3MSHA

Crystal structure of hepatitis b x-interacting protein at high resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of HBXIP: The Protein That Interacts with the Anti-Apoptotic Protein Survivin and the Oncogenic Viral Protein HBx.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Hepatitis B virus X-interacting protein
total genus 20
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16672 LAMTOR5 Ragulator complex protein LAMTOR5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3mshA00
2VK3A 4X25A 1PFLA 1Y4OA 2V8FA 1VEUA 2ZL1A 4FUWA 1PRQA 3LEQA 5EM1A 3DAVA 3CPTB 3T1SA 2V8CA 1CJFA 1VETB 3NULA 3MSHA 3T1RA 1A0KA 1SKOA 2PRFA 4FTXA 3T1XA 5EM0A 1Z09A 3T12B 1SZVA 3MS6A 1FIKA 1J3WA 1FILA 1CQAA 1G5UA 1VEUB 2B95A 2HZ5A 2ZL1B 3D9YA 3LGOA 5EVEA 4X1MA 1ACFA 1D1JA 2ACGA 3T1QB 2JKFA 2BTFP 4X1LA 1AWIA 1K0KA 3U4LP 1CF0A 4D60A 4QWOA 1PNEA 1SKOB 5FDSA 3L9KA 3CPTA 4ESPA 1VETA 2PBDP 2E8JA 1HLUP 2JKGA 1F2KA 2PAVP 3CHWP 3KYEA 3L7HA 5EV0A 5FEFA 3NECA 1YPRA 3UB5P 5FEGA
chains in the Genus database with same CATH superfamily
2CMNA 3IXHA 3N8LA 1LI9A 1XPBA 2W3EA 2P9VA 4FSFA 3A3IA 5CECA 1Y54A 4HOIA 3OBFA 4IUHA 3ZG8B 4ESPA 1S4RA 1M6KA 3ZNTA 2ZLYA 3H82B 4C6YA 1CI8A 5EVIA 1S66L 4FTXA 2YKHA 1W5DA 1G68A 2K7SA 2K2NA 3EGDC 4Y17A 1IYSA 3AGFA 2R9WA 3A3DA 1YLWA 5HW3A 1QMFA 4PKYG 3ITBA 4PM7A 4R1GA 2INWA 4E3MA 2BASA 4QD4A 1O07A 3ZG9B 1OMEA 5AQ9A 3OPHA 3WS2A 1MWTA 1SKFA 1XP4A 3UB8A 3VSKA 4YWZA 5KSHA 1G6OA 3T1QB 5CTNA 3ZDJA 3P7NA 4WEJA 1ES3A 4X56A 2WKQA 3BM6A 3B47A 5EVIB 1ESUA 3S4XA 1OTAA 3BFEA 3LEQA 1T1CA 5CGXA 4KUKA 4G3VA 2EWWA 4L0LA 2Y4AA 4MBKA 4RX3A 5GHYA 4H8RA 2KDKA 4JPMA 4B4XA 1PNEA 4HY8A 1PI5A 3T4JA 4NXFA 3AGEA 5AQBA 3V50A 3A3EA 4ZDXA 3SH7A 5KZHA 4I3JA 2PD8A 1DJCA 1K4EA 2JC7A 2MJ6A 1U60A 2DNSA 3M2KA 2XK1A 4OQHA 2D02A 1OTBA 5F5YA 2IWCA 5DFXA 1ZG6A 1FSYA 1K25A 4A5RA 3PAEA 4K91A 4PMAA 4HESA 4HIAA 3C4OA 5FI7A 3K3DA 3E4QA 1FOFA 4CLCE 3OOVA 3RH8B 2QZ6A 4CLCA 4LLOB 5HDSA 3A0VA 3KSGA 4MDZA 3MJQA 2O9CA 3NY4A 3CG5A 1JWPA 2J9OA 1EROA 2ZC4B 5I94A 4CLCD 5A8BA 3P01A 3PYPA 3ZVWA 3CI6A 4QHCA 1FIKA 4HBUA 4DDYA 1H0MA 3UB9A 2ACGA 3PXPA 2Y2QA 3EWKA 2W3HA 2XROA 4CQHA 5JYPA 5E43A 1KOUA 4Y2FA 2WGWB 1KE3A 3A0SA 1PW8A 3MMHA 4OPZA 4OVDA 2BTFP 3MQ0A 3C7VA 3VP0A 4JLFA 2Z6DA 1H5XA 4N1HA 2VK3A 4Y15A 2XA7M 3MXSA 3F1OB 4X55A 3NULA 1DP8A 4E3NA 3BRMA 1K4FA 4QPRA 4GJ4A 4B9OA 2AVXA 3M6BA 2VGJA 2GJ3A 1CF0A 2HF6A 1LLBA 1FSWA 1RP5A 3LI9A 2P7JA 2WADA 1DRMA 4RQ9A 2BLSA 5HL1A 3IX4A 4WEKA 2X71A 1OTDA 4HP4A 2D01A 4MNRA 4NKPA 2VZWA 2W3GA 1J9MA 1BYWA 3NDEA 5E2FA 1OTIA 4WYYA 1N9LA 5EOEA 1E25A 3CLOA 4DE2A 1MWRA 1HD8A 1UGUA 4GB7A 1YMSA 3E2KA 3C38A 1V9ZA 1WYBA 4DJ2A 1V9YA 5HD5A 1K57A 2W3DA 4N92A 4R70A 1I2SA 3C4PA 3LY4A 4KZ7A 2J3TD 2Y79A 4AFIA 2HJEA 3FKWA 1L0GA 3ZQ5A 4MEZA 4ZJ3A 5F6AA 3R7WB 3BQ8A 3F1PB 4KUOA 4UEYA 1DJBA 2ZMVA 5CX7A 2XH9A 1XXMA 4LRYC 3OPLA 4NG2A 4ME4A 4EEPA 2FFYA 1IKGA 3UDIA 3EEHA 4C3QA 4LCMA 1NZUA 5GLAA 3MXQA 5GLBA 1KGGA 1VHMA 4JF6A 1XA7A 4UQIS 4WMCA 3V5MA 3SS5A 1X0OA 3IXDA 3IHBA 3M6HA 3T4QA 3S1YA 1MXOA 1BLCA 1NYMA 2V0UA 4BBTA 3QNBA 1EWZA 1IYOA 3ICYA 2L4RA 3FG8A 3G30A 1TS8A 4HI4A 3QP1A 2JKTI 5A90A 2X02A 3PBQA 4HHDA 3LIEA 3N6IA 1XA1A 4UHUA 4UAAA 3EGXC 1O7EA 1BLSA 2YKFA 4Y13A 4KG6A 5CHMA 1EW0A 1LT0A 3BEBA 3PBTA 4FH4A 4IHQA 5DJTA 4UQIM 3MZDA 5TBMB 3B3XA 4X69A 5DFYA 4X1MA 4EUVA 4D60A 1HLUP 3LY3A 1LL9A 4E6WA 4R6LA 4WZ5A 1YLTA 3IWIA 3OZHA 3HUOA 1SDNA 5FQMA 5F1GA 3ZG5A 2K31A 4GLQA 3LR0A 5CEDA 2A24B 2ZOHA 4GZBA 3NC8A 1W8YA 4B93A 1W8QA 1CEFA 2WGVA 2WYXA 3UB7A 2RCXA 2EX2A 3BFGA 4R3JA 3IT9A 1MKIA 1N4OA 2XD5A 1OT9A 2QJ7A 3PBNA 3TE8A 3VOZA 3T4OA 2B95A 2JKRM 3KSIA 3JVVA 1K0KA 2C5WB 3CWFA 1GA9A 3VE4A 3DWKA 1E3UD 3MQQA 2ZQCA 1W63M 4OKPA 4EEUA 3FV7A 4JGPA 2WAFA 5KSCA 1N9OA 5CGWA 5J7EA 4NETA 3TSGA 1FILA 1ERMA 2PT7A 1K57C 3F1OA 1E4DA 3RFBA 5EVID 1G28A 2P08A 1TS0A 4PM6A 2ZM8A 3O3VA 3IBJA 2ZQAA 3LIFA 3G4PA 2XGNA 1KGFA 3T1XA 5DTTA 3ZG0A 4B4ZA 3IH8A 4KENB 1XJ6A 4IJGA 1XJ4A 2VLGA 2WKPA 5U47A 4PM9A 2B5RA 1VEUA 5L09A 4WN5A 1NY0A 4PM5A 5G4YA 2LB9A 1KGEA 3GECA 3VFHA 3T50A 3NHQA 1ZC2A 3OCNA 1N9BA 4QU3A 4KZBA 2JCHA 2ZC3B 4RVAA 4PAUA 1DJAA 4K0XA 4O7DA 2XA7S 4Y3IA 2HDSA 4BWIA 3NBLA 3PTEA 4S2NA 3TG9A 3UE0A 2W3FA 3CZDA 2VJWA 4KQOA 1SKOA 4I39A 1TD5A 3GMWA 2WK0A 1MKMA 5A91A 1W79A 5IHVA 3HLCA 4DE1A 4MMNA 1S6RA 2J9PA 4BLMA 4IUKA 3WRZA 2HDQA 3UNWA 1K56A 2EFUA 2HP6A 4OQIA 2WZXA 3LEZA 1PIOA 3S7PA 1BZAA 3HLWA 1GHIA 1ALQA 4U0XA 5FATA 5GHXA 5EVEA 2XR0A 1HVBA 1T1AA 4KQDA 3HLGA 4F94A 4M3KA 3L9KA 1Z6FA 1LSVA 1Q2QA 3IF5A 2ZC6B 3CJMA 3UMEA 5G4ZA 4R3AA 4RA7A 4XT2B 3BQAA 1CJFA 5FAOA 3GVBA 5AQ7A 5CHUA 3RXWA 2WKRA 4CJNA 4DN0A 2JE5A 2VA0A 1RGYA 2XSSA 4GD8A 4Z9QA 4ZRRA 4ETXA 2EX6A 5G18A 4ZJ2A 4DXCA 4I3IA 5KMWA 4QB8A 2Y55A 3MF0A 4E3OA 1CI9A 4OP8A 1OJGA 3IHAA 3T4TA 1NYYA 4DRTA 4E3JA 2Q9MA 4S2PA 5FAPA 3TW8A 4KZ9A 3VOLA 5TGFA 4XT2A 2V2FF 3WS0A 2PAVP 4HQAA 2JHEA 4NXBA 2Y2MA 3G31A 3U2AA 4R4SA 1VB6A 1XGJA 2HPBA 2DRWA 4OOLA 1K6SA 2L0WA 5DKKA 3UB6A 4KZ8A 4EQ1A 2VV8A 3D72A 3HJKA 4MBFA 3HREA 1CEGA 4R0QA 2H0YA 1EI5A 3HVFA 3E98A 3V3SA 4U0TA 4U3TA 1ERQA 5EM1A 1S1ZA 1XGIA 2M7UA 3T4SA 3PBOA 5CHJA 4Y5FA 3LR5A 5HARA 4GOGA 1D7EA 3ZFZA 4ARZA 1M40A 1AWIA 3Q07A 4WBGA 4JKTA 3BY9A 2XLNA 3BY8A 5I5LA 3O86A 2HP5A 1SCWA 2P04A 4EESA 3CAXA 4EW7A 2WUQA 4IEDA 1GCEA 4Y0OA 1K55A 4Y7PA 4HJ3A 1CQAA 3G2YA 1GHPA 2QHKA 4E6XA 3DTEA 5A93A 3NI9A 2Z6CA 1YLJA 4JGQA 3TOIA 1H3QA 1IEMA 4HH3A 1NRJA 4ZAMA 3UPOA 5EOOA 4Q0IA 1P9RA 2Y2KA 1L0FA 1MZUA 2M7VA 2NUPC 1SZVA 3ZNYA 1VQQA 4MLLA 4S2LA 5HL6A 3VSLA 1TDGA 2RL3A 1NZOA 5M19A 4EERA 1F9IA 3WS5A 2P74A 3K3CA 4FUWA 4P6ZS 1Y28A 3SH8A 3S7OA 2EX9A 2PU4A 2ZD8A 4EV4A 3E4OA 3SH9A 2WGWA 2V1ZA 3E0YA 3G32A 1VEUB 2FFFB 3CUEC 2J3WA 2ZQ9A 4MN7A 2OAP1 2V9AA 3CHWP 4I38A 1BUEA 4WLAA 3GRJA 5FI2A 2QKPA 1IOUA 2JKRI 5CXWA 3P09A 5HAIA 1GSWA 1H8ZA 4PHTA 2Y2GA 5AQAA 4P6ZM 3C5AA 3PHYA 5J4EA 3Q81A 4CLCC 1YAXA 5FAQA 4I3AA 2IWBA 3H7WA 4ARZB 4HH2A 4PM8A 3JPUA 3DAVA 3Q82A 1K56D 4HJ4A 3QP4A 3PBRA 3QP6A 3H82A 5FSRA 3ZHHA 4YOFA 2KOIA 4HEFA 5FDSA 2EA9A 3MR0A 1YSQA 3S22A 3GQZA 1TS6A 5EV0A 3P98A 2ZQDA 4EUZA 1MY8A 3LIBA 3LO7A 2XF3A 1ZKJA 4OQGA 3FWLA 2PYRA 1TF1A 2Y2NA 3UN7A 2JKTM 3LI8A 1PWCA 3DWZA 5FDHA 1XFNA 3PR6A 4GS9A 2FZ0A 3B42A 4Q0HA 3VP4A 2V1BA 1P0ZA 4NK3A 2A49A 1VM1A 5DF9A 1XJ3A 4B88A 3BFFA 4ZJ1A 3T4KA 5KIZA 2WKIA 4X68A 5F83A 1S0WA 3ZCZA 3S7NA 1JWZA 4P85A 1TEMA 1JWVA 5F68A 4GDBA 2OWJA 4JBFA 1MWSA 1GSXA 1DY6A 4XXRA 2WGIA 4R4RA 3HUNA 4S2JA 3O5YA 1PYYA 3S7QA 1IYQA 1XX2A 4IBRA 2A3UA 4LFUA 3RJUA 1WA9A 2OOLA 1XFQA 1JTDA 1MPLA 1P97A 3C7UA 3MZFA 4OOMA 4R3BA 4PPRA 4WUJA 3GSGA 3SW1A 4DF6A 4LRXC 3NOUC 3DTMA 3MZEA 4D2OA 3T4LA 4LGWA 3UB5P 2Y2OA 1IELA 5C5KA 4X1LA 4KZAA 2ZC5B 5TJJA 2Y2LA 5M18A 3LICA 5EECA 3NJAA 3DBAA 3OPRA 3LR3A 5HFOA 3OC2A 4OPYA 3Q7ZA 3UMDA 1KVMA 5AJGA 3UE1A 2IA2A 3BLSA 4G3KA 1L0DA 3C2WA 5HDCA 4YINA 5FASA 4QJGA 4QY6A 5FI6A 1YQSA 1ES5A 5TFQA 1T19A 2VGLS 5CGSA 4F3LB 2JKGA 2P9VB 3QHYA 2J3TC 2OLUA 4DE0A 3PBSA 4GNUA 4OLGA 2QJ5A 3NOTC 3O87A 4GD6A 1BULA 5A92A 4GCZA 3VP1A 1GA0A 1IYPA 1S67L 2W1TA 3PAGA 3W8KA 1JVJA 3Q7VB 5HSQA 1PRQA 3LFVA 2W27A 4S2IA 5K5BA 2PDRA 1HZOA 4JXWA 3M2JA 1BSGA 3D4FA 2J80A 4NXGA 4H6JA 4EXOA 4EBNA 5TR7A 1TDLA 4KQRA 2ZQ7A 2J8YA 3UDFA 4C75A 5HAQA 4WMCD 3DTIA 3QP5A 1A0KA 4I5SA 5MC7A 3QNCA 5HWTA 4OPQA 1YLPA 4L9GA 4LV1A 1ACFA 2WKHA 1PZOA 4EWFA 3F1NB 4OOYA 1K54C 4OPRA 2Y2PA 3NDGA 3BJNA 4X25A 2JBFA 3BECA 3VOYA 3VE3A 1NRFA 2PRFA 1ZTUA 4CLCB 4WL9A 1ESIA 5D3OA 1NWZA 4MBHA 1NLZA 2E8JA 5DTKA 3C8CA 4BBUA 3ZG7B 3N7WA 3IWOA 5E2EA 1L2SA 2V20A 4F3LA 3T1RA 4JF5A 3IX3A 3N4IA 4Q8IA 2W1TB 5DF8A 4E3IA 2Q0OA 2GDNA 2DCFA 2PBYA 1XJ2A 4ETZA 4O0PA 2HDRA 2Q9NA 3FPWA 4BMWA 5CTMA 2QYBA 5E2GA 2DMWA 3MFDA 4WELA 2E8IA 1L0EA 2ZC7A 4BJPA 2EXBA 2V0WA 4E3KA 4PKYA 5GLDA 4Z1WA 1K55C 3KO6A 3HJIA 3BLMA 1BLHA 1LHYA 3UO9A 4S2MA 3E4PA 3UE6A 3B33A 2BG1A 4IBXA 1FCMA 1G5UA 4GN2A 3IXBA 1LI0A 2B18A 3MKEA 4QWOA 3Q7VA 3KSFA 3CPTB 1Y4OA 2ZL1A 3W4PA 3LIDA 4II7A 4P0MA 4DKIA 3IF6B 3ZGAB 5FQQA 3R7WA 1GHMA 4BL3A 3F1PA 5JYOA 3W4OA 3D9YA 2XFSA 1L3LA 2OV5A 3FC7A 3SOIA 3FYZA 5IT5A 4GKUA 1ZG4A 5J8XA 1OT6A 2PU2A 3W4QA 3BW6A 5TBMA 4EQIA 4LV0A 1T18A 3VMAA 4O01A 4EETB 1NXYA 1FR6A 4WZ4A 4BBVA 1DP6A 3MQOA 1SKOB 5L8MA 5EVLA 3DTKA 1H8YA 3VFFA 1ES2A 3KYQA 2ZMAA 5GHZA 3G6OA 4MCWA 1UWNX 2UV0E 4BD0A 4EU0A 4H6JB 5HZHA 2XD1A 3R4KA 1PWDA 4HNBA 5IS1A 4GHIA 3EOIA 5FEFA 1YLYA 2NUTC 3TRCA 1D06A 4UA6A 5L07A 2IWDA 4Y0TA 3H9WA 4IVIA 2ZL1B 4UA9A 3IF6C 4WF0A 3MBZA 4OONA 5L2FA 3D3OA 4HBTA 4LRZE 3W2ZA 1G6AA 2QPNA 4JGOA 2WZZA 3UPNA 4K0WA 4MN5A 4E04A 2GZAA 2UWXA 1XKZA 2VEAA 3MSHA 4XUZA 2I72A 4YFMA 1KVLA 1PI4A 1YLZA 1OTEA 2Z2MB 3UPPA 1S4SA 3IXGA 3VP3A 3LR4A 3A3JA 2PHYA 4UA7A 1KE0A 1YSPA 2PBDP 1F98A 3SS4A 4FH2A 2G2WA 3HLFA 5LBRA 1MBLA 5CRFA 2PD7A 2V8FA 4ZTKA 4S2OA 5FQIA 4LENA 2V8CA 2WAEA 1MC0A 4O8GA 4S2NC 1YKDA 3ISGA 3AGDA 5M1AA 4BD1A 4MN6A 3VV4A 2ZBBA 1LL5A 2ZM0A 3KSHA 1I5QA 1YT4A 5EUAA 2W1RA 3WWXA 5DVAA 5F1FA 5HWWA 3RXXA 3CPTA 2XQZA 3KYEA 2LB5A 1PFLA 5E2HA 4XUXA 3MXRA 2V1AA 3QP8A 5HAPA 1W63Q 2A24A 3LYXA 2ZJ9A 1I2WA 4BL2A 4KG2A 4L9EA 4P6BA 5HPIA 2KLIA 3A3FA 1FQGA 2VGKA 4OQ0A 2QMIA 2WKEA 5EFWA 5FA7A 3HCYA 3O88A 1UWPX 1KDSA 4GHIB 5DJUA 5EE8A 4X6TA 3WS4A 2A2LA 3CMZA 3ITAA 3KYZA 4QY5A 3EQUA 4ID4A 5DKLA 3CUEA 3HUMA 3F1NA 2PR5A 3BFCA 1H8MA 4GDNA 4KZ4A 3HL9A 5DTSA 3HLDA 3UY6A 4LPZA 2ZMFA 4N1XA 2Y8HA 4CPKA 1K38A 1OJ5A 1K54A 4RYEA 3TJZC 1LSWA 4N9LA 3MS6A 1TVFA 1FR1A 3K2NA 4R38A 5CERA 2H10A 3JVUA 2OLVA 1F5MA 2ZM2A 1KDWA 3A0RA 1ONHA 2X01A 2I9VA 2H5SA 3C30A 5FQKA 4DXBA 2VX8A 3GDIA 2ZQ8A 2VV7A 3MFXA 3JYIA 3NCKA 1DP9A 3BWLA 3IF6A 3LIAA 3OPPA 4JXSA 1ONGA 1PZPA 5FEGA 3T1SA 1PW1A 1FCNA 1STZA 1ZHHB 5HWVA 1BTLA 4YNRA 1C3BA 4N9KA 2L1MA 3Q1FA 1Z09A 2XRNA 5HDDA 4BENA 1J3WA 3HLEA 1N9NA 3QP2A 4OLDA 2XEPA 4LV3A 3WS1A 4KZ5A 1SHVA 5AVFA 2VGLM 4NXEA 2EX8A 2B02A 4G3WA 2GNXA 3KX0X 3NECA 1YPRA 2O9AA 4KZ6A 2XDMA 2M1CA 3H7WB 3IS2A 2C6WB 3V67A 3IQAA 2G7UA 4KG5A 3T12B 3GV9A 5HPFA 3ULFA 5HD3A 2JN7A 1KE4A 1E3UA 5EVIC 4S2KA 2VV6A 2R78A 3G35A 1GSVA 2PR6A 3IH9A 1WE4A 4LV2A 5F69A 3DW0A 2GX5A 3IBRA 4ZBEA 5CEBA 3LUQA 4R23A 2Y2JA 3IX8A 4GW9A 1AXBA 2Y2IA 5GLCA 2Y91A 2PYPA 5BOHA 2HJ9C 3FKVA 2Y59A 2O9BA 3IS2B 1TS7A 3GTCA 2ZOIA 5J3WA 1Q2PA 3SS3A 4KQQA 2XFTA 3V3RA 3UE3A 1YMXA 2HP9A 4JXVA 4LCLA 2FH5A 4GS9B 4FOFA 1OPXA 3EQVA 3IWQA 4DDSA 3EEAA 4DJ3A 2W0NA 1RCJA 4EBPA 4WZ5C 1ES4A 3CITA 4WM9A 1IFQA 3LGOA 2VKSA 2H28A 1ODVA 5F82A 1VETA 4BQMA 2Y2HA 4FCFA 2R9XA 3MKFA 4OH0A 3WRTA 5EM0A 4FD8A 2HV1A 4EBLA 3N8SA 3RTYA 1FCOA 5L10A 1MWUA 3L7HA 3ZVTA 1QMEA 2OWHA 3NOPC 4DE3A 2G2UA 3SZTA 3E2LA 5EPHA 4HJ6A 2QWSA 3NIAA 1BLPA 2EXAA 4L9FA 3OLOA 3G2ZA 2HZ5A 3V39A 1BT5A 5GL9A 3LCEA 3GR2A 1W7FA 2OAQ1 2Z2LB 5HX9A 2O99A 4X53A 3BFDA 2EFXA 4OP5A 3G34A 1LL8A 4K08A 1D1JA 4NEED 2CC1A 3FPVA 1RGZA 2H0TA 4M4XA 1HTZA 1CK3A 4KZ3A 1IKIA 5FL3A 4RX2A 3ZYTA 2HDUA 4HP9A 1S1YA 1JTGA 2EWVA 5FQJA 3HLBA 4JF4A 5IU1A 4DMZA 3I7JA 4IVKA 2KX6A 4P87A 1NJ4A 1T1BA 1SDEA 2O0YA 1P9WA 3N8RA 4JXGA 5DF7A 3VP2A 3FZCA 3UDXA 4Q0JA 1WYCA 1K6RA 1VETB 4JGRA 5FQ9A 1PWGA 3BYDA 3OCLA 1NLYA 2J7VA 1LSXA 2HGVA 3U4LP 5AVEA 2JKFA 3HBRA 2OSUA 1JNUA 1F2KA 4Y0UA 4E3LA 1YM1A
chains in the Genus database with same CATH topology
2VK3A 4X25A 1PFLA 1Y4OA 2V8FA 1VEUA 2ZL1A 4FUWA 1PRQA 3LEQA 5EM1A 3DAVA 3CPTB 3T1SA 2V8CA 1CJFA 1VETB 3NULA 3MSHA 3T1RA 1A0KA 1SKOA 2PRFA 4FTXA 3T1XA 5EM0A 1Z09A 3T12B 1SZVA 3MS6A 1FIKA 1J3WA 1FILA 1CQAA 1G5UA 1VEUB 2B95A 2HZ5A 2ZL1B 3D9YA 3LGOA 5EVEA 4X1MA 1ACFA 1D1JA 2ACGA 3T1QB 2JKFA 2BTFP 4X1LA 1AWIA 1K0KA 3U4LP 1CF0A 4D60A 4QWOA 1PNEA 1SKOB 5FDSA 3L9KA 3CPTA 4ESPA 1VETA 2PBDP 2E8JA 1HLUP 2JKGA 1F2KA 2PAVP 3CHWP 3KYEA 3L7HA 5EV0A 5FEFA 3NECA 1YPRA 3UB5P 5FEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VK3 A;  4X25 A;  1PFL A;  1Y4O A;  2V8F A;  1VEU A;  2ZL1 A;  4FUW A;  1PRQ A;  3LEQ A;  5EM1 A;  3DAV A;  3CPT B;  3T1S A;  2V8C A;  1CJF A;  1VET B;  3NUL A;  3MSH A;  3T1R A;  1A0K A;  1SKO A;  2PRF A;  4FTX A;  3T1X A;  5EM0 A;  1Z09 A;  3T12 B;  1SZV A;  3MS6 A;  1FIK A;  1J3W A;  1FIL A;  1CQA A;  1G5U A;  1VEU B;  2B95 A;  2HZ5 A;  2ZL1 B;  3D9Y A;  3LGO A;  5EVE A;  4X1M A;  1ACF A;  1D1J A;  2ACG A;  3T1Q B;  2JKF A;  2BTF P;  4X1L A;  1AWI A;  1K0K A;  3U4L P;  1CF0 A;  4D60 A;  4QWO A;  1PNE A;  1SKO B;  5FDS A;  3L9K A;  3CPT A;  4ESP A;  1VET A;  2PBD P;  2E8J A;  1HLU P;  2JKG A;  1F2K A;  2PAV P;  3CHW P;  3KYE A;  3L7H A;  5EV0 A;  5FEF A;  3NEC A;  1YPR A;  3UB5 P;  5FEG A; 
#chains in the Genus database with same CATH topology
 2CMN A;  3IXH A;  3N8L A;  1LI9 A;  1XPB A;  2W3E A;  2P9V A;  4FSF A;  3A3I A;  5CEC A;  1Y54 A;  4HOI A;  3OBF A;  4IUH A;  3ZG8 B;  4ESP A;  1S4R A;  1M6K A;  3ZNT A;  2ZLY A;  3H82 B;  4C6Y A;  1CI8 A;  5EVI A;  1S66 L;  4FTX A;  2YKH A;  1W5D A;  1G68 A;  2K7S A;  2K2N A;  3EGD C;  4Y17 A;  1IYS A;  3AGF A;  2R9W A;  3A3D A;  1YLW A;  5HW3 A;  1QMF A;  4PKY G;  3ITB A;  4PM7 A;  4R1G A;  2INW A;  4E3M A;  2BAS A;  4QD4 A;  1O07 A;  3ZG9 B;  1OME A;  5AQ9 A;  3OPH A;  3WS2 A;  1MWT A;  1SKF A;  1XP4 A;  3UB8 A;  3VSK A;  4YWZ A;  5KSH A;  1G6O A;  3T1Q B;  5CTN A;  3ZDJ A;  3P7N A;  4WEJ A;  1ES3 A;  4X56 A;  2WKQ A;  3BM6 A;  3B47 A;  5EVI B;  1ESU A;  3S4X A;  1OTA A;  3BFE A;  3LEQ A;  1T1C A;  5CGX A;  4KUK A;  4G3V A;  2EWW A;  4L0L A;  2Y4A A;  4MBK A;  4RX3 A;  5GHY A;  4H8R A;  2KDK A;  4JPM A;  4B4X A;  1PNE A;  4HY8 A;  1PI5 A;  3T4J A;  4NXF A;  3AGE A;  5AQB A;  3V50 A;  3A3E A;  4ZDX A;  3SH7 A;  5KZH A;  4I3J A;  2PD8 A;  1DJC A;  1K4E A;  2JC7 A;  2MJ6 A;  1U60 A;  2DNS A;  3M2K A;  2XK1 A;  4OQH A;  2D02 A;  1OTB A;  5F5Y A;  2IWC A;  5DFX A;  1ZG6 A;  1FSY A;  1K25 A;  4A5R A;  3PAE A;  4K91 A;  4PMA A;  4HES A;  4HIA A;  3C4O A;  5FI7 A;  3K3D A;  3E4Q A;  1FOF A;  4CLC E;  3OOV A;  3RH8 B;  2QZ6 A;  4CLC A;  4LLO B;  5HDS A;  3A0V A;  3KSG A;  4MDZ A;  3MJQ A;  2O9C A;  3NY4 A;  3CG5 A;  1JWP A;  2J9O A;  1ERO A;  2ZC4 B;  5I94 A;  4CLC D;  5A8B A;  3P01 A;  3PYP A;  3ZVW A;  3CI6 A;  4QHC A;  1FIK A;  4HBU A;  4DDY A;  1H0M A;  3UB9 A;  2ACG A;  3PXP A;  2Y2Q A;  3EWK A;  2W3H A;  2XRO A;  4CQH A;  5JYP A;  5E43 A;  1KOU A;  4Y2F A;  2WGW B;  1KE3 A;  3A0S A;  1PW8 A;  3MMH A;  4OPZ A;  4OVD A;  2BTF P;  3MQ0 A;  3C7V A;  3VP0 A;  4JLF A;  2Z6D A;  1H5X A;  4N1H A;  2VK3 A;  4Y15 A;  2XA7 M;  3MXS A;  3F1O B;  4X55 A;  3NUL A;  1DP8 A;  4E3N A;  3BRM A;  1K4F A;  4QPR A;  4GJ4 A;  4B9O A;  2AVX A;  3M6B A;  2VGJ A;  2GJ3 A;  1CF0 A;  2HF6 A;  1LLB A;  1FSW A;  1RP5 A;  3LI9 A;  2P7J A;  2WAD A;  1DRM A;  4RQ9 A;  2BLS A;  5HL1 A;  3IX4 A;  4WEK A;  2X71 A;  1OTD A;  4HP4 A;  2D01 A;  4MNR A;  4NKP A;  2VZW A;  2W3G A;  1J9M A;  1BYW A;  3NDE A;  5E2F A;  1OTI A;  4WYY A;  1N9L A;  5EOE A;  1E25 A;  3CLO A;  4DE2 A;  1MWR A;  1HD8 A;  1UGU A;  4GB7 A;  1YMS A;  3E2K A;  3C38 A;  1V9Z A;  1WYB A;  4DJ2 A;  1V9Y A;  5HD5 A;  1K57 A;  2W3D A;  4N92 A;  4R70 A;  1I2S A;  3C4P A;  3LY4 A;  4KZ7 A;  2J3T D;  2Y79 A;  4AFI A;  2HJE A;  3FKW A;  1L0G A;  3ZQ5 A;  4MEZ A;  4ZJ3 A;  5F6A A;  3R7W B;  3BQ8 A;  3F1P B;  4KUO A;  4UEY A;  1DJB A;  2ZMV A;  5CX7 A;  2XH9 A;  1XXM A;  4LRY C;  3OPL A;  4NG2 A;  4ME4 A;  4EEP A;  2FFY A;  1IKG A;  3UDI A;  3EEH A;  4C3Q A;  4LCM A;  1NZU A;  5GLA A;  3MXQ A;  5GLB A;  1KGG A;  1VHM A;  4JF6 A;  1XA7 A;  4UQI S;  4WMC A;  3V5M A;  3SS5 A;  1X0O A;  3IXD A;  3IHB A;  3M6H A;  3T4Q A;  3S1Y A;  1MXO A;  1BLC A;  1NYM A;  2V0U A;  4BBT A;  3QNB A;  1EWZ A;  1IYO A;  3ICY A;  2L4R A;  3FG8 A;  3G30 A;  1TS8 A;  4HI4 A;  3QP1 A;  2JKT I;  5A90 A;  2X02 A;  3PBQ A;  4HHD A;  3LIE A;  3N6I A;  1XA1 A;  4UHU A;  4UAA A;  3EGX C;  1O7E A;  1BLS A;  2YKF A;  4Y13 A;  4KG6 A;  5CHM A;  1EW0 A;  1LT0 A;  3BEB A;  3PBT A;  4FH4 A;  4IHQ A;  5DJT A;  4UQI M;  3MZD A;  5TBM B;  3B3X A;  4X69 A;  5DFY A;  4X1M A;  4EUV A;  4D60 A;  1HLU P;  3LY3 A;  1LL9 A;  4E6W A;  4R6L A;  4WZ5 A;  1YLT A;  3IWI A;  3OZH A;  3HUO A;  1SDN A;  5FQM A;  5F1G A;  3ZG5 A;  2K31 A;  4GLQ A;  3LR0 A;  5CED A;  2A24 B;  2ZOH A;  4GZB A;  3NC8 A;  1W8Y A;  4B93 A;  1W8Q A;  1CEF A;  2WGV A;  2WYX A;  3UB7 A;  2RCX A;  2EX2 A;  3BFG A;  4R3J A;  3IT9 A;  1MKI A;  1N4O A;  2XD5 A;  1OT9 A;  2QJ7 A;  3PBN A;  3TE8 A;  3VOZ A;  3T4O A;  2B95 A;  2JKR M;  3KSI A;  3JVV A;  1K0K A;  2C5W B;  3CWF A;  1GA9 A;  3VE4 A;  3DWK A;  1E3U D;  3MQQ A;  2ZQC A;  1W63 M;  4OKP A;  4EEU A;  3FV7 A;  4JGP A;  2WAF A;  5KSC A;  1N9O A;  5CGW A;  5J7E A;  4NET A;  3TSG A;  1FIL A;  1ERM A;  2PT7 A;  1K57 C;  3F1O A;  1E4D A;  3RFB A;  5EVI D;  1G28 A;  2P08 A;  1TS0 A;  4PM6 A;  2ZM8 A;  3O3V A;  3IBJ A;  2ZQA A;  3LIF A;  3G4P A;  2XGN A;  1KGF A;  3T1X A;  5DTT A;  3ZG0 A;  4B4Z A;  3IH8 A;  4KEN B;  1XJ6 A;  4IJG A;  1XJ4 A;  2VLG A;  2WKP A;  5U47 A;  4PM9 A;  2B5R A;  1VEU A;  5L09 A;  4WN5 A;  1NY0 A;  4PM5 A;  5G4Y A;  2LB9 A;  1KGE A;  3GEC A;  3VFH A;  3T50 A;  3NHQ A;  1ZC2 A;  3OCN A;  1N9B A;  4QU3 A;  4KZB A;  2JCH A;  2ZC3 B;  4RVA A;  4PAU A;  1DJA A;  4K0X A;  4O7D A;  2XA7 S;  4Y3I A;  2HDS A;  4BWI A;  3NBL A;  3PTE A;  4S2N A;  3TG9 A;  3UE0 A;  2W3F A;  3CZD A;  2VJW A;  4KQO A;  1SKO A;  4I39 A;  1TD5 A;  3GMW A;  2WK0 A;  1MKM A;  5A91 A;  1W79 A;  5IHV A;  3HLC A;  4DE1 A;  4MMN A;  1S6R A;  2J9P A;  4BLM A;  4IUK A;  3WRZ A;  2HDQ A;  3UNW A;  1K56 A;  2EFU A;  2HP6 A;  4OQI A;  2WZX A;  3LEZ A;  1PIO A;  3S7P A;  1BZA A;  3HLW A;  1GHI A;  1ALQ A;  4U0X A;  5FAT A;  5GHX A;  5EVE A;  2XR0 A;  1HVB A;  1T1A A;  4KQD A;  3HLG A;  4F94 A;  4M3K A;  3L9K A;  1Z6F A;  1LSV A;  1Q2Q A;  3IF5 A;  2ZC6 B;  3CJM A;  3UME A;  5G4Z A;  4R3A A;  4RA7 A;  4XT2 B;  3BQA A;  1CJF A;  5FAO A;  3GVB A;  5AQ7 A;  5CHU A;  3RXW A;  2WKR A;  4CJN A;  4DN0 A;  2JE5 A;  2VA0 A;  1RGY A;  2XSS A;  4GD8 A;  4Z9Q A;  4ZRR A;  4ETX A;  2EX6 A;  5G18 A;  4ZJ2 A;  4DXC A;  4I3I A;  5KMW A;  4QB8 A;  2Y55 A;  3MF0 A;  4E3O A;  1CI9 A;  4OP8 A;  1OJG A;  3IHA A;  3T4T A;  1NYY A;  4DRT A;  4E3J A;  2Q9M A;  4S2P A;  5FAP A;  3TW8 A;  4KZ9 A;  3VOL A;  5TGF A;  4XT2 A;  2V2F F;  3WS0 A;  2PAV P;  4HQA A;  2JHE A;  4NXB A;  2Y2M A;  3G31 A;  3U2A A;  4R4S A;  1VB6 A;  1XGJ A;  2HPB A;  2DRW A;  4OOL A;  1K6S A;  2L0W A;  5DKK A;  3UB6 A;  4KZ8 A;  4EQ1 A;  2VV8 A;  3D72 A;  3HJK A;  4MBF A;  3HRE A;  1CEG A;  4R0Q A;  2H0Y A;  1EI5 A;  3HVF A;  3E98 A;  3V3S A;  4U0T A;  4U3T A;  1ERQ A;  5EM1 A;  1S1Z A;  1XGI A;  2M7U A;  3T4S A;  3PBO A;  5CHJ A;  4Y5F A;  3LR5 A;  5HAR A;  4GOG A;  1D7E A;  3ZFZ A;  4ARZ A;  1M40 A;  1AWI A;  3Q07 A;  4WBG A;  4JKT A;  3BY9 A;  2XLN A;  3BY8 A;  5I5L A;  3O86 A;  2HP5 A;  1SCW A;  2P04 A;  4EES A;  3CAX A;  4EW7 A;  2WUQ A;  4IED A;  1GCE A;  4Y0O A;  1K55 A;  4Y7P A;  4HJ3 A;  1CQA A;  3G2Y A;  1GHP A;  2QHK A;  4E6X A;  3DTE A;  5A93 A;  3NI9 A;  2Z6C A;  1YLJ A;  4JGQ A;  3TOI A;  1H3Q A;  1IEM A;  4HH3 A;  1NRJ A;  4ZAM A;  3UPO A;  5EOO A;  4Q0I A;  1P9R A;  2Y2K A;  1L0F A;  1MZU A;  2M7V A;  2NUP C;  1SZV A;  3ZNY A;  1VQQ A;  4MLL A;  4S2L A;  5HL6 A;  3VSL A;  1TDG A;  2RL3 A;  1NZO A;  5M19 A;  4EER A;  1F9I A;  3WS5 A;  2P74 A;  3K3C A;  4FUW A;  4P6Z S;  1Y28 A;  3SH8 A;  3S7O A;  2EX9 A;  2PU4 A;  2ZD8 A;  4EV4 A;  3E4O A;  3SH9 A;  2WGW A;  2V1Z A;  3E0Y A;  3G32 A;  1VEU B;  2FFF B;  3CUE C;  2J3W A;  2ZQ9 A;  4MN7 A;  2OAP 1;  2V9A A;  3CHW P;  4I38 A;  1BUE A;  4WLA A;  3GRJ A;  5FI2 A;  2QKP A;  1IOU A;  2JKR I;  5CXW A;  3P09 A;  5HAI A;  1GSW A;  1H8Z A;  4PHT A;  2Y2G A;  5AQA A;  4P6Z M;  3C5A A;  3PHY A;  5J4E A;  3Q81 A;  4CLC C;  1YAX A;  5FAQ A;  4I3A A;  2IWB A;  3H7W A;  4ARZ B;  4HH2 A;  4PM8 A;  3JPU A;  3DAV A;  3Q82 A;  1K56 D;  4HJ4 A;  3QP4 A;  3PBR A;  3QP6 A;  3H82 A;  5FSR A;  3ZHH A;  4YOF A;  2KOI A;  4HEF A;  5FDS A;  2EA9 A;  3MR0 A;  1YSQ A;  3S22 A;  3GQZ A;  1TS6 A;  5EV0 A;  3P98 A;  2ZQD A;  4EUZ A;  1MY8 A;  3LIB A;  3LO7 A;  2XF3 A;  1ZKJ A;  4OQG A;  3FWL A;  2PYR A;  1TF1 A;  2Y2N A;  3UN7 A;  2JKT M;  3LI8 A;  1PWC A;  3DWZ A;  5FDH A;  1XFN A;  3PR6 A;  4GS9 A;  2FZ0 A;  3B42 A;  4Q0H A;  3VP4 A;  2V1B A;  1P0Z A;  4NK3 A;  2A49 A;  1VM1 A;  5DF9 A;  1XJ3 A;  4B88 A;  3BFF A;  4ZJ1 A;  3T4K A;  5KIZ A;  2WKI A;  4X68 A;  5F83 A;  1S0W A;  3ZCZ A;  3S7N A;  1JWZ A;  4P85 A;  1TEM A;  1JWV A;  5F68 A;  4GDB A;  2OWJ A;  4JBF A;  1MWS A;  1GSX A;  1DY6 A;  4XXR A;  2WGI A;  4R4R A;  3HUN A;  4S2J A;  3O5Y A;  1PYY A;  3S7Q A;  1IYQ A;  1XX2 A;  4IBR A;  2A3U A;  4LFU A;  3RJU A;  1WA9 A;  2OOL A;  1XFQ A;  1JTD A;  1MPL A;  1P97 A;  3C7U A;  3MZF A;  4OOM A;  4R3B A;  4PPR A;  4WUJ A;  3GSG A;  3SW1 A;  4DF6 A;  4LRX C;  3NOU C;  3DTM A;  3MZE A;  4D2O A;  3T4L A;  4LGW A;  3UB5 P;  2Y2O A;  1IEL A;  5C5K A;  4X1L A;  4KZA A;  2ZC5 B;  5TJJ A;  2Y2L A;  5M18 A;  3LIC A;  5EEC A;  3NJA A;  3DBA A;  3OPR A;  3LR3 A;  5HFO A;  3OC2 A;  4OPY A;  3Q7Z A;  3UMD A;  1KVM A;  5AJG A;  3UE1 A;  2IA2 A;  3BLS A;  4G3K A;  1L0D A;  3C2W A;  5HDC A;  4YIN A;  5FAS A;  4QJG A;  4QY6 A;  5FI6 A;  1YQS A;  1ES5 A;  5TFQ A;  1T19 A;  2VGL S;  5CGS A;  4F3L B;  2JKG A;  2P9V B;  3QHY A;  2J3T C;  2OLU A;  4DE0 A;  3PBS A;  4GNU A;  4OLG A;  2QJ5 A;  3NOT C;  3O87 A;  4GD6 A;  1BUL A;  5A92 A;  4GCZ A;  3VP1 A;  1GA0 A;  1IYP A;  1S67 L;  2W1T A;  3PAG A;  3W8K A;  1JVJ A;  3Q7V B;  5HSQ A;  1PRQ A;  3LFV A;  2W27 A;  4S2I A;  5K5B A;  2PDR A;  1HZO A;  4JXW A;  3M2J A;  1BSG A;  3D4F A;  2J80 A;  4NXG A;  4H6J A;  4EXO A;  4EBN A;  5TR7 A;  1TDL A;  4KQR A;  2ZQ7 A;  2J8Y A;  3UDF A;  4C75 A;  5HAQ A;  4WMC D;  3DTI A;  3QP5 A;  1A0K A;  4I5S A;  5MC7 A;  3QNC A;  5HWT A;  4OPQ A;  1YLP A;  4L9G A;  4LV1 A;  1ACF A;  2WKH A;  1PZO A;  4EWF A;  3F1N B;  4OOY A;  1K54 C;  4OPR A;  2Y2P A;  3NDG A;  3BJN A;  4X25 A;  2JBF A;  3BEC A;  3VOY A;  3VE3 A;  1NRF A;  2PRF A;  1ZTU A;  4CLC B;  4WL9 A;  1ESI A;  5D3O A;  1NWZ A;  4MBH A;  1NLZ A;  2E8J A;  5DTK A;  3C8C A;  4BBU A;  3ZG7 B;  3N7W A;  3IWO A;  5E2E A;  1L2S A;  2V20 A;  4F3L A;  3T1R A;  4JF5 A;  3IX3 A;  3N4I A;  4Q8I A;  2W1T B;  5DF8 A;  4E3I A;  2Q0O A;  2GDN A;  2DCF A;  2PBY A;  1XJ2 A;  4ETZ A;  4O0P A;  2HDR A;  2Q9N A;  3FPW A;  4BMW A;  5CTM A;  2QYB A;  5E2G A;  2DMW A;  3MFD A;  4WEL A;  2E8I A;  1L0E A;  2ZC7 A;  4BJP A;  2EXB A;  2V0W A;  4E3K A;  4PKY A;  5GLD A;  4Z1W A;  1K55 C;  3KO6 A;  3HJI A;  3BLM A;  1BLH A;  1LHY A;  3UO9 A;  4S2M A;  3E4P A;  3UE6 A;  3B33 A;  2BG1 A;  4IBX A;  1FCM A;  1G5U A;  4GN2 A;  3IXB A;  1LI0 A;  2B18 A;  3MKE A;  4QWO A;  3Q7V A;  3KSF A;  3CPT B;  1Y4O A;  2ZL1 A;  3W4P A;  3LID A;  4II7 A;  4P0M A;  4DKI A;  3IF6 B;  3ZGA B;  5FQQ A;  3R7W A;  1GHM A;  4BL3 A;  3F1P A;  5JYO A;  3W4O A;  3D9Y A;  2XFS A;  1L3L A;  2OV5 A;  3FC7 A;  3SOI A;  3FYZ A;  5IT5 A;  4GKU A;  1ZG4 A;  5J8X A;  1OT6 A;  2PU2 A;  3W4Q A;  3BW6 A;  5TBM A;  4EQI A;  4LV0 A;  1T18 A;  3VMA A;  4O01 A;  4EET B;  1NXY A;  1FR6 A;  4WZ4 A;  4BBV A;  1DP6 A;  3MQO A;  1SKO B;  5L8M A;  5EVL A;  3DTK A;  1H8Y A;  3VFF A;  1ES2 A;  3KYQ A;  2ZMA A;  5GHZ A;  3G6O A;  4MCW A;  1UWN X;  2UV0 E;  4BD0 A;  4EU0 A;  4H6J B;  5HZH A;  2XD1 A;  3R4K A;  1PWD A;  4HNB A;  5IS1 A;  4GHI A;  3EOI A;  5FEF A;  1YLY A;  2NUT C;  3TRC A;  1D06 A;  4UA6 A;  5L07 A;  2IWD A;  4Y0T A;  3H9W A;  4IVI A;  2ZL1 B;  4UA9 A;  3IF6 C;  4WF0 A;  3MBZ A;  4OON A;  5L2F A;  3D3O A;  4HBT A;  4LRZ E;  3W2Z A;  1G6A A;  2QPN A;  4JGO A;  2WZZ A;  3UPN A;  4K0W A;  4MN5 A;  4E04 A;  2GZA A;  2UWX A;  1XKZ A;  2VEA A;  3MSH A;  4XUZ A;  2I72 A;  4YFM A;  1KVL A;  1PI4 A;  1YLZ A;  1OTE A;  2Z2M B;  3UPP A;  1S4S A;  3IXG A;  3VP3 A;  3LR4 A;  3A3J A;  2PHY A;  4UA7 A;  1KE0 A;  1YSP A;  2PBD P;  1F98 A;  3SS4 A;  4FH2 A;  2G2W A;  3HLF A;  5LBR A;  1MBL A;  5CRF A;  2PD7 A;  2V8F A;  4ZTK A;  4S2O A;  5FQI A;  4LEN A;  2V8C A;  2WAE A;  1MC0 A;  4O8G A;  4S2N C;  1YKD A;  3ISG A;  3AGD A;  5M1A A;  4BD1 A;  4MN6 A;  3VV4 A;  2ZBB A;  1LL5 A;  2ZM0 A;  3KSH A;  1I5Q A;  1YT4 A;  5EUA A;  2W1R A;  3WWX A;  5DVA A;  5F1F A;  5HWW A;  3RXX A;  3CPT A;  2XQZ A;  3KYE A;  2LB5 A;  1PFL A;  5E2H A;  4XUX A;  3MXR A;  2V1A A;  3QP8 A;  5HAP A;  1W63 Q;  2A24 A;  3LYX A;  2ZJ9 A;  1I2W A;  4BL2 A;  4KG2 A;  4L9E A;  4P6B A;  5HPI A;  2KLI A;  3A3F A;  1FQG A;  2VGK A;  4OQ0 A;  2QMI A;  2WKE A;  5EFW A;  5FA7 A;  3HCY A;  3O88 A;  1UWP X;  1KDS A;  4GHI B;  5DJU A;  5EE8 A;  4X6T A;  3WS4 A;  2A2L A;  3CMZ A;  3ITA A;  3KYZ A;  4QY5 A;  3EQU A;  4ID4 A;  5DKL A;  3CUE A;  3HUM A;  3F1N A;  2PR5 A;  3BFC A;  1H8M A;  4GDN A;  4KZ4 A;  3HL9 A;  5DTS A;  3HLD A;  3UY6 A;  4LPZ A;  2ZMF A;  4N1X A;  2Y8H A;  4CPK A;  1K38 A;  1OJ5 A;  1K54 A;  4RYE A;  3TJZ C;  1LSW A;  4N9L A;  3MS6 A;  1TVF A;  1FR1 A;  3K2N A;  4R38 A;  5CER A;  2H10 A;  3JVU A;  2OLV A;  1F5M A;  2ZM2 A;  1KDW A;  3A0R A;  1ONH A;  2X01 A;  2I9V A;  2H5S A;  3C30 A;  5FQK A;  4DXB A;  2VX8 A;  3GDI A;  2ZQ8 A;  2VV7 A;  3MFX A;  3JYI A;  3NCK A;  1DP9 A;  3BWL A;  3IF6 A;  3LIA A;  3OPP A;  4JXS A;  1ONG A;  1PZP A;  5FEG A;  3T1S A;  1PW1 A;  1FCN A;  1STZ A;  1ZHH B;  5HWV A;  1BTL A;  4YNR A;  1C3B A;  4N9K A;  2L1M A;  3Q1F A;  1Z09 A;  2XRN A;  5HDD A;  4BEN A;  1J3W A;  3HLE A;  1N9N A;  3QP2 A;  4OLD A;  2XEP A;  4LV3 A;  3WS1 A;  4KZ5 A;  1SHV A;  5AVF A;  2VGL M;  4NXE A;  2EX8 A;  2B02 A;  4G3W A;  2GNX A;  3KX0 X;  3NEC A;  1YPR A;  2O9A A;  4KZ6 A;  2XDM A;  2M1C A;  3H7W B;  3IS2 A;  2C6W B;  3V67 A;  3IQA A;  2G7U A;  4KG5 A;  3T12 B;  3GV9 A;  5HPF A;  3ULF A;  5HD3 A;  2JN7 A;  1KE4 A;  1E3U A;  5EVI C;  4S2K A;  2VV6 A;  2R78 A;  3G35 A;  1GSV A;  2PR6 A;  3IH9 A;  1WE4 A;  4LV2 A;  5F69 A;  3DW0 A;  2GX5 A;  3IBR A;  4ZBE A;  5CEB A;  3LUQ A;  4R23 A;  2Y2J A;  3IX8 A;  4GW9 A;  1AXB A;  2Y2I A;  5GLC A;  2Y91 A;  2PYP A;  5BOH A;  2HJ9 C;  3FKV A;  2Y59 A;  2O9B A;  3IS2 B;  1TS7 A;  3GTC A;  2ZOI A;  5J3W A;  1Q2P A;  3SS3 A;  4KQQ A;  2XFT A;  3V3R A;  3UE3 A;  1YMX A;  2HP9 A;  4JXV A;  4LCL A;  2FH5 A;  4GS9 B;  4FOF A;  1OPX A;  3EQV A;  3IWQ A;  4DDS A;  3EEA A;  4DJ3 A;  2W0N A;  1RCJ A;  4EBP A;  4WZ5 C;  1ES4 A;  3CIT A;  4WM9 A;  1IFQ A;  3LGO A;  2VKS A;  2H28 A;  1ODV A;  5F82 A;  1VET A;  4BQM A;  2Y2H A;  4FCF A;  2R9X A;  3MKF A;  4OH0 A;  3WRT A;  5EM0 A;  4FD8 A;  2HV1 A;  4EBL A;  3N8S A;  3RTY A;  1FCO A;  5L10 A;  1MWU A;  3L7H A;  3ZVT A;  1QME A;  2OWH A;  3NOP C;  4DE3 A;  2G2U A;  3SZT A;  3E2L A;  5EPH A;  4HJ6 A;  2QWS A;  3NIA A;  1BLP A;  2EXA A;  4L9F A;  3OLO A;  3G2Z A;  2HZ5 A;  3V39 A;  1BT5 A;  5GL9 A;  3LCE A;  3GR2 A;  1W7F A;  2OAQ 1;  2Z2L B;  5HX9 A;  2O99 A;  4X53 A;  3BFD A;  2EFX A;  4OP5 A;  3G34 A;  1LL8 A;  4K08 A;  1D1J A;  4NEE D;  2CC1 A;  3FPV A;  1RGZ A;  2H0T A;  4M4X A;  1HTZ A;  1CK3 A;  4KZ3 A;  1IKI A;  5FL3 A;  4RX2 A;  3ZYT A;  2HDU A;  4HP9 A;  1S1Y A;  1JTG A;  2EWV A;  5FQJ A;  3HLB A;  4JF4 A;  5IU1 A;  4DMZ A;  3I7J A;  4IVK A;  2KX6 A;  4P87 A;  1NJ4 A;  1T1B A;  1SDE A;  2O0Y A;  1P9W A;  3N8R A;  4JXG A;  5DF7 A;  3VP2 A;  3FZC A;  3UDX A;  4Q0J A;  1WYC A;  1K6R A;  1VET B;  4JGR A;  5FQ9 A;  1PWG A;  3BYD A;  3OCL A;  1NLY A;  2J7V A;  1LSX A;  2HGV A;  3U4L P;  5AVE A;  2JKF A;  3HBR A;  2OSU A;  1JNU A;  1F2K A;  4Y0U A;  4E3L A;  1YM1 A; 
#chains in the Genus database with same CATH homology
 2VK3 A;  4X25 A;  1PFL A;  1Y4O A;  2V8F A;  1VEU A;  2ZL1 A;  4FUW A;  1PRQ A;  3LEQ A;  5EM1 A;  3DAV A;  3CPT B;  3T1S A;  2V8C A;  1CJF A;  1VET B;  3NUL A;  3MSH A;  3T1R A;  1A0K A;  1SKO A;  2PRF A;  4FTX A;  3T1X A;  5EM0 A;  1Z09 A;  3T12 B;  1SZV A;  3MS6 A;  1FIK A;  1J3W A;  1FIL A;  1CQA A;  1G5U A;  1VEU B;  2B95 A;  2HZ5 A;  2ZL1 B;  3D9Y A;  3LGO A;  5EVE A;  4X1M A;  1ACF A;  1D1J A;  2ACG A;  3T1Q B;  2JKF A;  2BTF P;  4X1L A;  1AWI A;  1K0K A;  3U4L P;  1CF0 A;  4D60 A;  4QWO A;  1PNE A;  1SKO B;  5FDS A;  3L9K A;  3CPT A;  4ESP A;  1VET A;  2PBD P;  2E8J A;  1HLU P;  2JKG A;  1F2K A;  2PAV P;  3CHW P;  3KYE A;  3L7H A;  5EV0 A;  5FEF A;  3NEC A;  1YPR A;  3UB5 P;  5FEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...