3MTEA

Crystal structure of 16s rrna methyltranferase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
219
structure length
219
Chain Sequence
b'MLILKGTKTVDLSKDELTEIIGQFDRVHIDLGTGDGRNIYKLAINDQNTFYIGIDPVKENLFDISKKIIKKPSKGGLSNVVFVIAAAESLPFELKNIADSISILFPWGTLLEYVIKPNRDILSNVADLAKKEAHFEFVTTYSDSYEEAEIKKRGLPLLSKAYFLSEQYKAELSNSGFRIDDVKELDNEYVKQFNSLWAKRLAFGRKRSFFRVSGHVSKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA methylase
molecule tags Transferase
source organism Escherichia coli
publication title Structural insights into the function of aminoglycoside-resistance A1408 16S rRNA methyltransferases from antibiotic-producing and human pathogenic bacteria.
pubmed doi rcsb
total genus 76
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.1.1.180: 16S rRNA (adenine(1408)-N(1))-methyltransferase.
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3mteA00
2AOUB 3AXSA 3SSOA 1RJGA 3GCZA 1JQDA 4K6MA 1TW2A 1N7IA 2ZULA 3OPNA 4MWZA 5EZSA 3NWBA 5FWAA 4BY9E 1N7JA 4HRAA 4POOA 3A25A 4QPNA 1V39A 2AOVA 1EG2A 3E7PA 5E2BA 1NW3A 2NP7A 2EJTA 3A27A 1JQ3A 2WA1A 1XDUA 2AS0A 3LL7A 3TRKA 4G56A 3MCZA 2IGTA 2PVCA 3CGGA 3M6VA 5CM2Z 4A6DA 3G5TA 3LX6A 2BM9A 5HZMA 2UYHA 2GH1A 1BC5A 2VP3A 3DMFA 5EMKA 5FCDA 3T7RA 4E31A 4E2YA 4ISCA 1KXZA 4DM3A 4GQBA 2IP2A 2PX5A 4CKEA 3KQYA 3TLJA 4U7PB 2AOWA 5DTQA 3KPVA 4PYLA 3BWBA 3ELWA 2EFJA 4FT2A 4PYOA 4FT4A 3VC1A 3G2QA 3FUWA 4PNEA 5BW4A 4PYMA 3G2OA 2NP6A 1R00A 5EGSA 4PONA 1VQ1A 4YV2A 3DTNA 1IY9A 1Y8CA 2AN3A 1G60A 4FS8A 3OZTA 1RI3A 1VP9A 4BLWA 3PS9A 4MHTA 3M33A 1NW7A 1G55A 5JUWA 4QTUB 3DUWA 3MAGA 4JXJA 4L7VA 3SX0A 1XTPA 3GJYA 3SXJA 3EEYA 3HCAA 3AXTA 2VZ9A 3MTEA 4HC4A 3DLIA 5HIJA 5LQJA 1KR5A 3TFWA 3P9IA 2NYUA 2B3TA 5K0LA 5E9JA 1NBIA 3HM2A 3EVFA 5EHGA 4BLVA 2C7PA 3C3PA 2IBSA 5EG5A 4KRGA 1RI1A 2BZGA 2EG5A 2I62A 5CVEA 4C06A 5EQJB 4YMGA 4R6WA 5GP1A 5D1NA 3RIEA 4DF3A 1O9GA 3UJDA 1WG8A 5K0BA 3IHTA 1YZ3A 3QOWA 4PCAA 4Y30A 5EMLA 1L1EA 2PX4A 3BWCA 3G7UA 3L8DA 1VIDA 5FUBA 3LDGA 3FPHA 3NTVA 3F4KA 4RX1A 5DRYA 3TKAA 2ZBRA 3G88A 1G8SA 5FQOA 1EJ6A 3FTFA 2V7EA 3FTDA 3FPGA 4GBED 4R05A 1L3CA 4RTLA 1ZKDA 1TW3A 4A6EA 2NXJA 3UA3A 1NV9A 2PJDA 3MHTA 5EOVA 3NMUF 3TM5A 5CVVA 3ELDA 5E8JA 2PGXA 4DMGA 2AR0A 4RVHA 4RTPA 3ANXA 4U7TB 4DQ0A 3K6RA 4R6XA 2PXCA 3RW9A 3T7SA 2IH4A 5LQKA 1R18A 1WXXA 2ZZKA 3B89A 4PINA 4E33A 3E23A 5ERGB 3UJBA 1RJDA 2PX8A 3DLCA 3CJRA 3OFJA 5EEHA 1G38A 2CL5A 4DZRA 2YUIA 1EAMA 2Y1XA 3KQSA 3HVKA 3EMDA 1BOOA 3PT9A 4GOLD 3GXOA 5HIKA 4YUYA 3UJ6A 5GIOE 2QE6A 2UYOA 3A7DA 3EVZA 2OYRA 1MHTA 2IH5A 1X19A 3BXOA 1JG4A 3LBFA 2PKWA 1JQEA 2JHCA 2PX2A 1H1DA 2YTZA 2H1RA 3EVEA 3MGGA 4QTTB 4PYQA 5EMJA 5FHRA 5K0NA 4LG1A 2V74B 4PCLA 3SSMA 3UJ9A 3MCTA 5CCXA 3FPFA 3NVKI 3B5IA 3OE5A 1ZGAA 2DULA 1G8AA 2P7HA 5LSAA 5KS2A 3M4XA 2AVDA 3KR9A 2UYQA 3PX2A 2B9EA 2FRXA 4M38A 4OA5A 3JWIA 4KIGA 2CWWA 4PIMA 1KPGA 2ORED 5CUQA 3DXYA 1ZGJA 2Y1WA 3HEMA 3FRHA 1L3BA 5FA8A 3KPJA 3TKYA 2BH2A 4RVDA 5FA5A 5K0GA 3ERCA 1WS6A 4C08A 1NW8A 3EVCA 4RTKA 4OBXA 1SG9A 3IEIA 1R8XA 3P2KA 1OR8A 1F3LA 3KQMA 4XCXA 3THRA 3P8ZA 3HVJA 4GOND 2HV9A 2CMGA 2QY6A 1VLMA 1INLA 2ADMA 5K0CA 2ZWAA 3FUVA 2GLUA 3DP7A 4MIKA 3EVGA 3D2LA 4RSRA 3LGAA 4GUAA 5FHQA 2ZFUA 4XUDA 1JG3A 5FTWA 2NXCA 3GU3A 3KR2A 2B2CA 1R74A 3MERA 1N2XA 5DLYA 1VE3A 1D2HA 1JTFA 2DPMA 5EIWA 5C1IA 3VC2A 5EIFA 4BP1A 2R3SA 4AZVA 5CVUA 5FWDA 3SGLA 3LCCA 4M7RA 5K05A 5IKMA 5DX0A 4M36A 1BHJA 2QRVA 2OB1A 1JR4A 2XYVA 3SMQA 3BWMA 4DCGA 3REOA 2HR1A 2OBFA 4RTNA 3HTXA 1G6Q1 3KU1A 2VDVE 3PTAA 2YXEA 5LQCA 1NV8A 1SQFA 3HA7A 5H02A 3TOSA 2IIPA 2YXDA 2OZVA 1JSXA 3ID6C 4HTFA 2PBFA 2P8JA 2PWYA 4IV8A 3BGIA 4RYLA 4AZSA 5HOQA 2CKDA 3KQQA 3OU7A 3P2EA 1IXKA 2FK8A 1P91A 3UJ8A 1ZQ9A 2QM3A 4ER5A 4KW7A 3JWHA 2ZBQA 3DMHA 2H11A 5ICCA 4LWOA 1DL5A 1XJ5A 3LDUA 3KQOA 1HMYA 3ORHA 1L9KA 5EMMA 1M6YA 2NXEA 5GWXA 3FPEA 3KPWA 1T43A 1SQGA 2Q41A 1D2CA 4WVLA 2PT9A 5E8RA 4HG2A 4UOEA 2ZCJA 3PFGA 1P39A 3X0DA 2NXNA 2VDWA 2A14A 2FYTA 4FSDA 2UYCA 3EVBA 4E32A 3TMAA 2HTEA 4X60A 1O9HA 5DM0A 1WXWA 4C4AA 3IYLW 3BUSA 4CKCA 4EQZA 1SUSA 1IM8A 2IH2A 2ZZMA 4DA4A 1YUBA 3KKZA 3BGDA 2I6GA 3CJTA 5HIIA 4AZTA 5T64A 3FTEA 3LHDA 2C7QA 2O0LA 3KQVA 3FRIA 4MQ4A 1M6EX 1NE2A 2JH8A 3Q87B 2ZLBA 3TQSA 4YUVA 4ER7A 4QPPA 1UIRA 4RTMA 4OX9Y 4R8RA 4ATNA 4KDCA 4PGHA 2AOXA 3T7TA 5MHTA 4RVGA 4RTJA 1FPQA 1Q0TA 3B3FA 3CCFA 3G5LA 2AVNA 2GPYA 5DX8A 3I58A 1XCJA 1X1AA 3CC8A 3LKDA 4IV0A 2YX1A 3ER9A 2EX4A 4LWPA 2G1PA 4YUZA 1L3IA 3HCEA 2G70A 1RI2A 4O29A 5E1MA 5EVJA 4YMHA 3UA4A 4DKJA 3I64A 3GIWA 4PIPA 3FYCA 4V0QA 3SVZA 2XYRA 3GNLA 3LDFA 3B3JA 3BZBA 4F84A 2O07A 7MHTA 1NW6A 5ICGA 4LECA 3NDJA 3G8BA 2IFTA 4QQNA 3EMBA 2IDKA 1QAMA 9MHTA 2AOUA 5C9ZA 3DOUA 3OU2A 4ER0A 5DTRA 8MHTA 3V97A 1HNNA 3UBTA 1WZNA 5DM1A 1QAQA 2FCAA 1KPIA 2P1DA 5GOZA 3RODA 5LQAA 3DH0A 4PGGA 4XUEA 5EEGA 3PFHA 2K4MA 4CTKA 3M6UA 1YFJA 1YZHA 2ONYA 3AY0A 5DRTA 3EGVA 1KP9A 2JJQA 2PY6A 2VS1A 1NKVA 3EVAA 5T6BA 1B42A 4RWZA 4ER6A 3KR0A 3I5UA 3FYDA 1P1CA 4P7JA 3LKZA 4F85A 4RTOA 3BKWA 4HGZA 1UFKA 2AOTB 5HIMA 3OE4A 5CCBA 1UWVA 2P35A 2ZWVA 3HP7A 2B78A 3G2MA 2AZTA 3HA5A 5GM2A 5ICEA 2B25A 4P7KA 2ZW9A 2BR3A 1I4WA 5K09A 3ME5A 1PRYA 4NECA 2FHPA 2P3LA 3UFBA 1TPYA 3ELYA 4GC9A 2P40A 2PXAA 2ZBPA 3OCJA 1KHHA 3G89A 4P7GA 3HCDA 2HMYB 3KR1A 1XCLA 3HVHA 3M70A 4IWNA 3CKKA 5FADA 5K0JA 3NJRA 5FULA 2IBTA 3FUXA 3FPJA 3M6WA 4IKPA 3ER8A 5F2OA 1DCTA 5DX1A 1ORIA 3DMGA 3TM4A 1Z3CA 3S68A 1QZZA 2PWPA 3P9NA 4B17A 2JH9A 3UJAA 3FUUA 3P2IA 4CTJA 1O54A 4OBWA 1FP1D 5LQUA 3HCBA 2ZTHA 4PYJA 3I53A 2H00A 3O4FA 5LQNA 3EVDA 1ZG3A 3GWZA 3HA3A 5DT2A 3VSEA 2XYQA 2ZSUA 3OU6A 1QAOA 5E2AA 3AWIA 3KHKA 3GRUA 1X1BA 3A7EA 2ZZNA 2BM8A 2E5WA 3SSNA 2XBMA 2YXLA 4WXHA 3UWPA 4RTSA 4MTLA 1EQAA 1KIAA 1NBHA 4AZWA 1X1DA 5DSTA 3UZUA 4PWYA 2P3QA 2GA9A 2PV0A 4HTFB 4EK9A 2O57A 5KQSA 4RV9A 1VP3A 3KQTA 2Z6UA 3H2BA 3V8VA 3B7PA 3NW9A 5HILA 5K8VA 3UJ7A 3LBYA 2XVAA 3VYWA 5DM4A 5K03A 2FPOA 5BP7A 2PT6A 3FUTA 5HFJA 3TPZA 3Q7EA 4C03A 4EVIA 3HVIA 5IH3A 2ONZA 3BGVA 3G8AA 1BKYA 5DXJA 5K0EA 2OO3A 2ERCA 3GRZA 4YV0A 2ESRA 2YR0A 4AX8A 2P7IA 1QANA 2QYOA 3M6XA 3SM3A 1NT2A 5G02A 2I7CA 3OFKA 4PYNA 3C3YA 5CD1A 1R8YA 4OQDA 4FSXA 4E2WA 1JG1A 1RJEA 3P97A 1YF3A 5LQRA 3ELUA 3OZRA 4QVGA 1EJ0A 2P3OA 5EKUA 2XVMA 1XVAA 4CKBA 3LCUA 2OXTA 1SKMA 2JHAA 4YUXA 5GM1A 5T67A 5JR3A 2BR4A 2YQZA 3K0BA 2Z6QA 3LCVB 4C07A 3BWYA 3QV2A 1ORHA 5GINE 1ZHFA 3C6MA 4H0NA 5DXAA 3R24A 2G72A 2NNWB 5K01A 4QDJA 2GB4A 3NVMB 5DWQA 2IDJA 5EC8A 4ER3A 2UZ4A 1M0EA 3PB3A 2CMHA 3CBGA 2GS9A 4RTQA 2PSSA 2AN5A 4PYIA 5F2KA 4E30A 5P8WA 5DSXA 3C6KA 3NDIA 1NW5A 1QYRA 3PX3A 3QOXA 1X1CA 1P1BA 5GIPE 4KIFA 4C05A 5K0FA 2I9KA 4KVZA 2AOTA 5HEKA 1R6AA 3HCCA 3MB5A 3KPUA 4KDRA 5DTMA 5E9QA 4BP3A 3SR4A 4PYKA 1FJXA 5FQNA 3R3HA 5ICFA 3E05A 5C0OE 4FR0A 3DXZA 3KPYA 4E2ZA 4XUCA 3A26A 2BR5A 2WK1A 3C0KA 4M37A 4R8SA 2QRVB 5F2NA 4X61A 5EZQA 1EIZA 1I9GA 2LD4A 3LPMA 1AF7A 2F8LA 3O7WA 3BKXA 1I1NA 1SVUA 3WSTA 4GOOD 2ZIEA 4P58A 2G71A 3A4TA 5EKXA 4GC5A 3THSA 2ZIFA 2R6ZA 3R9XB 3FZGA 5KQRA 5LR6A 3KQPA 1XDSA 5E1BA 3OZSA 3G2PA 4GOMD 2HNKA 5CVDA 2C7RA 1YFLA 1SUIA 2G8NA 3GDHA 5B1SA 4E70A 5M5BA 3IV6A 2OPBA 4CXMA 4AUKA 3UJCA 3U81A 10MHA 4DCMA 3R0QA 5U4XA 3T0IA 3EEOA 1JTEA 4X1OA 3LECA 3P9KA 1FBNA 1Q0SA 4HSGA 2Z6AA 2PLWA 4Y2HA 4CWAA 3EGIA 3GRVA 2HWKA 5EHIA 1AQJA 2PXXA 5KVAA 1KPHA 3I9FA 2ZVJA 1YB2A 4RVFA 5BW5A 3PVCA 2OKCA 4E2XA 2FK7A 1RI4A 1AQIA 3B3GA 1RJFA 5DM2A 4BLUA 2O05A 4OQEA 4X63A 3CVOA 3P9CA 1RI5A 4FGZA 3TR6A 4X41A 5KYGA 5D1HA 5CVJA 3FTCA 5E1OA 3PLAE 4ZTBA 3DXXA 5CIYA 3JWGA 1VBFA 3DR5A 4HH4A 1D2GA 1DUSA 4QQKA 3P71T 2JG3A 4C04A 4YUWA 3E8SA 4EKGA 1JSZA 3JWJA 3MTIA 2P41A 2YVLA 1F38A 1KYWA 2KW5A 3KQWA 1U2ZA 4F86A 2EJUA 3GO4A 4OA8A 4EKIA 1MJFA 3CJQA 4FP9A 2IPXA 3GGDA 3LSTA 2OB2A 4P7FA 1VL5A 1PJZA 2WA2A 4KWCA 2GAFA 2VDUE 4GEKA 5EPEA 5E9WA 2JHPA 2AN4A 3AJDA 3HCFA 2N47A 4GF5A 3GRYA 4FZVA 4YV1A 3NWEA 5BXYA 2O06A 2ZIGA 1XXLA 3EGEA 2C7OA 3EPPA 4HGYA 4Z2YA 4QVKA 5E1DA 3O31A 1VPTA 1FP2A 4V0RA 1WY7A 4EMSA 1XDZA 3MQ2A 4QDKA 3DULA 3GRRA 3HNRA 3BT7A 4RTRA 1KYZA 1JG2A 2OY0A 1AV6A 3R6TA 5DPMA
chains in the Genus database with same CATH superfamily
2Q9CA 1YBVA 5KNBA 1NTOA 4E5NA 3HJNA 1JQDA 3PFKA 4DQKA 1CQZA 1TW2A 1YKFA 4LVOA 4AYXA 3DBLA 3SYLA 4ERNA 1EEHA 3SKVA 5CEEA 1S2DA 4R1PA 3E7PA 2J87A 4XSHA 1E92A 5HTKA 3W6UA 7AT1A 3MVEA 1DP4A 4D41A 1SC1A 4C7KA 2JJMA 5I7EA 3DTTA 1K06A 3RASA 3C4QA 1Q7TA 3KD2A 3C5WP 2X1MA 1BC5A 1PYGA 3B6ZA 3UCXA 5KOYA 4IGAA 1T8RA 1UDCA 2GEKA 1K75A 2QW8A 2ZRPA 4K6GA 5FBVB 5JBIA 1PD1A 4Z7OB 2RCYA 3BM5A 4JQYA 2YS7A 1RPAA 5EIBC 5KNLA 4PNEA 2FJ0A 1ZGHA 1R9NA 3IDAA 3LQRA 4FFMA 3RUPA 3C14C 3K70B 2RKBA 4M8KA 1OJLA 1NJGA 5AVTA 3VNVA 1OI4A 1WKCA 4R41A 2YV4A 3AX6A 1B6RA 1FDOA 1OLXB 1PJSA 3NTXA 1G3RA 4F4HA 1BO6A 2O1XA 3EW9A 1KI7A 4KPYA 1HRDA 5JUWA 1ORRA 4M87A 4L7VA 3NAQA 3L0DA 4ZO9A 3IE1A 1M5TA 2PSEA 5KSOA 1WNFA 4MLPA 3VSDA 2H3HA 4ZI7F 4BV8A 4D3YA 1ZVMA 1PR2A 2CXSA 2E4XA 4FZ5A 4BECA 5F3WB 2E5LB 1HQKA 4O59O 4TS4A 4E5UA 5TE9A 1P7CA 3C3PA 2HDHA 5B36A 3GPBA 2I4LA 5CFLA 5J2TA 3H84A 1HG1A 1QK3A 4FGSA 4C06A 3PF8A 5FOXA 3RIEA 3NYRA 1F17A 3MINA 3KZNA 4HWKA 1B4DA 4IIJB 4NX2A 1ZSYA 2YXNA 3E81A 3RAFC 3ZWWA 1R10A 2WD8A 4UVGA 5KJ6A 2B4TO 2XCOA 3JATB 2XZOA 4CFZA 1CUVA 1PFVA 2R87A 1KOJA 2QENA 4BCBA 1DG3A 2P4HX 3FPGA 4GBED 4R05A 5ICMA 2HW8A 3L8GA 1YI8A 5AT1A 1YQDA 2FFHA 2BT4A 2MYPA 1GQSA 1NNSA 3P9XA 4OFBA 4XVHA 4ZOAA 4DJTA 1B43A 3ITKA 5A6VA 4XJTA 3WGLA 1QTQA 1IN6A 3N5CA 1HWYA 4GKVA 5F7ZA 4DLAA 2GAJA 1U9YA 4AY6A 3DLHA 4UUAA 1EDEA 4JA2A 2UYYA 1CX9B 4GRAA 3TQIA 2EW8A 4HB4A 4IIUA 3A4YA 3ISTA 3R3WA 1IUKA 5FEMA 1LDEA 5BQFA 5AVOA 2I03A 2DTXA 1W85A 1Z0KA 2PGLA 2Q0QA 1H9BA 2IVFA 5DLDA 3VU9A 5B6PA 1BCRA 1B0UA 3DMTA 1BYIA 3FB1A 2C2HA 3PUHA 1EK2A 4Q24A 3CRZA 5DBHX 1N6LA 1XEAA 2VHYA 5L8VA 3WJ1A 3QVXA 2R62A 1X19A 3AY3A 5HKAA 4A6XA 1CJBA 1MRNA 3MGGA 4JXKA 5J40A 3EYAA 3DV0B 4A8JB 5C8ZA 5K0NA 3G9QA 1GNLA 1YQGA 4US0R 5LLDA 3VYSB 1N0WA 4GI3A 3I1YA 4DIOA 5AVYA 3K6JA 4KG7A 4Y2TA 4XJXA 4D0SA 5KS2A 1S4MA 3LJKA 4PRYA 3VPBA 2B9EA 3WLNA 4GYJA 1JQJC 2PSDA 4M0EA 1T9DA 5CUQA 4X6XA 2XBLA 3ROEA 1P4GA 4DV7B 5FA8A 2W8ZA 4UBMA 3BCUA 3O4VA 3BF7A 5DN6A 4BJ1A 4C08A 2ZRGA 3HV0A 2B82A 1JFLA 5F5NA 1XJCA 3KQMA 4OXIA 1Z5UA 4HYQA 1EGMB 4YBZA 2R6R1 1FX1A 1P19A 3AEKB 1GNTA 4MIKA 3FPKA 5HRCA 1QG2A 3SQLA 2HSWA 3TFQA 5LP6C 1NR7A 2OM6A 2VQ3A 2PZ8A 4DDWA 4EF6A 1NP7A 2I22A 2NSDA 4OB6A 4EB8A 2XT9A 4M6WB 1JYSA 1DRWA 2P6MA 4U7WA 1TGYA 4QDUA 1DIBA 3ETCA 2RI6A 2FRDA 3E15A 2QJWA 3REQA 1F0PA 3RTEA 3WGTA 3G6KA 3LU1A 2MU1A 3TNDA 4UCWA 5G0SA 5IT5A 2F3SA 2BH2A 4C6TA 2OUIA 3BJIC 4DLKA 4AMBA 2AXEA 5IVIA 1QLJA 4Z9YA 3PTAA 1M8GA 3IB6A 1NV8A 4JJ4A 2PKQP 3QY0A 2PNFA 5CTJA 5CW1A 1JB9A 3L46A 5GJVC 4UHFA 4A10A 1COWA 1QO7A 1XZKA 4QJ4A 4YBRA 4TM7A 1YS4A 4TLEA 2FN7A 3N74A 2FK8A 3O6VA 1KZ4A 4JOCA 4UNSA 3OT5A 2O5RA 4AWBA 2H11A 4DUGD 4EJ6A 2HYIC 2WV9A 3ASYA 3IQFA 3RTGA 3VR5A 4BASA 4HS9A 4EVQA 4FFBB 5JFGA 3ADBA 1JDUA 4BZQA 5CX1B 2RHDA 3PT5A 5BT8A 2JK0A 1GD1O 3Q0IA 2QL6A 4FSDA 2QZZA 1G9TA 2XCIA 5I4IA 3MA0A 3BTOA 2WQ7A 1O9HA 2D6FA 4C4AA 1QE5A 4JBYA 1UZMA 4HXGA 3H19A 1XA0A 3BGDA 1QP8A 3K8ZA 1ZD4A 3ZHZA 2GF9A 4JLPA 1Q0RA 2HLDD 1N6KA 2P3SA 2QNRA 3QE2A 4TM8A 4DLNA 5C37A 4MQ4A 1G6KA 3GLIB 5JNWA 2Q3HA 2J45A 3HB4X 2AX4A 1EWTA 2AWOA 5DSZA 5JJ5A 4JLKA 1H9AA 3ES9A 3WSVA 2H51A 2KSQA 3GAAA 5MHTA 3K5PA 4MDFA 3P32A 3F8SA 1EMDA 3WFJA 1FX0A 1THMA 2Q6TA 3ER9A 4YUZA 4KI7A 1SXJB 1YDFA 2RH5A 3C3KA 5LA6B 4AJIA 4EZIA 2CB0A 1BDJA 3H4TA 3UJPA 3GHHA 3W5JA 1WEHA 4V0QA 4RABA 4DYDA 3SVLA 1M8PA 2NZVG 4RPHA 2JL1A 1JJVA 1N75A 1JNYA 4WVFA 1PVDA 5DP2A 2CD7A 1IMJA 1V7PC 2RGNC 2EFDB 4IUDS 5EA2A 1TYBE 1DAEA 4BO3A 2DR2A 4CG3A 1UR5A 1T9GR 4PY2A 4ZEXA 4ZQEA 3ZTWA 4D99A 9MHTA 1T35A 3MOGA 3AV3A 4IGFA 4R5HA 1N5RA 3CX7A 5PGMA 1T0HB 1AHHA 1GUBA 4EW2A 2IYVA 2R7LA 5A6SB 4B9AA 4ENSA 1I3CA 2P1DA 2C94A 3CWQA 2DHEA 3FMOB 1UJMA 2HA3A 4JLSA 4PLCA 2DFTA 1P1FA 3PFHA 1V45E 3Q7TA 3AOEA 5JLAA 4C29A 3ZHVA 3VHQA 2ORYA 1KP9A 3ACBA 3A2MA 4DMKA 4TKLA 1RHUA 2YV5A 5AK3A 5DH9A 3ONDA 2D8AA 2QPLA 4F9TA 1HDIA 3ML1A 3BGSA 4JY7A 5SZHB 1T1RA 2VWQA 2HH9A 2IA5A 2XB8A 2O2SA 5EXTA 2G0TA 4B73A 2B78A 1PI3A 1XRRA 3ROFA 5CB4A 1N2EA 1LWOA 5FA6A 3EGDA 3PDUA 3ZY2A 2PGDA 1LZLA 4RJIA 2BYTA 1IEVA 1FB5A 4NECA 1MJHA 1GV1A 5ALYA 4RF3A 1DDIA 5I7OA 3TQOA 3HB0A 1EWKA 2C2XA 4QM7A 5E4TA 3HR7A 1D7OA 4B8ZA 2XOKD 4GU5A 4PE5B 3ZWBA 2RG7A 4IWNA 3RU2A 5G1PA 3AHFA 3PI6A 4HS4A 3EQ9A 1RE0A 1XO1A 2QA5A 1DBPA 3BQNB 3IQIX 4IKPA 3PITA 4RH0A 1WULS 3D2BA 3E9ZA 5BUQA 5E9AA 3S68A 5CGZA 3Q40A 2YY5A 2GCNA 4IXMA 2QM0A 4I2NA 2P4EA 2X76A 4JL6A 1Z0IA 4XDYA 5E2IA 3R7WB 3WL7A 4BJ3A 5LQUA 3PIDA 3G0HA 1NUHA 1YKSA 3FSGD 3FXAA 1ZH0A 3OHSX 1H69A 1U0BB 1C7IA 4EG8A 4B3RB 1ZG3A 4OUKX 4WN3A 4EHDA 4QUDA 4K86A 3HZRA 3AWIA 5F4ZA 4J4BA 2Z3ZA 4KIUA 1DU4A 3GGSA 5HK9A 3SX2A 4OQLA 4UFNA 5C7OO 4FGJA 4D43A 1T8UA 4RF4A 1Z6GA 2JLRA 4LHEA 2J3EA 3N5KA 4BATA 1YI0A 1KYVA 4HPJB 4O4IB 5DSTA 2P0EA 2QTNA 2PV7A 1XWWA 2X8LA 3JQGA 3MHPA 1CUZA 1QS0A 1LDGA 2FPGA 2G4VA 2H7XA 2R1TA 1DCKA 3KQTA 5JD3A 5LMNB 4R1NA 2ABWA 2GBPA 3LO8A 3M2PA 4KNVA 3MWEB 4U2FA 1NWHA 3NEPX 1Y6RA 5FB3A 1NN3A 5IH3A 1EFAA 3G8AA 3PDIB 4RADA 4BQNA 3IT3A 2C0PA 1EGAA 4YJ2B 2RGDA 1T1EA 4YT4A 1EJBA 1ZM9A 3EPLA 1OB2A 2I6UA 1HDCA 3SM3A 4E21A 5IT4A 2P68A 5JIBA 4DA0A 1U8TA 2GNPA 2XVZA 3IR5A 3VKUA 4INZA 1J8YF 1LGYA 3DL4A 3P97A 4FJ0A 1YQQA 2C5EA 2Y1EA 2WI8A 4JBWA 3DBOB 1E1KA 1W9MA 3PZRA 3JAMA 4XPIB 4INJA 4OHBA 4FKBA 4MRMB 4BNNA 3O26A 1R0WA 4IDGA 1PGNA 4GX1A 5BUSA 2HNBA 4AJ2A 1P61B 3T41A 2QORA 2IYAA 1DKUA 2Z8YM 4DR6B 5F12A 5AVRA 2BDTA 3DD5A 4ZJUA 1GFSA 4HGQA 3DPIA 4IDDA 1FFCA 4AM8A 3R7FA 3QSYA 3A9SA 2UZ4A 3HFSA 2FWJA 2IDJA 4MMYB 4RTQA 4M0UA 2F1HA 3WLAA 5KU1A 3AR7A 5J58A 1J33A 4LMBA 2OT3B 1PWYE 3AHIA 1CUYA 1NXQA 1Q15A 2B2XA 3IFSA 1X1CA 4MV5A 2C2GA 4FBGA 3RROA 1T3ZA 6CHYA 4FN5A 4EB0A 1Q1GA 4BQEA 1F20A 2X6TA 3UV6A 5IZCC 3W5DA 3FNBA 1R6AA 3HCCA 3KPUA 1R9MA 1TKAA 1I2DA 4ES6A 3S4YA 3DFMA 3B52X 1KMNA 3LG2A 1UXKA 2ZUBA 5LZ5A 2HEIA 3NUGA 3TW8B 2GBFA 5B3JC 1FTSA 3O84A 4E4YA 5F2NA 4E3WA 4K26A 4N7MA 4W9RA 4GLJA 3OCZA 1RZRD 2GZMA 4OGKA 1V71A 4ZDWA 4KJXA 1DEKA 2ZCVA 3FDZB 4PZAA 3GBPA 4Q1VA 3BTSA 4W5QA 3MD9A 3BGOS 2WT9A 4LRTB 5C31A 2ZAGA 2G0NA 2H4ZA 5EKXA 1H05A 1SBZA 2R6ZA 4PHHA 5K99A 1XDSA 1FFWA 4H60A 2FSIA 1GPBA 4BKMA 5F9FA 4DN6A 1DJOA 5B1SA 3TVDA 2FX2A 5F76A 3VZBA 1YK1A 4DPLA 2XCSB 4R0VA 3QEJA 1Z25A 1ZOLA 2R7NA 2ID7A 4XCVA 3R0QA 1KVRA 3DWFA 3H83A 3UUEA 4OQYA 1Q0SA 3IRVA 4IOKA 3VR6H 2A6PA 3CUSA 1G5HA 3H2GA 4HDNA 4OK5A 3ZWPA 5BWLA 2PXXA 3K96A 4K9KA 4B79A 2CT8A 1DHTA 3K73O 1MT3A 5T8KA 4TWJA 1QVVA 2IXTA 4QOIA 1EFHA 1UBGA 5DNEA 3TZKA 1LK5A 1S7CA 2DQYA 1MOSA 3BFJA 5HF8A 2UUOA 1W73A 1KDVA 2FWBA 1SURA 1YULA 2JA2A 3GPIA 3BN3A 2DB3A 1PR1A 5DHTA 3R0XA 1NMSA 2FSVC 3I2FA 1AY0A 1SJ9A 2RGRA 3DVAA 3UC5A 3BA6A 1KH1A 4M1YA 4NWIA 2C9MA 3GYBA 3AHCA 4XYMA 1KC3A 1A1SA 3L8MA 4MUBA 1T2VA 1WR8A 2MSKA 3BG5A 4YQEA 2P41A 2X0KA 2ZYIA 3UBMA 2BE7A 1DOHA 3SC6A 4BQFA 1J09A 2WT8A 4HNVA 1DKRA 2XMSA 1SOVA 3OJWA 4D44A 4ENUA 5AVZA 1IZ7A 5JS8A 5BMVB 2YUTA 1YQWA 2ZYDA 1C3OB 5ILQA 1DWOA 4WE3A 4NFHA 3MSCA 3DV9A 2OCYC 4Y7DA 2DTDA 3FOAA 3RS0A 5J1SB 4L0QA 1AVTA 4XVQA 4JEMA 1GO2A 1D1TA 2YIVX 5FOUA 3MWKA 1NBOA 4RANA 3ZX5A 1RWBA 2JD0A 1WY7A 3WNDA 1XDZA 5CHYA 1ANKA 4EYKA 2IOQA 4FEGA 3UV3A 1FC0A 5KPJA 3E35A 2M32A 4L2IB 4OQPA 3RVQA 3STHA 1JEEA 4Y2UA 4K6MA 2C99A 5HG0A 3A1UA 2WJ3A 1N7IA 4WPGA 4KHZA 5EZSA 4CIAA 3OF5A 2I6SA 1I9CA 1BFDA 2IEZA 2XUIA 2ZI7A 3ZDZB 1NDUA 2AOVA 1N6NA 3ND8A 4OL0A 5E2BA 4X54A 5C7YA 4G0WA 3Q7PA 1V7QA 1CSEE 4RJ2A 5CM2Z 2Q3CA 2I2XB 3L9XA 4G0PA 4HUQA 1OE0A 2I8CA 1HQCA 1T3SA 4E2YA 4CL0A 1W2HA 3I0ZA 4H6WA 3CXRA 3NB0A 5HKOA 2C83A 2RK4A 2UVQA 1GAXA 1GAWA 2RHHA 3O8OA 4V3BA 4CIYA 3G2QA 5FIUA 1WXQA 4WEOA 4XH9B 3PXEA 4Z4QA 1Z07A 3G2OA 3ZVNA 5HF5A 1R00A 3IQEA 2F1KA 4Z6KA 3E0QA 1O4WA 2B94A 2WFZA 3IDOA 5LDGA 5HA5A 5E3HA 5CNIA 2IDMA 3FNGA 3U09A 4L0CA 1U0EA 4OGLA 2C00A 1VP9A 2GJ9A 3CLRC 1YA4A 3Q3VA 1GZUA 4XR9A 5EN4A 2YWDA 4AJ9A 4EB6B 3O82A 4CI9A 1QP0A 3O1HB 4MHTA 4ZRDA 2JD1A 2VJLA 4V02A 1YC2A 3EXFB 1HTBA 2GTIA 4RVCA 5BO5A 1H65A 2RAFA 4URXR 3PGXA 3WK9A 4WFIA 3WGGA 4MQ5A 1E8DA 2BMAA 2JLCA 4FI3F 4ZU3A 2O8DB 4V0LA 1TX4B 5C2JB 3OIWA 3VTFA 2ZUDA 4GBJA 1GP2A 1OYWA 2OXRA 3ORYA 2Q9BA 3FH0A 2VHQA 2IBSA 4BAUA 3DVLA 4W7SA 4XLLA 1NMQA 1GEGA 2IXAA 3LY9A 5K0BA 2VNSA 5ILGA 3JRWA 4FVTA 4K1XA 2OP1A 4HWSA 4MHOA 3CF0A 5JNSA 3X1WA 1RYYA 1J22A 1RIIA 2E4UA 3KSDO 1WCV1 1Z0UA 5IJXA 3G88A 3LA8A 4NXNB 3LF2A 3RUDA 1RXCA 1XMPA 2X1VA 4AKTA 1O6BA 4GXQA 5EJ5A 2QF7A 2WOOA 1Y6GA 1O77A 2PL5A 3GGCA 1AJEA 1SU7A 1TMOA 1YNSA 2GD0A 4YGXB 2VPYA 3ANXA 1OFHA 3RW9A 2LUOA 3UGQA 4DQ0A 2CF5A 2H18A 3C2QA 3SZOA 2N46A 5BY2A 1MRSA 1QIFA 5AW2A 3CLSD 1Y7TA 1Z73A 2XGGA 1T2UA 1XCGB 3F78A 4CDGA 2PWBA 1MBZA 2H65A 4RF2A 3OQBA 5JNVA 1BOOA 3ZDAA 3CNLA 1TD9A 2OECA 3CV3A 1JH9A 2E7ZA 1CW2B 4OGGA 3QWHA 4MA4A 3WLOA 5KJ1A 3EVZA 1E1QA 3LHFA 1KY4A 4J0FA 5FLEX 3VKWA 5HP4A 1DTWB 2IY9A 2PKWA 3NIWA 3NC4A 3PQ8A 4ZOBA 4CDNA 2GGSA 3AUYA 1LLFA 1SHTX 2BSXA 2VP0A 3FI0A 1DBIA 4OJTA 3SJUA 4EH1A 4RVUA 1EZ1A 4DSOA 3KSZO 3D1JA 4PG8A 3ZWNA 1JNXX 1NZJA 1E9FA 4DIFA 5BSKA 5U1PA 3GBSA 3D4PA 1PFQA 4QNRA 1UKAA 3CRMA 2GNOA 4MUMA 3KPJA 2F2TA 3BVPA 2VJAA 3NRCA 2H8KA 3SXUA 3ZGXA 2YDYA 4XWKA 4XASA 3RTCA 1QF6A 1MLDA 4A23A 4HJXA 2BEUA 3DOOA 4IVQA 2J3IA 4MIEA 1Z33A 4RDCA 1U99A 4G8DA 1WBJB 3P8ZA 1NF8A 1Y1KE 2IL1A 3L6EA 1TLLA 4BEJA 1HDOA 3EF3A 2ZSJA 3M3DA 1S2LA 1Z12A 3FUVA 2QL5A 1GT91 2VUUA 4ZV9A 2RDMA 2P9BA 3LGAA 2B4YA 2ZFUA 4YRMA 1KEUA 2I6XA 3ZHUA 4LZAA 4KQGA 2DF8A 1GM5A 2PSJA 1IHDA 1L7QA 3FMFA 2UDPA 4FZJA 1EKXA 2XOEA 4MKRA 1FFHA 1C4KA 4EUFA 4GPIB 4YLYA 4JV5B 3UK6A 4QFCA 4G67A 1ORWA 1LH0A 3GUVA 4BP1A 3M7IA 3BSSA 3L18A 4MGKR 4BWYA 5IKXA 2ERXA 2V9PA 1NXOA 1CY6A 3QITA 1AU9A 1JR6A 2V7VA 1T8YA 4S2EA 3K30A 3DOJA 3FYSA 2WKPA 3BF8A 2B0CA 3MJDA 3NANA 3TTVA 3WNCA 1FFSA 4PF1A 1AKMA 4YLGA 1E9VA 1IOZA 4HDKA 5JSYA 2BGIA 1VSBA 3ZIAD 1NXWA 4YS6A 4WZBB 2B83A 2LTAA 1GUYA 3IAHA 4HN9A 2OZVA 1OLUA 4B3XA 3EDCA 3CCBA 1EZZA 5BSTA 2BGGA 2H1SA 3L6OO 4CLRA 1XEWX 4OI0A 4ZI3A 3BH6A 4GLLA 1XF1A 2W4IA 3K53A 1HMYA 1M6YA 2XKBA 3T3HA 2SKDA 1QG4A 4WVLA 5AR1A 4BVFA 4D3DA 1EHCA 4G81A 1WP4A 1ST2A 4P4GA 3IIIA 4R71A 3WGZA 2X6QA 1P18A 2H1CA 2QD3A 1NKSA 1DAFA 4BNYA 5A4AA 3WLEA 2EKLA 1REQA 1LQUA 1XC7A 2DOKA 2H1LA 1C3EA 2WSSA 3ICOA 2I6TA 2Q8QA 4Y6SA 1H0KA 4FYJA 1QS0B 4WJKB 1P7ZA 1PK8A 4PZZA 4IOMA 1E2KA 4FYXA 3OY7A 4QE3A 1L4MA 3DE2X 3I72A 3QEMA 1Z45A 5JHGB 5J5AA 2ZWPA 1I4OA 4UQOA 3GJ4A 2JFGA 1M1NA 4Y0VA 3N2ZB 1YUMA 4AZ0B 3R5JA 3K1JA 4W1RA 3T7TA 3ZX4A 3W7BA 4RY8A 2GPTA 1Q0TA 3N8GA 4E07A 2VPXA 3AHJA 3IEKA 1ZXBA 2ZR8A 3BCRA 4LRUA 4S1PA 5AI5A 3Q1LA 4IV0A 1CY4A 5FAXA 2HV8A 4GIBA 1E0SA 4Z8XA 3EPHA 4X84A 1ZLXA 3FCAA 4IMPA 3SEAA 2WJJA 3VZDA 3CE6A 1TEVA 3I64A 3HJAA 2UYGA 1ZL2A 3M5WA 4I14A 4AJOA 3ZHRA 5AIBA 3RF7A 3GA0A 4LK3A 2OHHA 3QXJA 3AUSA 5D3MA 3B3JA 1WPGA 4P86A 3G59A 4M1MA 2O07A 2QZPA 1WF3A 3EZXA 3R7AA 3I92A 1KAHA 4MB0A 3OZUA 1FXWF 5BN4A 3VNAA 1KDZA 2H0AA 1SIUA 2DX7A 2R48A 2XTNA 4Q4LA 5AKEA 5ERXA 4B80A 1ODTC 1OV6A 4HXYA 4M9QA 4AN1A 5FX2A 5KNDD 1GZ5A 4NAUA 4G36A 3AOGA 4INOA 3SDBA 4TVKA 2I3ZA 5LQMA 3ZXUB 2W5UA 1K9SA 1FFXA 3RKSA 4MI9A 4PLVA 3NFYA 1FUUA 4XUEA 3T4EA 1SUPA 4ZDIA 4BO1A 1YTUA 4AJHA 4M21A 2X7HA 1F8UA 3AY0A 3GJ7A 4JU9A 4RKYA 4U6SA 4GEGA 1OYVA 4U7HA 3TIFA 3W2IA 4A27A 5JQWA 3AEXA 1BHSA 1P80A 4HV4A 4JC8A 4B6FA 1PQYA 2LXNA 4WNAB 4C7VA 3T7IA 1XHLA 2FGKA 3LKZA 3TZHA 2B5OA 3G2IA 3OE4A 3PRYA 5AM0A 5CCBA 3QX9A 1UWVA 1W76A 1G7SA 2W48A 3M81A 2UZ3A 1KDPA 3HP7A 4W1SA 1SR8A 1PBTA 1Z62A 2YWEA 3DKVA 1C8LA 3G9XA 4P7KA 4QUKA 4KQ1A 5K09A 1RXSA 3WV4A 1F2TB 2DHDA 5K4AA 2HA2A 3OOEA 3HBNA 1XD2B 3FJ1A 3B82A 1UCFA 5M7EA 1I51A 1JA9A 2C3UA 2ZUSA 3K94A 4X0EA 4YACA 2OQIA 4UUNA 4M9XA 1A2BA 3RK1A 3UMVA 3SS8A 2KHZA 2G88A 4AMYA 3B2EA 4JD5A 3IURA 4O4IF 4Q1EA 4Q9KA 2GKOA 2OHJA 3M6WA 4X91A 5KNCH 4N76A 1GQQA 2IW3A 5BPFA 5IS2A 4ZAXA 2OD9A 5L3QA 1GLGA 2XUPA 1Y8AA 2JH9A 2XWJI 3KOMA 3TRJA 1UZUA 1NRJB 2JCBA 1BJTA 1E6WA 3OWOA 4KVFA 2D2FA 4YJ2F 3ST7A 1F12A 2CGEA 3I53A 1E6EA 5KUTA 3HJGA 3HA3A 2FEWB 3OJLA 1E2GA 5CYPA 5J47A 1XDGA 1Q2UA 5A4JA 3FROA 1C1DB 4NBTA 3FCCA 5D85A 2E5WA 2VSFA 3HBMA 1LS1A 1XQ6A 3SS7X 5A0FA 5BMVF 1KIAA 2KBEA 1MG0A 2Z1DA 4L9SA 4MR8B 2AT1A 4LJLA 3SYNA 2F8TA 3DNMA 4KSBA 1OPXA 1TA4A 1L6RA 1PQ4A 3QVJA 4OFXA 3S27A 4BC0A 3FWZA 1ZJZA 3LBYA 4A0FA 2HT1A 1KJIA 2VK1A 4KK3A 3F98A 2HI0A 3L7AA 4OOEA 5FOTA 1BWQA 4TWIA 4BX3A 3C3WA 2G09A 1U1GA 2AN9A 1D5WA 4X1IA 4B4UA 1ENYA 1IN8A 3AR4A 1H8ED 1I5OA 3EG5A 4J16C 4JROA 3WLTA 4AJ4A 4AX8A 4IR7A 3J80A 1MA0A 1ST3A 4PHFA 3JW8A 5KTNA 4LNUB 1MX5A 1QX4A 2C57A 3WLPA 1EI9A 4FBMA 3MZ0A 4OQDA 5CPBA 3WO0A 3GFGA 3MC1A 1SIBE 1C9JA 4C7OA 3CRVA 3OT1B 1QYXA 1R6UA 2XVMA 1ZAKA 5K20A 1OHHD 3I3SR 1D2NA 1JHUA 3PK0A 2XWSA 3LGSA 4G1EB 2YQZA 4ZOCA 2C5HA 2CW5A 3OPYB 3THOA 1ORHA 2PBLA 1PL6A 3MMZA 3W5UA 4DV6B 2CK3A 1STOA 2QRPA 2P1RA 5DI3B 3ZQUA 1ZIPA 4B0OA 3N0VA 5JAPA 5K01A 3ND5A 3FLMA 3IJRA 2YN0A 4YB8A 4ANFA 4YXWD 1B0PA 3LC2O 1R3DA 2E6KA 4LJYA 2ZJ7A 4PYIA 2XCQA 2CEKA 4KLRA 4TL8A 3OLQA 2EFCB 4BQOA 2ZJOA 4M60A 9ABPA 2W2KB 1NJ5A 4EKYA 2J4DA 4O6VA 5CJ2A 1JVBA 2XCUA 1CRWG 4N40A 4N1AA 1HYQA 1L0BA 5K0FA 2Q3JA 4NU5A 1SUBA 3MB5A 4KCGA 1G7CA 3S7TA 4JQZA 1GRVA 4FMDB 1W5SA 1VB3A 4DIEA 1JBKA 3DMRA 3HJRA 3NAMA 4ZO4A 4E2ZA 5J4HA 1SGWA 3QJ5A 1ULSA 2HLNA 1HE2A 3IMCA 1NRIA 3QVSA 4BFXA 1NUPA 3SNKA 4CM9D 3D7LA 3L8ZA 4GOOD 3G7SA 3JTMA 4RL6A 3EXFA 3M5CA 3A9RA 5EYPA 3BXHA 3A4TA 1XGKA 5KTTA 4TL6A 1Z6ZA 3MUOA 4B3SB 5CNKA 3IIMA 2H4FA 4B4KA 3WRWA 3G2PA 3U4CA 4MRVA 3EEQA 5HF6A 2ZQYA 4ZZIA 4DIBA 4C4ZA 2OPBA 4HZGA 4L27A 3AESB 5HQ3B 1MQ9A 4NDNE 1U7OA 3BCHA 5LDDC 3ZK9A 3M1LA 4B3DA 1UMDA 1N2SA 5EXXA 1T5BA 2BFCB 2QQ5A 3QKTA 1FSPA 4M76B 4RM2A 4BMOB 2ZRLA 1ZA1A 1EFVA 5LWQA 1OD6A 1JIIA 4RVFA 3DO8A 2JANA 2PUDA 1QV6A 1A88A 1X0XA 3N59A 4L8VA 4LZZA 3IKTA 3U56A 1P5HA 2VYND 1Q0LA 1EVIA 4COOA 3QVVA 2VWPA 1C81A 4WK0B 5TPZA 4HPWA 5CXQA 1KQ3A 1Z38A 2PWZA 3OOJA 3QLVA 1EK5A 5DCUA 4QDXA 3ADCA 2WSBA 3CMMA 1AHIA 4HNHA 2HYDA 5DGIA 2JF0A 2TMGA 3C3DA 5DHFA 3ZGYA 2BI8A 3A1EA 3O4JA 3AG5A 2NWQA 4MULA 4OKNA 1YQXA 2YVLA 2KW5A 4JXXA 1W25A 3IC5A 1AN9A 1XVIA 3HKCB 3I76A 4QJIA 5CDYA 2CDAA 1SELA 1GTJ1 1SUDA 3CZQA 4N8DA 4HB2A 1FBTA 4OUDB 1Z5VA 4TWRA 2X2PA 2Y71A 1E2HA 3C3BA 3LSTA 3MLEA 4H08A 3GXBA 3NP7A 3QE3A 1OKKA 5JO9A 1N2CE 3DR3A 4ZREA 2AI2A 2Q1SA 2Z98A 1XTQA 3VO9A 2FW9A 2H2DA 3EN0A 1GA6A 5A03A 2O06A 5H4HA 3ETJA 1ZJWA 5DHAA 1FU4A 1UBNA 3E5MA 1YH3A 3AF4A 5JCZA 2N1MA 3HXMA 3MQ2A 1DUIA 5JI2E 3HNRA 2D0PB 1AM4D 1CP2A 3DZHA 3EXHC 1JG2A 3HR8A 1ULAA 1ESEA 5DPMA 1BN6A 4ZPXA 3ED5A 1M2OB 1WB5A 3GJTA 4IRMA 3SHVA 1XLVA 2DR3A 4ENPA 1Y1QA 3WIVA 3OWXA 4BFZA 2HJSA 2QN8A 2VPZA 3CX4A 1R6TA 2JBHA 3W5VA 3AL0C 4YA6A 4F3TA 2R6JA 5KB3A 4HDMB 5IDVA 2O8BA 1XDUA 4L07A 4X62B 2GD6A 4CMCA 3LX6A 3K72B 3HLKA 2QW1A 1KJYA 1SKYB 1CUXA 2XE8A 2A9QA 2JNWA 5TB5A 2VP3A 2PUTA 4O5OA 3WYBA 4E31A 4M88A 4CKEA 2F1OA 4PSUA 5JLJA 4HGOA 4AFNA 2PRSA 5DTQA 2VT3A 3VVBA 3ZE8A 3TNYA 4F4JA 2HX1A 3GVPA 4YDRA 4FT4A 2ORVA 2CNWD 3HYCA 5CHEA 1AK2A 5BSUA 1NULA 1UXJA 3PEEA 2CLLB 4UCXA 1HF3A 5I6DA 1QHHB 3N9IA 3KV1A 2W6MA 3R7LA 1YVDA 3V8BA 4M55A 1Y8CA 2DGDA 2EV9A 2GUWA 3OM8A 4P1ZA 1Y4UA 5AHWA 3QKSA 2NTJA 2QU7A 3DWIA 3W06A 3M33A 5F1KA 3DVRX 3HP1A 3KSAC 3OETA 1Z8FA 3TSZA 2JIZD 3PKJA 4H77A 3SX0A 3ZUPA 3IIJA 4U5QA 5DIZA 2IHUA 2NU9B 3CH5A 3HGMA 1VRWA 2PUHA 3O21A 4N8SA 2B3TA 3COPA 4RY9A 4JP5A 1NUTA 1FUEA 1NBIA 3HM2A 3W1WA 4AIRA 1FYWA 3I2KA 3CLUD 4FHFA 1I2ZA 1I36A 1SBCA 5KJCA 1U04A 2NO7A 1Z15A 1RI1A 4L5IA 3T3NA 4IRXA 5F4BA 4Q9HA 1MAUA 3AJRA 3R5FA 2WZCA 4R8LA 5D1NA 3V4ZA 3UCFA 3AR5A 4AK9A 1UXHA 2FG5A 2YW9A 2Z4SA 2A0YA 1FLAA 2EYQA 3IO5A 3NOOA 4Y30A 2P6OA 1R16A 1X13A 1WHTA 2AKAB 4H7DA 4ZU1X 2NV6A 1E98A 1DC4A 1EPUA 4CM3A 3FFWA 4WJZA 5EJ6A 1L5FA 2W70A 5JRJA 2J32A 1HKUA 1U94A 2IYTA 3IULA 4PZDA 4XQGA 3KJIA 2O2XA 2VSNA 3W7AA 4W9MC 3NZEA 1HGXA 3TSAA 1AKTA 3LZCA 3TM5A 1ZI6A 2XDQB 4Q9JA 3R8XA 2HSDA 2AX3A 4BS9A 2B8WA 4CLEA 1OXSC 3FWKA 1XQYA 2A84A 1WXXA 3EDRA 3GCDA 1TQHA 4CGYA 2RGEA 3FZYA 1FDTA 1ZZEA 2HB6A 4JI3B 5MDHA 1UPFA 4LTNA 1QQTA 5ALGA 5EUQB 1FJGB 2JGNA 1PVVA 2OFOA 2VKTA 4BVBA 1L5OA 3JQQA 4RAQA 2ZXUA 3Q3HA 3U4QA 1XA4A 1YRAA 2FWRA 3CSSA 3G2JA 3JZMA 4CF4A 1RQNA 2B1QA 2NUPA 4W82A 3CLTC 4WADA 4GW3A 3N8IA 5ESXA 1GGNA 4PCLA 2R9VA 1XFDA 3HDGA 5GV7A 4BFYA 2G1UA 4ZARA 3W5BA 5AI4A 1LC0A 4F2WA 5CCXA 4KQEA 1XCOA 2W7TA 3JVIA 1GZSA 1NVGA 1RIFA 3D8BA 5CVTA 3USCS 3H13A 1YU9A 2G40A 3D5QA 5BVHB 1OWOA 4NZ9A 3PX2A 1UJ6A 4PIMA 3CTPA 2RGBA 4H15A 3THYA 4EFMA 1HR0B 1N1MA 4I46A 1BWSA 1N9GB 5JBQA 2PA3A 2QNBA 5CLFA 3NIDB 2DTEA 1T91A 3C7KA 3VOTA 1MIOA 2Q4RA 3NTOA 3IAEA 4LQDA 3DJFA 3VH3A 2H3EA 2EJBA 4E03A 1RQ2A 1W0CA 4GOND 2QY6A 4R9SA 2C4VA 1FVHA 1EDBA 1L4HA 3PC2A 3INNA 2XMBA 1GGFA 4D80A 3DAGA 1E5TA 3BWXA 1W47A 3WBFA 4BMZA 2MSLA 2NQ8A 3R9KA 1FDSA 2E4YA 2VSQA 2C61A 3OT1A 1A4UA 2BGMA 4XGKA 2I2AA 1JAXA 2A5GA 2GAAA 4ZCIA 4KMMA 4OQQA 5IJ9A 3AKZA 3AFIA 3N6XA 4L76A 2H6EA 3DDZX 1MFZA 1BH6A 1Z4LA 4HX5A 4L3WA 4KQHA 3W6OA 1HY3A 1IUPA 1JTFA 4C3UA 4PLFA 3UYLA 3ONEA 1Z0ZA 5EXSA 4CIBA 4HQ6A 4RL4A 4MUEA 2P6PA 1OYYA 3G79A 1AGYA 3QKRA 1JAZA 5CPFA 1U3UA 1BHJA 2R6GA 5TS2A 2IYFA 4GZ5A 4JLWA 1VKHA 3VI4B 4R9VA 5KOJB 2QRLA 1O9BA 2ZSHA 1EXNA 3N2LA 1E77A 1I10A 2MSWA 2OQRA 2YXEA 4JI6B 5I7WA 4RHTA 1ABBA 1NLZA 2E6UX 4H3HB 1Z6YA 3LUAA 1NSYA 4ASUA 1FUKA 1QCZA 5KMGB 4RGVA 2PWYA 4PC3A 2NYRA 2CKDA 3F0TA 3LCMA 1XYYA 1RRPA 2DY1A 2PQ6A 3MYRA 3PJEA 2AMFA 2Y8EA 4M9UA 5JOQA 1GZ6A 3UJ8A 1ZQ9A 4XUGB 3SQDA 3MT9A 1QCYA 1TTPB 3DZ8A 1A95A 3F47A 3R09A 4H0CA 4R2XA 3HJFA 1K8QA 3M4YA 1CUAA 1K3FA 1SQGA 1WUKS 2XUOA 2ZCJA 2IXBA 4HG2A 1ZD1A 4L9WA 5CA1B 4TXNA 4DB2A 1J4AA 2OCLA 1V35A 1N9KA 1QF9A 3L0BA 5AI0A 3G3EA 5LNK1 1ZUD1 1E2IA 5HSGA 3EG9B 4ND1A 2JFYA 3EW7A 1Y5MA 2QTBA 1P45A 3DEKA 5DWVA 3G8DA 2IV3A 3RYFA 4GZMA 3ET4A 2FWNA 2DEUA 3BMNB 1FK8A 3LHDA 2OAEA 2R8YA 3KQVA 4JNCA 3S7ZA 4ZZ0A 2X0NA 2R0QC 2CCGA 4TKMA 1WKVA 1X15A 2G5PA 3F73A 1UEIA 4I3GA 5DNVA 1Q0QA 2CDRA 1FMCA 3EIQA 1NVVR 2AV6A 4P08A 2OMKA 3TDKA 1EESA 1PNRA 3RKUA 4FNOA 4KZPA 2R79A 1LVHA 1EGQA 2EDAA 2R8XA 3G5LA 2G7ZA 4Q9LA 2VZEA 5T57A 2R44A 2YV3A 2PX3A 2AJLI 4O63O 2QUBA 3PIRA 2WVHA 3TIGA 2VNJA 2FX3A 2AMJA 4GO1A 4Z7NB 4YO8A 1L3IA 2DQ4A 1F48A 2QROA 3HCEA 1BVYF 2FZCA 2CJFA 2ZE7A 3ABRB 4UU1A 3HMQA 1ZWLA 2WHEA 3IDSA 3S1SA 1X2EA 1YZFA 3SVZA 3LV8A 1NDQA 4FFVA 4Y2VA 1AGRA 2R7MA 1U7UA 3STVA 2FPUA 2QIPA 1OI2A 3GG2A 1WSAA 2ZSEA 3G0IA 4GR5A 4WUTA 5FWXA 1SBNE 4A5SA 1COZA 5AIAA 4DNQA 3NCTA 4CM5A 2AOUA 1OXUA 2XSZA 4TT8A 1EFDN 3DOUA 2IU0A 5F9HA 3F6RA 1QIHA 1W1WA 4EA6A 3S3TA 1E2DA 3O91A 2HMAA 3LP5A 3KAPA 2NN3C 3DUFB 3UUGA 3P27A 2Q6LA 1G5FA 1EYZA 1U7WA 2BH9A 3EODA 4GGMX 3TEMA 3WI7A 3LVQE 4FB5A 4C20A 1OWMA 2C1EA 2O8FB 4S1VA 3WZ2A 2HDWA 2Q3FA 3A1WA 3T9BA 4O8CA 1B42A 4DXDA 4CKYA 1P7YA 1X2BA 3H3XA 3U31A 4CQLA 4B5LA 3VVCA 1A27A 2WSIA 2EZ8A 4DNFA 2G6TA 3FVVA 4BDTA 4BNGA 1H93A 5ESRA 4B4VA 4TGLA 2A33A 4QJ3A 2ZK7A 4EG3A 2P35A 1BQEA 4AS1A 2C04A 4PAWA 1G5RA 4LFCB 2VWHA 2NU8A 2IS2A 2AJTA 1RW4A 1YCGA 2OLKA 3GIDA 5C51B 3OECA 3QUBA 2IYEA 3HN6A 1I1OA 4CE6A 2DMRA 3MWEA 4R01A 3TGPA 3U16A 4G0QA 2O2HA 4QASA 5LB4A 3I1JA 4IX1A 3RK4A 3WK5A 3PEUA 5GVRA 5IDWA 4HXFB 5JVDF 1EVQA 3Q0EA 3SHQA 3IP3A 1DRKA 1TB4A 2ALJA 3JQGB 5BN1A 5IHPA 4KUHA 1PK7A 5K0JA 2IBTA 2AKYA 5K8UA 1V6SA 3QW4B 4OHCA 2YHAA 4OL9A 1A9PA 4N5LA 2BKUA 1LKZA 1Z06A 1EX9A 1ORIA 2D1SA 5DX1A 3RU7A 4URYR 2V4UA 3T1HB 1XOIA 1SCKA 2HA7A 5DISB 5FYDA 3I32A 1TVMA 3UJAA 3IQZA 2P9EA 3OLXA 2ZUEA 1Y1LA 1XTJA 4P4SA 5KNCA 3OG9A 4FMCF 2YC2C 2BWJA 4RMJA 2ZWOA 1CDDA 1N1GA 2N9UA 3BJMA 3M4ZA 6NULA 3R0JA 3B12A 3BD7A 3EXHA 3HYSA 1TA9A 4OQMA 1G16A 2ZETA 1ZC4A 2DVMA 1C4OA 3KIPA 4QA9A 3SSNA 3ZK8A 4EG0A 1H6DA 3X2FA 4UM7A 2ERYA 2H7YA 2IPNA 1NBHA 3KTDA 1XTUA 4P3NA 5FBWB 5K3BA 5F23A 4BIIA 2PS9A 2CZGA 4XIJA 4CW7A 2FN4A 1P0CA 3UFXB 1ICEA 4Q3LA 2H0RA 1QM5A 3ECCA 3DQZA 3NAZA 4MR7A 3V8VA 4YFYA 4RHEA 3GUUA 3QBEA 4Q3AA 5FI1B 2II6A 4PAMA 2EGGA 5DM4A 5FT9A 3ZDRA 4C03A 3VNUA 3NUZA 4MYRA 1BKYA 1O2DA 4ASUD 1EM8B 1NOJA 2OXIA 1TZCA 3QTBA 4IZIA 5FOVA 3WYGA 3T9DA 4ZN6A 1PR5A 5A5VA 5KWVA 3PXUA 1E3TA 1II0A 1XDBA 1HO3A 5HNKA 2ECQA 4YRBA 2GBIA 4H7HA 1U3DA 5G02A 3QE0A 2J3DA 3H17A 1OH7A 4QU0A 1Q1QA 1XZHA 3W1EA 1Q17A 4ZD6A 1YQUA 4O0MA 2WWIA 3CW9A 1XKTA 4JBHA 4MGIR 1Z4NA 1F8FA 1ZL0A 2ATEA 1C0IA 5AJYA 4QVGA 5B30A 4PLZA 5BWBA 3O4IA 4YROA 1MP0A 1ZM2A 3IUYA 3JWEA 3CZ9A 5EKUA 2HFKA 4CKBA 1LTQA 1NP3A 1LV8A 1X7WB 3B8HA 4YUXA 4AG6A 3HCRA 1IIBA 3LZDA 3L8YA 4N01A 1HDGO 3R20A 4UUQA 4OYYA 1SCDA 3BORA 3T3OA 2XR1A 1LSSA 4K0KB 1LNSA 4I9GA 3Q8LA 5L7WA 1QZXA 1LA2A 2WILA 2WHPB 3KKLA 4IPTA 4MQEA 3W6ZA 4EHBA 3D1VA 4R98A 2GB4A 5DWQA 4E94A 4NEHB 3C98A 3LOUA 4KQ9A 5ALMA 4PM4A 3RVBA 3UKDA 4LRXA 2JCSA 3UMGA 5CK4A 4KNYA 2ZATA 2IE0A 1UWLA 3AFMA 4X5OA 1XNQB 4OCZA 3T9AA 1X87A 1FRZA 4BV3A 4LXYA 5F9MA 4F5EA 1KZ1A 2CUKA 2V5UA 3IAAA 2AFHA 1O03A 2FP4B 2XQVA 3WG9A 1PGOA 1MVNA 1MQAA 4KFRA 1EZ4A 1VJ1A 2W6NA 3A70A 3PXXA 1AS3A 1XKLA 2WUWE 1XF9A 2YJGA 4TSKA 1RXWA 4B40A 3FWNA 4UE3S 4BNHA 1Q91A 5J2TB 4CN9A 1U2GA 4DADA 2BFBB 4ZEVA 3TECE 4MNTA 2BZ0A 4R8SA 3DP9A 4M37A 4DGSA 721PA 4MPDA 5GJCA 4B8YA 3S2EA 2HIAA 3FX2A 5B7NA 3BMNA 1CYEA 2J9FB 1QC5A 4F8JA 1SCNE 4JP3A 4GICA 2J0QA 1T4DA 4XLZA 4M8IA 2ZIFA 5E95A 4D7AA 3KQPA 2ODAA 4Q47A 5CVDA 3RUCA 4MVJG 5HGJA 1DELA 2FVYA 4B09A 2FFAA 4ZDJA 1A1VA 3ANLA 5FJIA 1WSBA 1PR3A 3EASA 3E22B 1CJCA 2XDWA 4R1QA 2C9BA 4I9UA 2AXPA 3EEOA 5B4TA 3FYUB 3O1LA 2CMDA 2ZYTX 2O19A 4XIYA 2NTNA 3PWSA 2GAIA 1W30A 1L7MA 2PH7A 5JAOA 4NBLA 1T0JB 2WP8J 5JCJA 1FFXB 4B85A 2JI4A 4I8DA 2KWIA 5BW5A 5IHXA 1LLCA 3WWCA 4R2JA 1AGNA 2NLOA 3H9GA 4I55F 3EEBA 2C98A 1P5JA 1MAHA 1E9AA 1B1AA 2AUNA 2ZJ8A 2IZ6A 1IMOA 3VKGA 3T5GA 5BOSA 1UKEA 5KVVA 2VDNB 4JASB 1JF8A 1IEWA 5ITSA 4BGUA 1BMFD 4WV3A 4G26A 4XLTA 2Q5HA 1I14A 2Q1TA 3H9UA 2JFPA 3IS3A 4IFEA 3KEMA 1AB5A 1WUYA 5K6TA 2G1KA 3ZIAA 2VHXA 3OY2A 5FNVB 2VDJA 2ZJ2A 4YDHB 1DRJA 5EZYF 2EWWA 1QIEA 2QDXA 2D1TA 2X4GA 3AKDA 3E3AA 1LQTA 1WMBA 3BYZA 3CJQA 5LA6F 2CLEB 4TS1A 1BCSA 2GEBA 5LDHA 5EIXA 1VL5A 1V43A 4WY2A 4CIDA 3CNQS 3HN2A 1BU5A 1XZCA 3KUXA 3PWZA 5E9WA 3GAZA 1GNPA 1RRKA 4P4UA 5DTIA 3GRYA 4XQEA 3AKEA 3O74A 2VAWA 3OKCA 1M0SA 3WZLA 1YCFA 4Y0AA 5JPCA 1EB8A 1I5RA 1ZJJA 3KWFA 2WVJA 3FOFC 3ZYCA 4V0RA 4AJPA 1E6KA 3N2EA 2WV7A 3R6GA 4LISA 4UUPA 1V4BA 4JT9A 4Q3DA 1IUNA 2QVCA 1UJ5A 3DULA 5T41A 3CVWA 1GSHA 1PJ3A 3AYZB 3BRCA 3ZD6A 2D74A 1AV6A 4Q1FA 3AXSA 5J5VA 5BV0A 3P0EA 4S0ZA 1FXSA 3UW1A 4ND3A 2QRUA 4L4SA 4MWZA 1OT5A 3BMOB 3LQ2A 1NBMA 4PLGA 2XMZA 4HY3A 4ZZ2A 5K1ZA 4BY9E 4WOKA 5DHPA 1J24A 2F00A 4P82A 1V39A 5IC4A 5JO0A 1GCIA 3FPBA 1L5HA 4IMJB 2BC9A 4PWZA 3AIOA 1X8JA 2BL4A 2Q5QA 3MLBA 4G09A 5HKKD 5FOQA 1VLJA 3W8NA 2YWFA 2BW0A 1ZMXA 1UZLA 3OKFA 1E4OA 5H16A 3O8NA 4ISCA 3R7NA 2MOKA 3KYBA 3WMGA 2B4QA 4AU1A 1V8OA 3TLJA 1WO8A 3KJFA 4LYJA 2CV0A 2X9LA 4GWKA 4PZLA 4DJAA 4PYOA 3VR4A 4ZK2A 1Z35A 4Q7LA 2VTBA 4Y98A 1IDN1 2NV0A 1BX3A 2EHDA 1UQUA 3Q5EA 2PH1A 2XMRA 3P52A 2JAUA 4BKQA 4BTVA 4BJHB 4M49A 1U28C 2Y0CA 3KG2A 2YASA 5IYZA 1TT5A 3WL5A 4CDRA 1CEYA 5LFAA 3KHSA 4BQSA 3BL6A 4QUIA 4IEFB 3HGQA 5D01A 1FMFA 1TF5A 3A14A 3QEBZ 3U5ZB 1KRXA 3RVJA 3DLIA 2P2CA 4QECA 3TFWA 1OF1A 2O54A 3DKIA 3PJRA 4FGWA 3EQ6A 4P0PB 2IITA 4L4RA 2FGJA 4OMDA 3QE9Y 3AR2A 4QDTA 5AOBA 5EAIA 1EJ2A 4JT8A 3X3HA 5CB6A 1KI2A 4R6WA 3ZBQA 2SHKA 4ZT7A 1QE0A 3GOHA 4D6XA 3KT3A 4ESEA 3WKDA 3Q7SA 3L1KA 3RS2A 4JNKA 4MRNA 4Q1CA 2VH5R 3R9XA 3GW8A 2NNLD 1G64A 1UK7A 1BDBA 3LDGA 4EUHA 4H7FA 2VNHA 1D0SA 1J1IA 1DC6A 1P1IA 2XTMA 5JXJA 1ZRHA 1TYCA 3D4NA 2C4WA 4KDFA 1E6LA 2ZIUB 1I3LA 4ZMBA 1XZBA 4HLQB 1T9ZA 5IXJA 1PFUA 3L05A 1JLLA 1JXAA 1OI3A 1C3XA 1WHSB 3OSZA 1ULHA 4H1HA 3T8YA 4DBVO 1W4LA 1HNZB 5A9TA 4RK6A 2B36A 3NKFA 5H9VA 1LU9A 2ZSFA 5LQKA 3CPEA 3OQPA 3WWZA 4RLQA 3EWAA 3AM3A 4RK4A 2WWRA 4X93A 3UJBA 3RC7A 1Z3IX 2CL5A 1UEXC 4H6XA 3DT8A 2Q3EA 3QF4A 4OATA 4A8JC 5IT9A 4R2LA 1FIUA 3VQTA 3IP9A 5HIKA 1KMHA 2HXGA 3KOUA 5EIHA 3WB1A 3KJHA 3E82A 4YCDA 4BVLA 2P2GA 1FJ2A 1RDFA 2P6UA 4ZWNA 3OD5A 4O4HB 5B1IA 8GPBA 2EZTA 4QTTB 4KLZA 5JDIC 4YDSA 2QPAA 4PYQA 1Y6QA 4OP2A 3RWOA 1KJZA 3TKLA 3UJ9A 3NVKI 4X6LA 3U62A 2WF6A 5F3DA 1U9CA 3RANA 3W4JA 4Z51A 2O2EA 1YIDA 4OHUA 1HTWA 4CIWA 2YJTD 3KR9A 5KTPA 5KSYA 1ILEA 1JGTA 2OZLB 4P4LA 3KDAA 5EHNA 2B8EA 3VH2A 1KYTA 4GPBA 3OLZA 2HU2A 3JWIA 4ENRA 5H4GA 4O2AB 3C3JA 4EEKA 4WKOA 3CNBA 1E7RA 4U0KA 4UNQA 4OFWA 2PS1A 4FHEA 4IEEA 1CY1A 4Q12A 1IYZA 2OR3A 3ESBA 5ELMA 3FMIA 3G68A 2QD2A 3NGXA 2F1RA 4YAJA 3GDOA 1R5JA 3N2IA 2SCUA 4U6NA 3A2NA 2RB4A 3HVJA 1E4EB 4ZVQA 1N8SA 3QU9A 5A4DA 1GU0A 1NSFA 3I8OA 3K1AA 2VYCA 4GLOA 4A2QA 3MTDA 4K3UA 1S01A 4R83A 2BHLA 2GLUA 3HPQA 3IUJA 3E5RA 1I3OA 3GLGE 1Y5NA 2C5SA 4DA8A 5GVSA 1JH8A 4C5AA 2F3UA 4RZ3A 1KYIA 1FCJA 3RGGA 3S29A 1XK6A 5JAUA 1YR6A 2BISA 3V3TA 4Q01A 3GLRA 4EHHA 1TC2A 4TMYA 4JBIA 1N78A 3IPXA 3Q5GA 4W8HA 3H9QA 3HDHA 3JD3A 5DBEX 4F97A 1E94E 1AKUA 1MHPA 3CR3C 3H1EA 2CL6X 5DW3A 4E08A 5CVUA 4MROA 5F78A 5HBRA 3RYIB 1WV0A 4KWEA 5BYKA 1NIJA 4M36A 4UPVA 2GCOA 3SI7A 3QI7A 3DE7X 4ZMSA 4AWXA 2QMYA 1FW6A 1DI0A 1K5PA 4QARA 3OQIA 1YVUA 4EG4A 4OAOA 2GN8A 3PD0A 5INTA 4YAKA 3NHMA 3NV9A 5A71A 3UMMA 4M0MA 3NHSA 2PBFA 2P8JA 2FP4A 3BGIA 2E4AA 5DHRA 2O1WA 5TY0A 3TMYA 2ODQA 4ZVMA 1UINA 1B14A 4LV8B 3TZCA 1KEVA 2K5UA 3IVXA 2C2YA 4AICA 3UMCA 1EQUA 4KW7A 4J0JA 5KQLA 2NUTB 3B1WA 2FE4A 1OTXA 1YS9A 1PWHA 3U1VA 1P3Y1 1T43A 3RSLA 3IBCA 4DV2B 4CYMA 2NXNA 4BU1A 4YAUA 3BMOA 5KWJA 3ANNA 1Q1ZA 4LKOA 1E3DA 2C07A 4FEAA 1V11B 3TMAA 2OILA 4US1R 1Z2NX 1AO0A 3ESZA 4QRDA 1N2HA 1PT9A 2HCFA 2JKVA 3OMWA 4IIBA 4G07A 2BN4A 4WIAA 3L7NA 3LTNC 4LYYA 1KEEB 1WB9A 2AZDA 2Y3IA 2O6LA 4MUGA 1S8OA 4DWJA 1XU7A 2B61A 2O9JA 1NXVA 2HC9A 2DJ5A 2JH8A 2FOXA 4I7EA 1P73A 4NV0A 4FIZA 3D3WB 1PFGA 1U28A 4RTMA 1YZGA 2WYIA 1ECGA 3VR3D 4LYGA 4A0RA 2IHZA 3O9MA 4D8TA 3HXOA 1EH5A 2YZGA 4IBOA 3V8QA 5JW6A 1JRLA 1PNOA 3C6QA 3KD3A 1MMFB 3N05A 1RZRA 1EX6A 4CQNA 2YX1A 3KLPX 1DWQA 2C2KA 2EX4A 4JBLA 4LWPA 1RM3A 3X1DA 5EVJA 2N42A 3HWWA 3SYTA 5FPKA 1DBRA 1PGPA 5A3VA 1I7SB 4ZOLB 4LY0A 3TL2A 4IVNA 5A5GA 2EC5A 1FSFA 1PP4A 1SKAA 4FS3A 4DW8A 1CY0A 1U0LA 4BNTA 4Q9DA 3LMKA 4BNWA 3IAFA 2VZLA 1B74A 3A2LA 1YVRA 3KHUA 1EFKA 3EMBA 1PSWA 2OXFA 3K09A 1EFUA 5DB4A 2OAGA 4PXSA 3SY8A 3VO1A 3D6AA 3THXA 3ABQB 1QK4A 3RSHA 1WD5A 3MS2A 2BBWA 2ZRHA 3PPVA 1HNNA 4GBGA 4NE2A 4OXKA 4DQUA 1GDTA 1DXQA 4QOGA 1V0JA 4URFA 4DNPA 1TVKB 1WU7A 1AMOA 5ALDA 1Z0DA 2GRAA 1BGVA 3EFEA 4S12A 3L2OB 4KMSA 3VU0A 4YFVA 1XL0A 2OSVA 5ARCA 5HJ7A 4W1QA 1FF9A 5ALVA 4HNAA 3H0CA 1N2CA 5JT1A 4AKGA 1E0JA 2D5IA 4D9HA 3PQ2A 5DMXA 4F56A 1V1MA 3I5UA 3IBYA 3BXPA 2GPNA 1G8JA 1QVZA 2ZRAA 1HE1C 2AEJA 1U80A 4MVJM 4N0QA 5KNDA 2AF4C 1C7JA 2JCVA 3WMWA 4BZWA 2HZ7A 2JGFA 2ZI3A 4ID9A 1I7LA 3D3WA 3FW1A 5WRFA 3FNFA 1XTIA 5K3FA 4TLLB 1JBQA 2XUGA 3F2IA 3BMCA 2LR0A 4AKIA 5AP9A 4OXQA 3GT3A 1KH3A 2WTAA 2WVGA 2ZYUX 2CHEA 3WFZA 1BYUA 4GL4A 1GZVA 3MRXA 3FBGA 4FINA 3DZDA 4KC0A 4M2LA 3H8VA 5FL7D 1Z36A 2Y0DA 3M70A 3WXBA 3JARB 5KAMA 4P3XA 1S2OA 3LT4A 4X1KA 4ZOLA 4HRYA 2D1FA 2ZAMA 3A58B 5CDSA 2W6OA 4WK2B 4EX6A 1X9HA 1M1XB 3OFSA 1R50A 1K5DA 3DMGA 4DIKA 4MRMA 1DIOB 4A1OA 2ZM6B 1PF7E 2X1LA 3CNHA 1PJAA 4MK4A 2HOQA 2V4MA 3GHYA 4CQLB 1V26A 1CY8A 4YASA 3TI7A 4B82A 4OBWA 5A1JA 2G06A 3UMSA 2ACKA 1A2KC 3WGYA 2WEKA 5T8KC 3KBOA 4LYFA 2IUFA 2Z43A 3DOEA 2BF7A 5JMWA 3OPMA 1PT7A 3BEOA 3R9WA 1D6MA 1J49A 2VP5A 5EIBD 4DSAA 2XBMA 1KIFA 1GVHA 2QN2A 2ZVPX 3UWPA 3WYAA 4IILA 3FG9A 3CG4A 4WOJA 1AMNA 2SCUB 4F6CA 1P4AA 1XWFA 3PC6A 3SR0A 2XW6A 2WG0A 3ZHQA 2WFLA 1KNXA 4AO6A 4YCCA 2WYOA 1M66A 1Q74A 4ZQBA 1S2IA 4DFDA 5HM6A 5CA1F 2KX7A 1GPMA 3VYWA 3HUTA 1R64A 4MLCA 1L9XA 1KZGB 1GL3A 1PR6A 2F1IA 1Z56C 3DWGA 3N70A 3QYJA 1BDMA 3U0VA 4WW0A 4D92A 1M0TA 2V7TA 5DGXA 2ERCA 4YV0A 1BXGB 1SCUB 1K8ZB 1ID8A 2QYOA 3B1ZA 3M6XA 1RZUA 4TWAA 1XCPA 1ZMTA 2FPSA 1QYVA 1P72A 1A04A 1DFGA 4S04A 4QYIA 4YH1A 2PUGA 1LK7A 3EWIA 1YQEA 2HA5A 2RHJA 1TAQA 3FFXA 2AC2A 3T5TA 2I2FA 2JCXA 3TBHA 2DECA 2D00A 2JJ2D 3EXAA 4LMAA 4JYZA 5HUHA 1T8SA 3HYTA 2W22A 5IDYA 1NKTA 2DXIA 2QQFA 4QDZA 2IP1A 1J2UA 4MYTA 3U80A 1I30A 1JQ5A 3H9BA 4UREA 2I8AA 1A8QA 3KT6A 3Q88A 3E9NA 5K8JB 2F48A 2QRMA 1JI0A 1CC1S 1ZRSA 1N57A 2B5WA 2P9HA 4L08A 1WB4A 2ZR0A 5B1DA 5D86A 1ORVA 1EQ2A 4YECA 2RK6A 4W4TA 5IFKA 1M7BA 3QVLA 3GC6A 4D1YA 1PR4A 3BIXA 5DYNA 1BS1A 4WBSA 2HQOA 1DOAA 2PSSA 1ZU5A 3I2GA 4LHZA 4LRSB 4P92A 2Z3WA 5F2KA 4N5HX 3DKRA 3ZIDA 2A0KA 3C6KA 3NDIA 5F7JA 2DH6A 3PX3A 1U2RA 4EHJA 3QOXA 2BSAA 1UPCA 3TZEA 2ZTVA 4C7BA 2QZ4A 4WK4B 1M34E 3K15A 1HL3A 2WZQA 3FZEA 4KVZA 3T3GA 5KNBH 1YZKA 3D0OA 4BP3A 1AZSC 1SHJA 3IPYA 3CF2A 2V59A 3SR4A 3A10A 3LCJA 3DZJA 1KK2A 3LS2A 5KVQA 4RXTA 4EMTA 5IF3A 1HK7A 3V4FA 4YR9A 2ECOA 3LLVA 3QJYA 1X86B 5AUQA 2HPZA 4XUCA 4B32A 2FZEA 3OE1A 4WXMA 1MC1A 4DCNA 4F7WA 2M98A 4KWTA 4KQ2A 4MMZB 1EIZA 4WCFB 3O7WA 1FRFS 3WSTA 1E79D 4F3NA 1W75A 1PS9A 3JQAD 5M29A 2IC5A 2PH5A 2YJNA 1HDEA 4IZHA 3QTTA 5E0KB 4GPZA 2G9UA 2CVQA 2YRWA 3UXMA 1RM5A 1LLQA 3PQCA 3E9DA 1J70A 2DQKA 2V6GA 4F06A 3GZTB 2QL7A 4CNBA 2I2BA 2ZIAA 4R1TA 4E70A 1NLMA 3X1KA 4RIEA 2IUYA 5JFTA 1LX6A 4Z0NA 2C9CA 4KAAA 1PG2A 1VKOA 1VMDA 2CJXA 2J0EA 3KOWA 3P9KA 3K8OE 2O3QA 4X1OA 4D0GA 1R9GA 4CIXA 5B57C 2HWKA 5EHIA 3HU5A 3LX8A 4XX1A 4BX2A 4K2HA 5B6JA 2DKFA 2IXFA 4RAOA 2DT8A 1M2VB 1PG0A 3CE9A 1K1EA 1SBTA 1AQIA 4OYRA 5KTOA 2R8RA 2BMWA 1H3EA 4DCPA 4R2KA 1TM2A 2QY9A 3H5VA 2WHRA 3RAGA 4LJ4A 4NEGA 4G5YA 1N0VC 1N1EA 3HWRA 1COWD 1QRRA 3IMEA 3KSMA 4J9UE 3IKVA 5DK4A 3KYJB 2F43B 2ZIXA 4TT3D 5DF1A 1FNCA 1DNPA 3J81A 2PYZA 3CA8A 4JFRA 1ZRNA 1U2EA 1VSVA 3KQWA 3LVRE 3EUEA 3OLCX 1DBSA 1NMYA 4N7RA 2AMLA 3DDWA 3UF0A 3U4QB 3D8NA 1QVWA 5ALUA 2IPXA 3GGDA 3TGWA 1F0NA 3QEAZ 3KLMX 3G9UA 2ZRDA 2VBCA 5A0TA 3GT7A 3SMVA 1V5WA 1Z16A 2ZT5A 3D3JA 4NJEA 1CR1A 2QRGA 4XTCS 3QWBA 3S1LA 5FKJA 1RCTE 2G28A 2B98A 2XKJE 6REQA 4B48A 1GNSA 4MQLA 3O1JC 2Q3BA 3LRXA 1U8AA 2Z5GA 4Q7EA 4P22A 2QMQA 3RSGA 3H4VA 2RJ3A 1Q1BA 4LW8A 1HYEA 4MJXA 2FPIA 4O2AA 1KKLA 4QOFA 2ZSAA 4HWRA 1XN4A 3NOXA 3LHIA 4YJ3B 1AGXA 1SMKA 3AM5A 2ZUWA 1W4RA 1ZNQO 3RBAA 4POOA 2ZI5A 3HDTA 3R5SA 4EMBA 2PE5A 1H4QA 2NP7A 4W5OA 1M33A 1T13A 4M99A 4D4LA 3D0KA 2PVCA 1E1CA 4A6DA 2W6PA 4MDEA 4UHCA 5HZHA 4JYAB 3IUSA 1R0BA 2QRQA 3DT9A 3LE8A 2A5YB 4HBGA 4JJ8A 5EMHA 2CF6A 1C8BA 4IZOA 3I5MA 3RVDA 1TZJA 1I1QB 2MMGA 1VJCA 3IV7A 1RYFA 4IGIA 4P98A 1F8GA 5DVZA 3IBTA 4BYMA 4WLFA 1F1JA 2B0JA 1C14A 4RFSB 4ND7A 1K88A 2QI9C 4BXOB 1A8UA 2Y1DA 3Q3EA 4DA7A 4D4KA 5IJWA 1SZJG 3WIUA 1BCRB 3NWPA 5IBPA 5ALEA 1YIOA 1SZCA 3TF5A 1D4OA 3D3EA 2M1ZA 2QR2A 4IIHA 4QLOA 2GZ1A 3FBWA 3L01A 1KRWA 2CVFA 2VN8A 3HKBA 5I9BA 1E4YA 5JSZA 1Y6ZA 3WICA 2WU3A 1NL3A 5CRIA 2QD1A 1JE0A 3DDHA 2IODA 5FLYA 3ZYZA 1PZNA 3MAGA 3TPCA 3U7JA 4KO1S 2NX2A 1Y9AA 4YRAA 3UB4A 3W3ZB 3SXJA 5LOVB 4FI3C 4UTNA 1O94A 5EE1A 1H0RA 1ZK0A 4Q1BA 1GPDG 2R25B 3A9UA 5E9JA 5D8DA 4J75A 1JMYA 1PNQA 5B12A 3U6BA 4OF4A 2X9GA 5KQMA 3MMNA 3WL6A 1L4EA 2X8BA 3C3CA 4TVBA 2J0VA 4CLOA 1CD5A 3OKPA 3I30X 1H0SA 2FHSA 2G08A 3BK2A 3OIFA 4L1KA 3MXOA 2AHOA 4J2TA 3PF9A 1TE2A 2H59A 5AK6A 3KQUA 2XECA 5IG2A 3SYKA 4PCAA 5EMLA 5K5EA 4NMWA 3H7AA 5LP1A 2WBLC 4EKIA 3SE7A 3ZJUA 4OBEA 2GJAA 4H4EA 3E9CA 1PR0A 3FA2A 3K05A 3PNMA 4IDHA 3ND9A 1WQ4A 1PL0A 2EJVA 2JBAA 3RSCA 2E4ZA 2J9ZB 4CEJB 4UHKA 4FHDA 3A37A 1JV2B 4LBWA 1PDOA 4MS3B 5BSWA 1NV9A 1FRVA 2Y66A 1QZ3A 5I7RA 4UDOA 3MHTA 5KYNA 3FSRA 4DMHA 2PGXA 3TVYA 4RVHA 5LIRA 1FPMA 2JFFA 3VNBA 2F55A 2IK8A 3FRJA 4D5GA 3AGPA 2OA0A 2JVJA 2QM7A 2RHMA 2ZJZA 1QNLA 3OZEA 1RJDA 3PXGA 3MLAA 1ZISA 1GKIA 1M2KA 1FDUA 1VKRA 5LBTA 4RZ2A 3RIHA 5I8PA 2X9NA 1II9A 3RSZA 1IEXA 3RVNA 1UOOA 2CVZA 2FA9A 2OYRA 2I7TA 3HKDA 2BF4A 3V4PB 4ZRNA 4YIHA 1TQ6A 4Q16A 1ZX1A 1OC4A 2REQA 5EMJA 1QG0A 1PT5A 1RKQA 2GBLC 2JIOA 1A7UA 2IPMA 3E5HA 4CV0A 3TLCA 1DCMA 3PQ6A 1BNCA 1GUZA 2OO5C 3B5IA 5CAEB 3VU8A 1RAIA 5LSAA 3E2IA 4BEWA 1LPPA 3B3QA 4ZV7A 3VOBA 4L3OA 3NP9A 2IBMA 3NHZA 4N9QA 1M3SA 5BYBA 4J43A 4CR6A 1KPGA 2I3DA 1MX3A 1IHYA 2C5GA 2IE8A 3FRHA 3TKYA 4LJ6A 1B8OA 1SCIA 1YHNA 3OVMA 4NLLA 4RTKA 3U13A 2ZOSA 1SQ6A 2NG1A 5IUJC 3LT0A 2BBSA 4QYXA 1NF2A 1U0OC 4QGSA 2ZTLA 1SPBS 1MVLA 4G9GA 1UBSB 2ZSKA 1RYEA 2J0UA 1WCIB 4TTIA 2RGXA 2AE2A 1GUDA 5CXXA 3JQ8A 5C5CA 4NCXA 3RSOA 2RIRA 3AJ8A 5D6OA 1TCAA 1T1JA 2JLUA 2A0WA 2R7AA 3HI6A 3ROTA 1DKMA 2Y4OA 1H2HA 2HIHA 3GU3A 3KR2A 4G0OA 1KERA 5AHXA 3QG1A 4ZALA 4QUJA 2RARA 2QGZA 2BGTA 2TRSB 1GL6A 2C88A 4QT0A 4QU5A 3UAGA 1TCUA 5GONF 2UYCA 2FZGA 2X4LA 3BHNA 3WYDA 5EIWA 4BBAA 1A9ZA 5EIFA 4QOEA 1KS9A 3ZLTA 1ELOA 2FF5A 1AK9A 5I7VA 3GD7A 4K7JA 1FS4A 2XYVA 3QY9A 4O4HA 1GAJA 3NJ8A 2PZMA 2HR1A 2H4XA 1W5TA 2J5QA 2BGUA 3HWX1 5DCYA 5BN3B 5L3VA 4N0MA 4DV5B 1KVSA 4CKXA 4IG9A 5JEEA 1SQFA 1SOMA 2YXDA 3F96A 3QJGA 4MIOA 2WTMA 3W05A 3LY7A 3ZHOA 1IONA 2Q0HA 3WP0A 2HMUA 2O2ZA 5A9RA 2JCYA 4TZ6A 1B6TA 3TQCA 2DFPA 3L5OA 2P5YA 4YQZA 2GCGA 4X97A 2UYHA 4TXHA 4JI0B 3KQOA 1E2MA 1M8JA 1EVLA 4NP6A 4QBKA 5DTEA 5C1PA 1T24A 5EJFA 4JJ6A 1ZK2A 4DMLA 2PUWA 3VAZA 1AUQA 4ALJA 2QAGA 4F2PA 5HM8A 3KAQA 4N6GA 1HT1E 1UOPA 4N3CA 3O0DA 2WSMA 3LDAA 4L51A 4EJ0A 2OORC 1HXHA 2Y6UA 1P9OA 1DAOA 1PR9A 3N0XA 2Z58A 4WKBA 2F3RA 3V55A 3V4OA 2LV8A 1KOGA 1P44A 3Q87B 1P9NA 2IQ5A 4M9SA 5G40A 2ARKA 3EBLA 3UK1A 4GZ3A 3RUHA 1JB1A 1OXTA 4F5ZA 2VTBB 4ATNA 1ZONA 3LY5A 5H9WA 1IBLB 1X7WA 2NMVA 2VFAA 2D54A 5B2FA 4GKJB 3B3FA</