1LSX A;  4RQ9 A;  2XA7 M;  1NZU A;  1WA9 A;  3O3V A;  2Y2Q A;  4CLC B;  4WL9 A;  2W0N A;  1CF0 A;  3VP1 A;  1ZC2 A;  1BSG A;  1K4F A;  4LRX C;  4CLC A;  4N9K A;  3C38 A;  4PHT A;  1QMF A;  1KVM A;  3OC2 A;  3MZF A;  2PYP A;  3EOI A;  3MBZ A;  2DNS A;  5F1G A;  1K56 A;  3LGO A;  4E3K A;  3A3F A;  3UB5 P;  3M6H A;  2WKH A;  4EET B;  3FZC A;  2EFU A;  3IXG A;  1W63 M;  3HUM A;  5GHZ A;  3PR6 A;  4I3A A;  5TJJ A;  1MXO A;  1OTD A;  1QME A;  1XJ4 A;  2VV6 A;  4QJG A;  1ZKJ A;  1W63 Q;  5F69 A;  1XGI A;  5FSR A;  2XLN A;  3HBR A;  3LO7 A;  3FKV A;  1MZU A;  2BG1 A;  1MWS A;  5IS1 A;  2ZMF A;  1ZTU A;  4FCF A;  5EUA A;  1E25 A;  2HV1 A;  1LSW A;  1Y28 A;  3ZNY A;  1KE3 A;  5E2H A;  4ZRR A;  3Q7Z A;  3C2W A;  2B95 A;  4OPZ A;  4I3I A;  2Y55 A;  1S66 L;  4HP9 A;  2V1B A;  3SS5 A;  2WAE A;  1NYY A;  2IWC A;  4F3L B;  3T4K A;  3EGD C;  4X55 A;  1GA9 A;  3PBQ A;  2WKI A;  1FQG A;  4EQI A;  3JVU A;  3KSF A;  4U3T A;  2HDU A;  1P0Z A;  4F3L A;  2QHK A;  2XF3 A;  2A3U A;  3MXS A;  2XQZ A;  1DRM A;  2V0W A;  1XJ3 A;  1LI0 A;  3BYD A;  1TS8 A;  4MDZ A;  4AFI A;  2XD1 A;  1DY6 A;  3SS4 A;  4MN6 A;  3G2Y A;  4WZ5 A;  1XA7 A;  1FSY A;  1K54 A;  3IX8 A;  4BD1 A;  1FR6 A;  3DTM A;  4CLC D;  3IHA A;  4GCZ A;  2FZ0 A;  4DE2 A;  4QD4 A;  4FH2 A;  2QPN A;  4JF6 A;  2ZQC A;  4WEK A;  4LV3 A;  4NXE A;  3IXD A;  5FAP A;  2DMW A;  4C75 A;  4OOM A;  1K56 D;  4JKT A;  5D3O A;  5DJU A;  4DDY A;  2ZD8 A;  2QJ5 A;  4R6L A;  1ODV A;  1YMX A;  3G2Z A;  3KYZ A;  4GN2 A;  3VP4 A;  4BJP A;  2EXA A;  2FH5 A;  2V9A A;  2W3G A;  3GVB A;  3S1Y A;  4PM7 A;  2EWW A;  4JXS A;  3VOY A;  4Y2F A;  3KSI A;  5BOH A;  1MY8 A;  1W5D A;  4DE1 A;  2CC1 A;  3A3J A;  3MSH A;  1FR1 A;  1PI5 A;  1MWT A;  3RH8 B;  1JNU A;  1ES5 A;  3B42 A;  3G4P A;  4OOY A;  2XGN A;  2H0T A;  1GA0 A;  1I2S A;  4Y3I A;  4GB7 A;  3LIA A;  1TD5 A;  1MPL A;  5EVE A;  4L9F A;  3FYZ A;  1HVB A;  2QYB A;  4IVK A;  3D72 A;  4R1G A;  4I3J A;  2CMN A;  3UE0 A;  5FI2 A;  3WRT A;  4E3M A;  3LEQ A;  3UB6 A;  4ARZ A;  3LR5 A;  3GTC A;  4NKP A;  4MBK A;  2C5W B;  1CEF A;  1N9O A;  2OWH A;  2JKT I;  4JXG A;  2OV5 A;  2H28 A;  1NY0 A;  3MFD A;  4Y0U A;  3V3R A;  2PHY A;  1Z09 A;  5AVE A;  5DJT A;  4KUO A;  3BM6 A;  5CEC A;  2V0U A;  4M4X A;  2P74 A;  4YIN A;  3ZYT A;  3H9W A;  4PKY A;  4O0P A;  3CI6 A;  3OOV A;  1H8Y A;  4OKP A;  4WM9 A;  3HLB A;  3LIC A;  3GRJ A;  5EE8 A;  1RGY A;  4R3B A;  3CMZ A;  3B47 A;  5TGF A;  4Q8I A;  5HL1 A;  1NWZ A;  1AXB A;  4RVA A;  2EFX A;  1G5U A;  2JKF A;  4UA7 A;  2H0Y A;  1E3U A;  3IS2 A;  2Y2P A;  4II7 A;  1P9R A;  5HDS A;  3N8R A;  4GD6 A;  5CHU A;  2EXB A;  3NOP C;  1E4D A;  1OTB A;  2X01 A;  2XEP A;  4EES A;  3OPH A;  3S22 A;  3N4I A;  3TE8 A;  3M2K A;  1OTA A;  2EX8 A;  3DBA A;  4MLL A;  3BRM A;  3PBN A;  4PKY G;  3FKW A;  5KIZ A;  5HAR A;  1WYC A;  5A93 A;  3QP5 A;  3IWO A;  1W8Y A;  5KSH A;  3C8C A;  3Q82 A;  4OP8 A;  2Z2M B;  3NOU C;  3F1O B;  5FQ9 A;  3H82 B;  2VLG A;  3CHW P;  1H8M A;  3ICY A;  2EX6 A;  3T4S A;  3UDI A;  4Q0I A;  1K57 A;  3LYX A;  2V8F A;  3H82 A;  1T1C A;  1CI8 A;  2GDN A;  5GLB A;  4BLM A;  3FG8 A;  3V5M A;  5IT5 A;  4X53 A;  3W8K A;  4Q0J A;  1JTD A;  2GJ3 A;  1D1J A;  2VV7 A;  3IX3 A;  2I9V A;  3UME A;  3MKF A;  5E2F A;  4UA9 A;  3C4P A;  3OCN A;  3LUQ A;  5GLA A;  4OQG A;  3LR4 A;  1IKI A;  4M3K A;  3FV7 A;  1E3U D;  4I5S A;  3MZE A;  1ZG6 A;  3C7U A;  1ERQ A;  2L0W A;  2V1A A;  3OPP A;  2PYR A;  3F1N A;  2VGJ A;  1K55 A;  3BFC A;  4HBT A;  5U47 A;  2Z6C A;  3SZT A;  1K38 A;  1FIK A;  1EW0 A;  4HH3 A;  1K6R A;  3HJI A;  1PNE A;  2HGV A;  4MNR A;  4GOG A;  1PI4 A;  5IU1 A;  4QHC A;  4P0M A;  2NUT C;  1S67 L;  2ZOI A;  5F1F A;  3G35 A;  4B9O A;  1OT9 A;  2JKT M;  4KG5 A;  4QY5 A;  3T1X A;  3MZD A;  1WYB A;  4DE3 A;  3H7W B;  3FPV A;  5HPF A;  2Y2H A;  4B93 A;  1NRF A;  3VOZ A;  2J3W A;  1C3B A;  5K5B A;  5L09 A;  4E3J A;  3VOL A;  2W3H A;  1N9N A;  3G31 A;  2JHE A;  1H3Q A;  4S2P A;  5HX9 A;  4DRT A;  4BL2 A;  2VJW A;  5L07 A;  1FOF A;  5FDH A;  3UY6 A;  2UWX A;  4WBG A;  3P01 A;  4OOL A;  4E3N A;  4PAU A;  4P87 A;  4Y13 A;  5KZH A;  5EOO A;  3OZH A;  2IA2 A;  4R3J A;  3GR2 A;  2VX8 A;  3GEC A;  3S7O A;  4U0X A;  5EVI B;  4X25 A;  4KZ3 A;  3UDF A;  2C6W B;  2XDM A;  3HRE A;  3IF5 A;  3UE6 A;  4HJ3 A;  1PZP A;  5EVI A;  3GV9 A;  3WS5 A;  4H8R A;  3V67 A;  4PM5 A;  3BQA A;  2HPB A;  3GMW A;  5EEC A;  4OQI A;  3UPP A;  1XPB A;  2Q9N A;  3Q81 A;  2ZC7 A;  3BWL A;  4WYY A;  5MC7 A;  4A5R A;  4MBH A;  3T4Q A;  4UQI M;  3DAV A;  4DKI A;  2QZ6 A;  3C4O A;  4R3A A;  5DF9 A;  2HP5 A;  2Y2G A;  4GHI B;  4ZJ3 A;  1FSW A;  5FAT A;  4N1X A;  3MF0 A;  1MKI A;  2V20 A;  1BLP A;  1XFQ A;  3MXR A;  5EV0 A;  4XXR A;  4GHI A;  4KZ4 A;  2XRO A;  3M2J A;  4D2O A;  3MR0 A;  4QU3 A;  3DTI A;  2HDQ A;  3UPO A;  4HH2 A;  4EQ1 A;  3FC7 A;  4G3W A;  4OPY A;  1F2K A;  2D01 A;  3GSG A;  5CHM A;  2ZOH A;  3E2L A;  3S7P A;  5M19 A;  3K2N A;  5HWV A;  1YQS A;  2Y2L A;  3IBR A;  3F1P B;  1TEM A;  3SOI A;  3PHY A;  2YKF A;  2RL3 A;  2LB5 A;  3TSG A;  4ZJ1 A;  1GSV A;  1LLB A;  3F1P A;  1Z6F A;  2ZQA A;  3PBO A;  4Z9Q A;  1CI9 A;  4DN0 A;  2OLV A;  4ID4 A;  1PWC A;  5EVI D;  1KGG A;  3O88 A;  2Y4A A;  2VEA A;  2V8C A;  3RTY A;  3VE3 A;  3O87 A;  1P97 A;  2VGL M;  3CG5 A;  1MC0 A;  3L7H A;  3LI8 A;  4F94 A;  3RJU A;  5FEG A;  1K6S A;  2A49 A;  3RXW A;  4YOF A;  5EPH A;  3JPU A;  2ZLY A;  1YSQ A;  2P08 A;  3N6I A;  2BTF P;  1PRQ A;  4O8G A;  5HFO A;  2XRN A;  4N1H A;  1VM1 A;  3ZG5 A;  4NXF A;  1T1B A;  4BEN A;  1YM1 A;  2VGK A;  4KQO A;  5EFW A;  3E0Y A;  4OQ0 A;  5AJG A;  2E8I A;  3CUE C;  1FIL A;  3LIE A;  1M40 A;  1DP8 A;  3QP2 A;  5DTK A;  1PIO A;  3DW0 A;  4OP5 A;  3VFH A;  3T50 A;  3LI9 A;  4OVD A;  4GNU A;  2B5R A;  4FUW A;  5CHJ A;  4KZ8 A;  5J3W A;  5DF7 A;  3MQ0 A;  3TJZ C;  4QB8 A;  3IQA A;  1PWG A;  3W4P A;  1L2S A;  3B33 A;  1OTI A;  3HJK A;  3T4O A;  1ERM A;  2P7J A;  2Y2K A;  3BLM A;  2BLS A;  1LL8 A;  3C7V A;  4S2N C;  3R7W B;  4DJ3 A;  5LBR A;  1XJ6 A;  1BLC A;  5DTT A;  3E2K A;  5CRF A;  3VMA A;  2ZQ7 A;  4ZJ2 A;  3R7W A;  1XKZ A;  5HL6 A;  2QWS A;  4LPZ A;  1FCN A;  4E3L A;  4L0L A;  3E4O A;  2KX6 A;  1JWZ A;  1YLP A;  3PXP A;  1IYP A;  3C30 A;  5AQ7 A;  3LR3 A;  2Y79 A;  2PDR A;  4KG2 A;  2P04 A;  1RCJ A;  3BFE A;  1YKD A;  3DTK A;  2W1T A;  1BUE A;  4R4S A;  4WZ4 A;  1NJ4 A;  4BD0 A;  2EX2 A;  3NUL A;  3PBR A;  3IHB A;  1L0F A;  4ARZ B;  1LSV A;  2PRF A;  3WS4 A;  4HNB A;  2ZM0 A;  3NEC A;  4C6Y A;  1O7E A;  3V39 A;  3TOI A;  4R70 A;  3VSK A;  1OJ5 A;  5HWW A;  3UDX A;  4EU0 A;  4B4Z A;  5CEB A;  4EV4 A;  2ZQ8 A;  1OJG A;  2Q0O A;  3EQU A;  3HUO A;  4BWI A;  1HD8 A;  4EEU A;  5HSQ A;  3PAE A;  2W1R A;  4OPQ A;  1KDW A;  3ZGA B;  4H6J B;  1ES2 A;  5CTM A;  4FH4 A;  2J3T D;  1LL9 A;  3A3I A;  4X6T A;  5F68 A;  1BUL A;  1ZHH B;  4QWO A;  1IYS A;  4H6J A;  2Z6D A;  4C3Q A;  2DCF A;  5FQK A;  4WEJ A;  1IYQ A;  3IS2 B;  1OME A;  4GZB A;  3V50 A;  2R78 A;  3MMH A;  4DE0 A;  1MKM A;  1DP9 A;  1BT5 A;  5FEF A;  4HBU A;  4L9G A;  2Z2L B;  3P98 A;  3QP1 A;  1VET B;  3SH7 A;  5F6A A;  3ZG0 A;  3T1S A;  4MCW A;  4NG2 A;  2NUP C;  2ZBB A;  2Y91 A;  3PYP A;  3C5A A;  4IED A;  4ZAM A;  3BEC A;  3RFB A;  3VP3 A;  1XGJ A;  3BY9 A;  4RYE A;  1VET A;  4MBF A;  4MEZ A;  1PZO A;  4LFU A;  3OCL A;  1STZ A;  2PBY A;  1O07 A;  2JE5 A;  3MQQ A;  1ZG4 A;  5KMW A;  1M6K A;  3LY3 A;  5FAO A;  4EBP A;  1H5X A;  2JN7 A;  1ERO A;  2KLI A;  4RX2 A;  4LV1 A;  1TF1 A;  4JGP A;  2HF6 A;  4PM6 A;  4OQH A;  3ZHH A;  4HI4 A;  3E4P A;  4BQM A;  4S2J A;  3HLD A;  3E4Q A;  2XFS A;  1Y4O A;  3KYE A;  5GHX A;  1YAX A;  1RGZ A;  3QP4 A;  3ZQ5 A;  4ETZ A;  5L10 A; 
#chains in the Genus database with same CATH homology
 4X1L A;  1SKO A;  1K0K A;  2V8C A;  1HLU P;  3MSH A;  3CPT B;  1CJF A;  4QWO A;  3L7H A;  5FEG A;  4ESP A;  3T1R A;  2E8J A;  1AWI A;  1FIK A;  5FEF A;  3CPT A;  3DAV A;  5EVE A;  1PNE A;  3T12 B;  1PFL A;  1SZV A;  1VET B;  2ACG A;  2PBD P;  2BTF P;  1J3W A;  1PRQ A;  3T1S A;  2B95 A;  3T1X A;  4D60 A;  5FDS A;  1VEU B;  1VET A;  3LEQ A;  5EV0 A;  1FIL A;  3NUL A;  2HZ5 A;  1VEU A;  3D9Y A;  3U4L P;  1Z09 A;  2PRF A;  3CHW P;  2PAV P;  1F2K A;  2ZL1 B;  1CF0 A;  4FTX A;  3NEC A;  3MS6 A;  2V8F A;  2VK3 A;  1A0K A;  4FUW A;  2JKG A;  2ZL1 A;  1ACF A;  1YPR A;  3L9K A;  5EM1 A;  1Y4O A;  1D1J A;  3LGO A;  3KYE A;  3UB5 P;  1SKO B;  4X25 A;  1CQA A;  5EM0 A;  4X1M A;  3T1Q B;  1G5U A;  2JKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...