3MTEA

Crystal structure of 16s rrna methyltranferase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
219
structure length
219
Chain Sequence
MLILKGTKTVDLSKDELTEIIGQFDRVHIDLGTGDGRNIYKLAINDQNTFYIGIDPVKENLFDISKKIIKKPSKGGLSNVVFVIAAAESLPFELKNIADSISILFPWGTLLEYVIKPNRDILSNVADLAKKEAHFEFVTTYSDSYEEAEIKKRGLPLLSKAYFLSEQYKAELSNSGFRIDDVKELDNEYVKQFNSLWAKRLAFGRKRSFFRVSGHVSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the function of aminoglycoside-resistance A1408 16S rRNA methyltransferases from antibiotic-producing and human pathogenic bacteria.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 16S rRNA methylase
total genus 76
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.1.1.180: 16S rRNA (adenine(1408)-N(1))-methyltransferase.
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3mteA00
3NTVA 1I1NA 3R6TA 1VBFA 2NP6A 3ANXA 3ME5A 5EMMA 1M0EA 3L8DA 2UYOA 2NXJA 3TRKA 1HNNA 4E2WA 7MHTA 4KRGA 2PWYA 1KYWA 4R8SA 2PY6A 3HVIA 1RI5A 3KR9A 3LDFA 4C08A 1QANA 1D2CA 1KYZA 1G6Q1 5E2AA 3OZSA 3DXZA 1Q0TA 3BT7A 3UJ9A 1YUBA 2YQZA 2NXEA 3UZUA 4FS8A 4Z2YA 4KVZA 3KPWA 4GF5A 2O05A 1XCJA 1NW6A 5FHRA 3TKYA 5KQSA 1KPIA 1N2XA 5HIJA 1JTEA 1BOOA 5BXYA 3OCJA 2OPBA 3BKXA 4GOOD 5C1IA 4YUZA 4M7RA 2YXDA 5DX1A 1X1AA 5LQCA 5LQNA 1FJXA 3A27A 4PYMA 4DMGA 3AXSA 2ZIEA 1KPGA 5EG5A 1NBHA 2P8JA 3DLCA 3EVBA 4GUAA 5C0OE 1XDSA 1IM8A 1JR4A 2PXCA 1N7JA 1R00A 2IDKA 2P40A 1T43A 3KKZA 3OZRA 1U2ZA 3G2PA 2I6GA 5LR6A 2I62A 2UYQA 3BWYA 2ZBPA 4FSXA 3LKZA 3I53A 1G8SA 2YUIA 4CTKA 2PX2A 5EVJA 2WA2A 2PJDA 4QPPA 1YB2A 1L3IA 1RJEA 3EVZA 3OFJA 2EJUA 4PYQA 2ZW9A 4OBWA 8MHTA 4R05A 3EVCA 3KQSA 4DCGA 4DA4A 4K6MA 5DTMA 5EZQA 2AS0A 4RWZA 3LGAA 4PGGA 1JG1A 3OZTA 3PB3A 4PYKA 1NW7A 1R6AA 3KR1A 5ICGA 1AQIA 2VS1A 3TQSA 3BWCA 5K0FA 3BWMA 4XCXA 1KIAA 3CJQA 3FUXA 2CMGA 1XXLA 3K0BA 3LHDA 4YUWA 1D2GA 3X0DA 5DM2A 2I9KA 3IV6A 2Y1XA 1YZ3A 5CD1A 1G8AA 4IWNA 2CKDA 3BGIA 5K0GA 4RTNA 1QAOA 1ZHFA 3D2LA 4HGZA 2YXLA 3TM5A 1NW5A 1VP9A 2ZWVA 3MQ2A 5HZMA 1YZHA 3C6KA 3HNRA 3KPUA 4LWOA 5BW5A 4PIPA 5HIKA 5GM1A 4MTLA 2GH1A 3B3FA 1WXWA 2AOWA 1AV6A 2DULA 5GP1A 1WG8A 4AZVA 3AY0A 3NJRA 3PT9A 5CVDA 5JUWA 5F2NA 1IXKA 5DSXA 2AZTA 5EKXA 2FYTA 4GEKA 1XCLA 5K05A 3JWJA 2IIPA 3T7TA 1M6EX 4DCMA 3Q7EA 4MHTA 4B17A 3EVAA 3FRHA 3G7UA 3KQWA 4M37A 3M70A 3SMQA 4A6DA 4CXMA 2IH5A 1L1EA 3SR4A 4RTRA 4JXJA 2PGXA 5E8JA 3V8VA 4EKIA 3GRRA 4CTJA 1JG2A 2A14A 4P7KA 5DM0A 3OFKA 4OA8A 2ZIGA 3FPHA 2GLUA 5CVJA 5EPEA 2AVNA 3BZBA 4E32A 2P41A 4M36A 2PXXA 2UYHA 1TPYA 2R3SA 1TW3A 2B9EA 2QRVA 1NE2A 3OU2A 3R0QA 5FQNA 1P1BA 3E23A 5KQRA 4X60A 4X63A 5KYGA 3HCBA 1JSZA 2AOTA 2V7EA 5B1SA 3RW9A 3UWPA 1WS6A 2JG3A 2JHCA 3T7SA 3GRVA 4FGZA 3B5IA 4O29A 4DKJA 3DTNA 3UA4A 1M6YA 1G60A 5FTWA 3FUUA 3EGIA 2FK7A 4P7JA 2H1RA 1SKMA 3NVKI 3DMGA 3R3HA 4R6XA 3A7EA 3FPFA 5DPMA 2ZTHA 3HP7A 3TKAA 3UJ7A 2IBSA 3VC1A 3EVDA 2OKCA 2PX4A 3ELDA 3SGLA 3PFHA 1VP3A 5DTRA 5KVAA 2NXNA 3EGEA 5ERGB 5CCXA 3TR6A 2R6ZA 2G72A 2EX4A 3CCFA 3O4FA 4DQ0A 1QZZA 5K03A 5DRTA 3V97A 3CGGA 3TOSA 4M38A 3GWZA 4RSRA 2AN3A 2NNWB 5LQKA 3EPPA 5K0LA 3NW9A 4ER7A 4YV1A 3UFBA 1X1DA 2BH2A 2FK8A 2V74B 2Y1WA 3I9FA 4YUVA 3ID6C 4KIFA 4F84A 4RTSA 1RI1A 1QAQA 1ZKDA 1RI2A 3OE4A 1DCTA 4X1OA 2VDWA 1SVUA 4LECA 3A26A 4AUKA 3NDIA 4OA5A 3KQPA 4WVLA 1JG3A 2PT9A 5CVEA 3HVHA 2XVAA 4EMSA 1RI3A 5LQRA 5FA8A 3TMAA 1Q0SA 1Z3CA 1UIRA 5HEKA 1PJZA 3PX3A 5DWQA 5GINE 4EK9A 1P1CA 3A25A 5DXAA 2AOXA 3FRIA 2AVDA 1EG2A 3GRYA 2HWKA 4QVGA 3IEIA 3M6XA 2YXEA 2B78A 3GO4A 2ESRA 2P35A 3DUWA 4C06A 2ZZMA 4GC5A 3CBGA 4YMHA 4ISCA 3QV2A 3HVJA 1O9HA 3NDJA 4CWAA 5T67A 5BP7A 10MHA 5HILA 3LCVB 3SX0A 3R9XB 5M5BA 2PSSA 3OPNA 1ZQ9A 3A4TA 2VDUE 2ZWAA 5K0EA 2AR0A 3SM3A 4ATNA 2FCAA 2O07A 3HA5A 4RVDA 2IDJA 5K8VA 3LCUA 2LD4A 1EQAA 3QOXA 3THSA 5EHIA 2UZ4A 2ZBRA 3G5LA 3BWBA 3ERCA 1XTPA 3FZGA 3KR0A 5E2BA 3DXYA 3RODA 2FPOA 1YFLA 2BZGA 3KQTA 3ORHA 4GOND 3JWHA 4HRAA 4PGHA 3VYWA 2ONYA 2WK1A 1SUIA 4RVFA 3S68A 5HOQA 4C4AA 5DXJA 5E1MA 2IH2A 1N7IA 1L9KA 1G38A 1X19A 4DM3A 1ORHA 4P58A 2QRVB 3LSTA 4OQEA 1F3LA 2PKWA 3KPVA 5CCBA 2HR1A 3DXXA 4LG1A 2PWPA 4MIKA 4EVIA 4RTOA 2OY0A 3CJRA 3R24A 2B3TA 5CM2Z 1DUSA 2P3OA 4H0NA 5ICCA 3REOA 3P2KA 4R8RA 3RIEA 4BP1A 4C03A 3NVMB 3CVOA 4HC4A 3DLIA 4E31A 3P97A 2AN5A 1R18A 3T0IA 1D2HA 2YX1A 3P9KA 3KQOA 5FCDA 3FPEA 4E2ZA 3KPYA 5GIPE 3BUSA 4XUCA 2AOUA 3GCZA 2B25A 2ZFUA 2H11A 4BY9E 4GOMD 4V0QA 3MAGA 3G88A 4HG2A 2XYRA 3M6VA 1PRYA 1RI4A 3HEMA 3M6UA 2BM8A 4PYJA 3TLJA 3SVZA 1HMYA 5FULA 3B3GA 2AOUB 2QY6A 2YTZA 4BP3A 2O57A 3HA7A 1I4WA 5EMKA 2EJTA 3I64A 5ICEA 5K0BA 1KPHA 4GBED 4L7VA 2PBFA 3FTFA 3B3JA 1KP9A 2OB1A 3FPJA 2C7QA 3K6RA 3NMUF 3MERA 4AZSA 5MHTA 2ADMA 3A7DA 4CKCA 1FPQA 1XDZA 4XUDA 1JQEA 5K0NA 3M33A 2P7IA 2JJQA 3FTCA 4RYLA 2BR3A 3LDGA 5DT2A 2PX5A 3EEYA 3LCCA 5T64A 4YV0A 5C9ZA 1EAMA 2ZULA 2H00A 3GDHA 2QE6A 4DZRA 1WY7A 2HV9A 5HFJA 3EVEA 3GRUA 3MCTA 5T6BA 3HCFA 5JR3A 1DL5A 3HA3A 3HCCA 2XYQA 2KW5A 2FRXA 3DOUA 3FTDA 4P7FA 4RVGA 4C07A 1NT2A 5DM1A 4RTMA 2AOVA 4PCLA 3BGVA 1O54A 1QYRA 2ONZA 4LWPA 5DX8A 4ER3A 2NYUA 5E9WA 4RTKA 3IYLW 3FTEA 2ZVJA 3SXJA 5FUBA 1P91A 3P9CA 4CKBA 1SG9A 2EG5A 4F86A 3KQYA 2JHAA 4QDKA 2CWWA 1ZG3A 5CUQA 2OXTA 5H02A 2PT6A 1RJFA 2AN4A 5K01A 4AX8A 1UFKA 4C05A 1L3CA 3EVFA 3GNLA 1L3BA 3GXOA 3GIWA 3I5UA 2IFTA 3HVKA 2BR5A 3EMBA 4RTLA 3O7WA 3HCEA 4BLUA 4E70A 2FHPA 4KDRA 4A6EA 3EEOA 3H2BA 1G55A 1RJGA 1R74A 4RX1A 5BW4A 4PYNA 1I9GA 2OO3A 3CKKA 3KU1A 1BKYA 3LX6A 4QTUB 5EHGA 5LQUA 4GQBA 1VIDA 1JQ3A 3LBFA 2JHPA 3G8AA 3JWIA 4FR0A 4RTPA 4PONA 5DX0A 3GGDA 1BHJA 5EIWA 5FQOA 2G1PA 9MHTA 3F4KA 4KW7A 5IKMA 3AXTA 4WXHA 2B2CA 2OZVA 2IBTA 3BXOA 3G2OA 4XUEA 5K09A 3NWEA 2ZSUA 5E9QA 3LECA 1V39A 1SQGA 1JSXA 1ZGJA 1NV9A 3M6WA 2HTEA 4IV8A 1O9GA 4YUYA 3SSMA 3KR2A 3ELUA 5EC8A 1ORIA 3THRA 4U7PB 2PXAA 4KWCA 5P8WA 4BLVA 3C3YA 2XBMA 1RJDA 3VC2A 5DLYA 5LQJA 3MB5A 2PX8A 3Q87B 4HH4A 3NWBA 4QQKA 2OBFA 1MJFA 2QYOA 1P39A 2I7CA 1SUSA 1NW3A 2CMHA 2GAFA 1JQDA 3HM2A 3G8BA 4IKPA 3C3PA 4HTFA 1XJ5A 4KIGA 3HTXA 1BC5A 1IY9A 4DF3A 3PS9A 3EVGA 2VDVE 4MWZA 1VLMA 2G70A 3LBYA 4GOLD 3LKDA 4QTTB 3BGDA 4AZWA 2PLWA 2DPMA 1JTFA 3IHTA 5EOVA 1R8XA 1YFJA 5U4XA 4U7TB 2GS9A 3B7PA 2OYRA 4PNEA 4QDJA 3AJDA 3FYDA 2NP7A 5EEHA 3MCZA 2C7PA 4QVKA 2IH4A 2ZLBA 3GRZA 1X1CA 3TM4A 3OU7A 2ZBQA 4Y2HA 5GM2A 3C6MA 4ER0A 3FPGA 3LPMA 5EQJB 4HSGA 3E05A 3AWIA 4FT4A 3SSNA 2JH9A 1XVAA 3EGVA 5LSAA 3ER8A 1TW2A 4HTFB 3FUWA 5E1BA 4RV9A 4PWYA 4QQNA 3T7RA 1VE3A 2C7RA 2ERCA 3E8SA 2XVMA 3FUVA 3OE5A 3KQVA 1H1DA 5EMJA 4C04A 1QAMA 4EKGA 3G2MA 4BLWA 4E2YA 4FSDA 1NW8A 3PTAA 3DR5A 4F85A 3ER9A 1INLA 3DULA 3EMDA 5FWAA 5DTQA 2Q41A 3UJAA 4PINA 2BM9A 3E7PA 3OU6A 5CVUA 2P3QA 4YV2A 4QPNA 5F2KA 3UBTA 3KPJA 4GC9A 2IPXA 1FBNA 1SQFA 3HCDA 3P2IA 2UYCA 4YMGA 1KHHA 3M4XA 1UWVA 1Y8CA 3JWGA 2Z6UA 2JH8A 2F8LA 3P71T 5LQAA 5G02A 2G8NA 3QOWA 2PV0A 3O31A 3G2QA 4RTJA 2NXCA 2GB4A 1WZNA 2O0LA 5ICFA 2GA9A 3UA3A 4NECA 4X41A 1MHTA 1VQ1A 2G71A 1OR8A 2HNKA 4X61A 1KR5A 5EZSA 2XYVA 2AOTB 2P1DA 4E33A 5CIYA 4KDCA 2E5WA 4PYLA 1JG4A 3TPZA 4YUXA 1NKVA 2ORED 2BR4A 3MTIA 3GU3A 3U81A 1VL5A 5D1NA 4V0RA 5FHQA 1F38A 3DMFA 5EEGA 2ZZKA 5EGSA 3P9IA 4PYIA 3MHTA 1XDUA 3FUTA 3PFGA 2K4MA 3TFWA 3FYCA 1NV8A 3HCAA 5E1DA 5KS2A 4PYOA 1YF3A 2O06A 1FP1D 3ELWA 2Z6AA 2Z6QA 2HMYB 3KQQA 2P7HA 3KHKA 3P2EA 4HGYA 4PCAA 4Y30A 1R8YA 4AZTA 1NBIA 4G56A 1EJ0A 5FA5A 3BKWA 1EJ6A 3G89A 5HIIA 2VZ9A 4POOA 2OB2A 5GIOE 2PVCA 5FWDA 4E2XA 3VSEA 2ZZNA 3UJBA 3LL7A 3MGGA 3PX2A 3KQMA 4OQDA 3CC8A 3B89A 5D1HA 4ER6A 2C7OA 3DMHA 5E1OA 5F2OA 3P8ZA 4UOEA 2P3LA 2IGTA 1AF7A 5FADA 4EQZA 2EFJA 4ER5A 3UJDA 5GOZA 4R6WA 3LDUA 1X1BA 4FP9A 4ZTBA 3I58A 1ZGAA 4OBXA 4RVHA 3PVCA 4FT2A 2GPYA 2N47A 2QM3A 2VP3A 3DH0A 4FZVA 1AQJA 1WXXA 1FP2A 4P7GA 3UJ8A 3ELYA 4CKEA 5EIFA 3WSTA 2YR0A 4E30A 4RTQA 2ZIFA 4PIMA 2ZCJA 5EKUA 3G5TA 5CVVA 5EMLA 3P9NA 4OX9Y 5DRYA 3CJTA 5HIMA 3SSOA 5GWXA 5K0CA 3DP7A 2CL5A 3PLAE 4MQ4A 5DSTA 2WA1A 2YVLA 5IH3A 3MTEA 1VPTA 3UJ6A 5E8RA 5DM4A 3C0KA 3UJCA 3GJYA 1KXZA 5K0JA 4IV0A 2IP2A 1B42A 1EIZA 5E9JA
chains in the Genus database with same CATH superfamily
2UUAB 1NULA 1W93A 2B94A 2HDOA 4ZD6A 1J5EB 4AWAA 4LJ5A 3VZPA 4M1ZA 4JP8A 4TYQA 3GYGA 3IIMA 1R1DA 1ZOIA 1QBGA 3DAYA 3F67A 4XJTA 2R87A 1LW6E 2OC4A 2X7HA 3CLRC 4K6OA 2Q6TA 1XDWA 3OPXA 4RSHA 3TAHA 3UW1A 5BR4A 1Z37A 5AOAA 4BMPB 4Q1EA 1V7QA 4J8PA 3UJ9A 2XUZA 2SKDA 3TX6A 4NHOA 1Y89A 4NU6A 4YYZA 1SD5A 1M2VB 1DBPA 3GUVA 3KE9A 1XCJA 4Q4AB 1Y82A 4JJEA 5DBIA 4EY6A 1DIGA 2FPMA 4W1QA 3AR4A 3NHZA 2VT3A 5AKZA 1JTEA 3C3KA 3WIOA 4HAIA 2XIQA 4PLHA 4OL9A 2FH5B 2IZZA 2B4YA 3KJFA 4GX2A 1TQDA 5IYZF 1K5PA 1V3QE 2AJ8A 5TS2A 1WKCA 4ZI7A 5ESXA 5LQNA 2IHYA 4AN1A 2ZJAA 5LOVA 4HQNA 2GARA 4EDFA 1H8HA 4IFIA 4IGEA 2WWVD 3P1JA 4MR7A 1J1ZA 3QGMA 2QAJA 1R00A 4Q4JA 1GL7A 3WKCA 1L5WA 2IPNA 4RHUA 3VR1A 1T43A 5E4FA 1AXEA 5LR6A 1A9ZA 2UYQA 3LE8A 2ZBPA 2OQ2A 1MENA 2B34A 1GZDA 1TJNA 2UZ0A 2YRFA 4FSXA 4KQXA 2OHJA 2DFDA 4MO9A 1TB4A 5GJVC 3IAXA 2GAOA 4HQRA 4S2EA 4G4SP 1XAGA 5ALEA 2IHBA 1R8JA 2F3UA 5DLPA 1QQ7A 4FKMA 4ENWA 5IAGA 2C84A 3ZGVA 1YKGA 3DKPA 8MHTA 1RBMA 1LQ2A 4DCGA 3ZCUA 4EG7A 1NBMD 3JQFC 3EK2A 2XCQA 3EEBA 3I39X 5ICGA 1NXWA 2V96A 5HCIA 3BWCA 2VSYA 3AVYA 3IMGA 2Y76A 4JYMA 1TQHA 4U00A 4A27A 3ZE1B 4PZZA 3GLTA 4EA7A 2WSSD 4NDZA 5JPCA 1J8YF 1P0QA 4Q16A 4U2BA 4QT4A 6NULA 1FP4A 2I66A 1ZNQO 2ECPA 4RPHA 5GTDA 2HDNB 1Q84A 4MKFA 2KLHA 1P8JA 1KZ7B 1RC1A 3O4VA 1XTQA 4D96A 2EFGA 3C6KA 4UOZA 4JI1B 2A9RA 5B57C 1OFUA 1MHPA 2Y1DA 1ZJZA 2B8WA 3IA2A 4YAEA 2WWRA 2J85A 4IVQA 3ZE9A 3A70A 3RG8A 1NSTA 3DD5A 1RM5A 3V48A 3B6MA 4GEKA 3RNLA 3IVMA 3THWB 3ZDXB 2DBZA 4I9UA 4AZ0B 5AUPB 3AJEA 3OQIB 5LP6B 1VM6A 4MHTA 3HU2A 4MZDA 3EEIA 4NV0A 5HMLA 5K3CA 1L5GB 4CXMA 1Q57A 5A4JA 5I7VA 2SCUB 3E7DA 3SR4A 3SX2A 1FDUA 1KJ8A 2ZXUA 5IK2D 4TS3A 4TKVA 1ST3A 1HFWA 4C0LA 2P6PA 4WGFA 4J76A 2IY8A 3DHVA 4E32A 1T8SA 4JVLA 4RDXA 1DPFA 4HTAA 1TQ6A 2X2OA 1P1BA 1ZQ1A 2AFVA 2QTGA 3O83A 4HD8A 4D6YA 4DARA 4C0AC 5H83A 5KYWA 4BBZA 1M2WA 1U2RA 3HCBA 3RVOA 5ALFA 5FT9A 3CF2A 5UKDA 4G89A 4B84A 4Y6RA 4JI8B 2GCEA 3M5DA 2H7XA 4WFQA 5DYIA 3HUEA 1I2BA 4XDZA 1IG3A 1UBFA 1Z5WA 2C4KA 2VF8A 1U8TA 4D81A 1E9FA 4M3NA 2X4LA 2JIMA 2VPWA 4ZCQA 5JRJA 3U6KA 2OG1A 1RC0A 4Q3EA 1ECGA 1Z88A 1ADCA 1XQ6A 2XD9A 3RUPA 5LP6C 3TKAA 4TT3D 3UJ3X 1ATIA 1VP3A 5DIFA 2NXNA 3H75A 1IVNA 7ABPA 1XZNA 2SECE 3ANYB 1REQA 2ZUDA 4QOHA 4Q9HA 2A3NA 4TS1A 2YWHA 2RHHA 3KD2A 2C59A 2QR3A 4QZVA 3VVCA 3TNDA 2CXQA 1AZLA 5THKA 2B83A 1CW2B 7ADHA 3F90A 2HHJA 1S8NA 2GZSA 3X2FA 4HAWA 3ROQA 2FK8A 1A96A 1Z5NA 2QUIA 5A0FA 3I9FA 2YJ4A 2ZAOA 3NXKA 3STYA 5BUQA 1PIWA 1D6SA 1K7SN 2W0MA 5B4UA 5KINB 1PFUA 2HMVA 4NONA 5DISB 2OD9A 3E8XA 3IVGA 5AUQA 3FNBA 4K9OA 3RHZA 5JG7A 3TNFA 4L2IA 1JNYA 3JTMA 3KQPA 3E0QA 4MARA 1LTQA 1RE1A 1WMAA 3U61B 2QGZA 3KVOA 2WRZA 5EJ8A 4JB2A 3HB9A 1GDTA 2GLXA 2BAGA 3K0FA 2Q27A 2CF5A 4R2JA 4GL2A 1PJZA 2OL4A 2VDWB 3CIFA 1I7QB 1LS1A 1LDEA 3PEVA 3A25A 4PZ9A 1N1GA 1XTZA 3KTDA 3GUUA 3R0IA 5KOJB 1USKA 1PFVA 1C0EA 1VLLA 2HWKA 4JCOA 5KAPA 4KNYA 1IN1A 3WLAA 3WLPA 1KY3A 4GC5A 1WBJB 4HGRA 4A6XA 3SQWA 3ZLBA 4TZ6A 2HEGA 3H6GA 1BYUA 1U9CA 3CZ9A 4DIKA 4PWZA 4REMA 3A3PA 2XRZA 4R9SA 4RSMA 1UH5A 3SLRA 3HV0A 1LI7A 3T5BA 3VYUB 1ZC3A 1IAQA 3WB1A 4ZQHA 3DWIA 1BHO1 2C97A 2XPCA 5CFZA 1TJ5A 1N5RA 1NQXA 1RM4A 3PHHA 1OBCA 5IVHA 1I24A 3OTQA 1E69A 1JPJA 4MAFA 3RS3A 2B9VA 4WESB 1WUJS 2F1RA 1QZUA 3JYPA 3TRJA 4XSHA 4ETMA 4D0SA 3VYTB 2WPDD 1R2QA 4BAUA 3Q2IA 1D4FA 2ISQA 3GW8A 3DJYA 1U2GC 3DEAA 3JD4A 1P9NA 1ZU5A 1CVIA 3C5WP 1T2NA 2BEUA 2BF4A 2PZJA 5ALUA 2O23A 3UXMA 1CP3A 1WKBA 2JDID 3KAKA 1N75A 1WW2A 1YB7A 3SK0A 4YEDA 1MIHA 4JC8A 4HY3A 4PXSA 5B3KA 4WJLA 5KDOA 4MIKA 1KOGA 2Q0QA 2G9RA 4CZ2A 3I1FA 2GEKA 4HR7A 2Q1TA 2ZVPX 4I9GA 1X1SA 3QBTA 4XVQA 1U1IA 5EXTA 2VTEA 4OQNA 4AY2A 4MS3A 3TEJA 1RLJA 4D9JA 5C5CA 5JS6A 4H4CA 1BWRA 4HEA1 1U7TA 1FIUA 3UOGA 3NTRA 4JODA 3DTVB 5CX1A 5G40A 3T0IA 1E5DA 3QIVA 5KDDA 1BN7A 1EUZA 3IBFA 3ZDAA 3L8ZA 2FUNB 1QHYA 1XKXA 2Z5GA 3C48A 3E03A 3MZ0A 4QO7A 3VYVA 1X8XA 2XF8A 3DAOA 8ATCA 4NDNE 2H4JA 1DFIA 3LY9A 3D8RA 3DMTC 1QM5A 3M6VA 4WW0A 5FJJA 5JS2A 3QPWA 3URMA 1GZHB 1P5HA 1AKQA 2O1EA 5A5VA 1ESMA 2P30A 2OGZA 1N3LA 5T3YA 3WK4A 4U3JB 1USVA 3SOPA 3C7TA 5CU7A 1L5ZA 1Y81A 3HFRA 4JEMA 5I7HA 3O38A 3DMRA 1KPHA 4F2WA 1N1EA 2G1KA 4LYAA 5ABPA 1XF1A 3GEMA 1C7IA 2X86A 4LWZA 2HJRA 5LBTA 3ENNA 3FPJA 1NZJA 4CKCA 3IDFA 3QUAA 2QTAA 3NANA 2NZVG 3EQ8A 4MLCA 3OCCA 4O1MA 4CEIA 2QDXA 1K2VN 4R8KA 3VI3B 3W5CA 2WG1A 4C78A 1EXWA 3EASA 4KMSA 1VL8A 2RKOA 3LUKA 4BFWA 1R64A 2RH8A 1Y7HA 2AQKA 5KNCA 5LM3A 3IODA 1Q15A 4DYDA 4L4YA 2LXNA 5IM5A 3MCWA 4L0DA 2OBYA 1W30A 3LOPA 1T5LA 1FPMA 1XEWX 2ZIVB 3VBEA 4BN0A 3TK1A 4RKQA 4G0NA 2ZK7A 3L6OO 1W29A 1KDZA 3GC6A 2ZYRA 2C7GA 4F86A 3JAWB 3NHKA 5I9SA 3R5FA 2VYFA 2CFCA 2VXCA 3CO5A 1BDJA 3FVWA 1KAGA 5EUQB 5H59A 3BQ9A 4YJDA 1NYLA 1N6OA 1DU4A 1E5VA 2DHEA 1Z28A 3V8QA 2Z98A 3B1VA 5IN4A 1QSGA 2WWFA 1F48A 4WK6A 3K6KA 2AEFA 4LZNA 4ZDJA 5L4NA 3AV3A 2YCBA 2HTFA 1EUCB 2WWWA 3KTAA 2HK8A 5DF1A 1FSSA 4LYYA 2VJDA 4MPRA 4ZQBA 4BVEA 3KV1A 4K86A 4URZR 3NDBB 4GS5A 1THZA 3WYNA 1Z16A 2HRQA 2C98A 2WNIA 1JLLB 2W93A 5BURA 2NO5A 1T36B 2Z2YA 2Z3WA 1KJQA 3A2KA 2ECQA 3NT2A 1JQJC 2ACEA 4WDRA 3BB4A 1SCNE 5ITSA 3G2OA 5LXTB 1ZA1A 2H1OA 1Z7GA 2WSBA 1IQRA 1FTGA 1XEWY 3Q88A 2WTNA 4TTJA 3DF7A 2YVKA 3DB2A 4Z8XA 2OHFA 2OG2A 1M7GA 3QEJA 5CURA 4HATA 1IH8A 4YUYA 1JJBA 2I6XA 1W7AA 3ASVA 4KFTA 1M74A 1MXHA 3H18A 3H65A 4U7PB 5P8WA 3FKSA 3PEFA 1HT2E 2G67A 3TZCA 4GPTA 4D3XA 1G4UR 3RSOA 3RRXA 4HAVA 3K5HA 5IJXA 6GPBA 3HM2A 2VTBA 2BGJA 3QLEA 3D31A 1BJTA 3K1YA 4I9FA 5KMGB 2JFFA 5HWSA 1MP0A 1SBNE 1I36A 3C2QA 2D54A 4G0VA 2D7DA 1Q7RA 3WBKA 1KWKA 4DPMA 3LBYA 1DBWA 1HA3A 2C3PA 3QENA 4Q47A 2WC1A 3WMWA 4HB3A 3OEHD 4J3NA 1UPFA 1HF3A 3RHTA 3E5RA 1Z6TA 1B14A 1P5FA 1XG5A 2G9VA 2CNOA 2Q6LA 1XUOA 3KO8A 1WV1A 5U1PA 2BHRA 4EYQA 3O03A 1W9MA 3DLPX 4W5RA 4TS4A 1VA4A 2VSNA 4G41A 5KVSA 1DFHA 3FPLA 2GPJA 4HDSA 4DTIA 1N2CE 3KL4A 1CTQA 2CYBA 1A0OA 2P9FA 3QX7A 3WJAA 4E2XA 1UANA 4KOEC 2DFTA 2AUMA 2I4RA 3N2YA 4OBEA 1OHHA 3LDHA 2HLPA 3RPEA 1GWNA 3WI7A 1K0FA 2J3LA 3L9WA 3OAAD 3OO1A 3QVOA 5E6RB 3ZBQA 7REQB 1ZAYA 1Y3DE 2HPAA 5BT8A 3C8DA 2IELA 3HJBA 3C8UA 3L6EA 3AIMA 4R31A 8LDHA 3F78A 1XLVA 4Q05A 4D82A 1CUZA 2IBMA 1Z8DA 4HNAB 3TZHA 4GNRA 4CL2A 6CHYA 1MV8A 2IPXA 1EVLA 4HH3C 5CFPA 2WM9B 2P78A 1KHHA 2ZS9A 4ZT5A 1AQLA 3S1AB 2PGJA 1RCTE 2QWXA 5GOTA 3L8GA 3BWXA 2H5LA 2WM3A 4D79A 4LV5B 5KOIA 1AHPA 4FONA 4NL4H 2X23A 2JGDB 1EFVB 3OZFA 4FOLA 4JGIA 3S2GA 4C4OA 4HAZA 4MUJA 2GB4A 2O0LA 3CTPA 4JLVA 4QXQA 3UA3A 3IIIA 2BD0A 4OEHA 2DH6A 1JT9A 1S2IA 2QV7A 3K71B 4P31A 3DWGA 2G04A 1DT5A 2KQUA 5ECGC 3F6EX 5HFNA 2MCFA 3RT7A 1GPJA 1NBME 2FRVA 3H5TA 5LZ5A 3H4TA 2P0AA 3KZCA 4BEJA 5E95A 3G0DA 4L4UA 3CPJB 4UBNA 1ENZA 5DZSA 1DTEA 2IODA 3VAZA 2MSEB 2OYSA 1QQTA 4PC2A 3ZVKA 1UPAA 3QNUA 1H0RA 4LN1A 1RRMA 3OPYA 4PLTA 5JXWA 4PPGA 3ZHVA 2FAXA 2QD3A 1A8QA 1PFQA 5CJ2A 3ZWBA 1A69A 1QIIA 3NHYA 1E20A 2QVZX 3SDSA 4AG5A 1C9DB 3WGTA 3WIDA 3LQ2A 3Q3CA 1NX6A 3ABRB 3VU3A 3LW8A 1L7DA 2GFIA 3UT5A 4P22A 4ZEXA 2ZRFA 1GT91 2ZZNA 2VCYA 2NM0A 3HUFA 3V7FA 4F0JA 2Q2VA 5DNCA 3FXAA 2O52A 2Z1MA 3P5SA 4JJ8A 4QVIA 4EB0A 5JWHA 3PPWA 2C3OA 3DM9B 5KTOA 4RA6B 2KYRA 3BIFA 4HLNA 1IWBB 4LY6A 3T54A 4XUGB 2NZJA 2F6RA 2P3LA 5J4LA 1W49A 2GNAA 3BTOA 1TGVA 3L92A 3LDUA 4EGQA 5KEIA 1SRQA 2O2GA 4D5GA 1LBTA 3FNRA 1KK2A 1QCZA 5BYJA 3K72B 1WXXA 2PJZA 4P7GA 4BUCA 4K03A 3GQVA 5I48A 4XB6B 2D7CA 3K0HA 2O2ZA 2Y0DA 2ZIFA 4KXYA 1XMSA 3FM9A 3IAFA 3REQB 1BS9A 1KEUA 2VAMA 2Z8XA 4AWXA 4DIDA 3ZXSA 1Q1ZA 1RLMA 2CD9A 1QE5A 3MQFA 1RRFA 3H11A 2VP4A 4I6EA 5BO5A 5FBKA 3U1BA 3FOZA 3U48A 1C41A 2PU5A 1R16A 3HUUA 3G8CA 4QYSA 4ZVLA 2YRXA 4ZVRA 2NO1A 1BS2A 5E9JA 4D74A 1I1NA 2H1FA 2ZTMA 1XZDA 2F9LA 1SQSA 4YBZA 4YR9A 4E12A 3HO1A 3D7MA 1QFSA 1PK7A 1J21A 4N3GA 5I7UA 3NGMA 3TRKA 4G0YA 4O2RA 4GVLA 4KR3A 2HXYA 3T7IA 1J2UA 4IQ0A 3H2YA 4DILA 3OI7A 4MEJA 1P7WA 1TUIA 3TLAA 3TW4A 4WZZA 4WLEA 1MW8X 4HH1A 4GI2A 3R9WA 1URPA 3P26A 1Y98A 3SBXA 2NXEA 2GPSA 3AINA 1Q22A 3EC7A 4V0SA 4XM0A 4B3HA 2HQ1A 2XMSA 3ORRA 3Q7SA 4GF5A 5DT9A 2HH9A 5C4IA 1YMQA 2JFWA 1U2EA 1XU9A 1XCOA 3EPJA 4NMWA 5D5QA 3RBZA 4F91B 3AIIA 5FLYA 5TIIA 3PD0A 4ARCA 2R7MA 4RD6A 5DK6A 5BN1A 3WL3A 1WNFA 3Q1KA 5E6UB 5EJAA 2VHWA 3IP6A 5AVSA 1SUWA 5TLSA 4R9NA 4KR7A 5CLQA 4KN8A 4Y6SA 3EUWA 2JJMA 1V4VA 3K32A 3N8NA 5F9FA 4DWJA 1IBLB 1O6BA 2XUIA 2X3UA 3E70C 1UKYA 4YTEA 1AKVA 1KJYA 3NP7A 1X13A 1XX6A 2BDUA 4HL6A 1CRPA 1DUIA 4UAVA 1LPPA 3KFLA 1YJ8A 5HW0A 1H85A 1NOIA 1QOQB 4PYQA 1ZGHA 3DVRX 3RROA 3WE7A 3IPYA 5LQSA 2H2WA 1CR0A 1I1HA 2HSJA 4QBFA 3SJ7A 5TV2A 3SYRA 2VHEA 1CWUA 3GRCA 4FJ0A 4HGPA 4DLBA 4EX6A 2NUPB 5JNVA 1Q0PA 4BGEA 4EF4A 2C9DA 3AUKA 3EFEA 1H0KA 2PNJA 4A2PA 3OWHA 3W78A 3PJRA 3ANMA 3E58A 3WNQA 2I03A 3NM4A 4CPDA 1KMHA 4DHWA 3F6CA 3VR5D 3E3NA 1J2YA 5CD1A 3IEPA 3KUXA 1E3WA 1JDBC 1ZJJA 2IEGA 3NV7A 4AJPA 5B58C 3ZOZA 1IK4A 3O2QB 4CIXA 1WU7A 2YXLA 3I4FA 1L4HA 1E0SA 3NOVA 1YZHA 2ZAGA 3P9PA 1YV9A 4G5GA 2VLBA 4JEUA 4LWOA 5BSUA 3FH0A 1L4GA 1BMFA 1F3OA 1U5CA 2GTPA 1USIA 2X9QA 2GVDC 4Z4HA 1FP4B 3FI0A 3ZD6A 3R3JA 1T3ZA 4LXGA 4AZVA 2VWPA 5J3JA 1YULA 1AQUA 3S81A 2O5EA 3OY7A 3N0RA 1CUEA 1E2EA 1UJ5A 3ZKWA 2V6GA 1JB9A 2I2AA 2VUSA 1Q1GA 1WUIS 2X5JO 1L5SA 4KP7A 4DWWA 1NDQA 4YLYA 4YMLA 4CEJB 4ND7A 4DCMA 4QTXA 4QM7A 1GPKA 5LYJA 4MVJG 3UK2A 3QFSA 1L1EA 1B2LA 2H0RA 3I45A 4YPVA 4A15A 5IT5A 1N5IA 3MMNA 1QC5B 2VNKA 2WIFA 3LO8A 1NJ8A 1VECA 1JVNA 3RSHA 1M1XB 1TM1E 2FY8A 2DB3A 3BZBA 1VPLA 2P41A 2FSFA 4MNTA 3ANTA 3I2JA 4B83A 4PZ0A 3TEFA 1QK4A 3KOWA 2ST1A 1A4UA 2NSLA 3WBFA 1DUVG 3GH1A 3QPCA 1YA4A 1WS6A 3OF5A 3NHAA 1SXJA 1U3GA 4LJAA 2H65A 4MQEA 4C1NA 2RI6A 1GVNB 1SOMA 1WULS 1XI2A 2D7JA 1JTVA 3OUZA 3ZHXA 1G60A 3OUUA 5FWYB 4AMUA 4D0LB 4DV4B 5FO1A 5BSGA 5JAIA 1PV4A 1MG0A 3I6QA 2G08A 1OF1A 3I37X 4FEGA 2A1TR 3BS4A 1AZTA 1LX6A 1N36B 1LA2A 4NG5A 2IBSA 3USCS 2EQ5A 4UXJA 2DFKB 5DTRA 1F17A 1KYQA 2CJPA 2Q8NA 3A6JA 4BZPA 4REQB 1RWMA 1EZ1A 2YYZA 1QFJA 1X9HA 5DRTA 4LZZA 4Y2TA 4B3MB 2BEKA 2WW8A 3TFOA 4HBGA 3BMOA 4KZKA 4TLMB 7GPBA 3BD8A 4GKBA 1U8YA 5AI0A 5M04A 4MULA 5H8WA 3QF4A 2IU4A 1E32A 3K9BA 3GVIA 2PG3A 4E5DA 2Q5EA 2WAOA 2POQX 1C3OA 4DV0B 2XMPA 1GTRA 2GBCA 5HIAA 4INOA 5GONA 1BMQA 1Z38A 2RGGA 2F17A 3WNBA 3THWA 1L7AA 4OY3A 1ODKA 2GZ3A 4EMSA 2PT9A 4GMXA 1U6KA 2XVAA 1YGPA 3D4IA 3R1IA 1XB2A 1Z35A 2P9YA 5TPZD 3R0JA 3GJQA 1KMIY 2LCIA 3DHYA 3ETLA 1COZA 2AYZA 1KVUA 4GKVA 3WGLA 1G3MA 1MC8A 2OZKA 5HEKA 5K8TA 5C51B 1FRQA 2ZRLA 4DIEA 1KEEB 1XE3A 2L19A 1RDFA 2ZRAA 3FRIA 5BV2P 3IAHA 3F8WA 1OIWA 2XW6A 4Z7OB 1IXZA 3U31A 3A3KA 4HPWA 2TRSB 3EF0A 3AL3A 3HJFA 1C3VA 1H3NA 2PJRA 4Q4HA 1VC2A 3PI6A 4WHMA 5EJ7A 5TVKA 2D4HA 3VU0A 3EZFA 3QUTA 4RIFA 2OWDA 2QGNA 5BP7A 1FYFA 5CRIA 5DCYA 5GV7A 5JALA 3SX0A 3PD7A 2GYYA 4JLPA 2ZGVA 2FSIA 3WQBA 1JEAA 1GRRA 3GVXA 1V5GA 3UATA 1E3TA 1FU8A 4O59O 3VOAA 5L3SB 1UMCB 1ZGZA 2HZ7A 3HXQA 3DVAA 5G4KA 1E9VA 3QOXA 4OFXA 5KCMA 3S0JA 1YJAA 4IMPA 4K9RA 4G5YA 4F4FA 4JT8A 3IUQA 2JGMA 3BWBA 2RHDA 3KR0A 4NYIQ 2BZGA 5IBCA 3OLCX 1VE5A 4Z9BA 3JWHA 2ORWA 3OF2A 1OX5A 1ZRSA 3OZAA 3PQEA 4PC1A 4PSUA 1DJLA 3ZD9A 4CKWB 2PT5A 4PLWA 1DTWB 5FR2A 2NYRA 1CQIB 1H1LA 4EKYA 2VF4X 5CXQA 5JYDA 3ZQKA 4ASUD 1KVRA 4BO5A 1QF9A 3NHSA 4Q00A 4A2CA 1KEZA 3A1NA 3EZGA 2W8ZA 5CCBA 2HR1A 1VG9B 4NJOA 3HP4A 2WI8A 2FN7A 3DT9A 4JOBA 4N7MA 1R4ZA 2B3TA 1RAAA 1KFJB 4Y6QA 1JFFB 1R0SA 3KAJA 3QKSB 4BX9A 5IHXA 1F9AA 3NBAA 4BNDB 3KEGA 3PPIA 2YNMC 4ZI3A 2GD2A 3DLIA 3O3NB 3AHDA 1NLZA 2PKYX 4KQJA 1BX0A 3F46A 3DKKA 3H9CA 1PZMA 3QLUC 4KPGA 3CVXA 4NLLA 4WNAA 3F5FA 4UDOA 3QYPA 3EFOB 4CFSA 3UXYA 3QPUA 1BIFA 1BN6A 4DM7A 1T6ZA 3CX6A 4JUIA 4D9KA 1LRKA 3GCZA 2C57A 4CL3A 2P67A 3HR7A 1UWCA 1MOZA 4HG2A 1BEUB 4LY9A 2V3WA 2JAPA 3N2IA 3GAAA 1CUWA 4P4LA 1C7QA 1Z7EA 5F3RA 2ZRBA 3ZEIA 3X1DA 2FWAA 2VQEB 3EVNA 3BGSA 3HDJA 3IDOA 5JMWA 2EJTA 1WSWA 2EKQA 3UG6A 2RHRA 2QAGC 3RAGA 4RCYA 1X7XA 3GLIB 4DCNA 4G4IA 1EK5A 1ADGA 1E7SA 2Q99A 4WCVA 3LDGA 4RIGA 2PX5A 3EEYA 1M2GA 4CT0A 2JJYA 3LYLA 3M6AA 3L41A 5GGXA 4YV0A 1KEKA 2F4VB 3GP3A 3R4VA 1JIVA 4X64B 1T2UA 2MYTA 4YUAA 1RKBA 3SYTA 4OKNA 5FPYA 1XTRA 5T6BA 4Q1CA 1ZUIA 1C4XA 3L4BC 1KMQA 5AVXA 2W2QA 1O03A 2BM0A 2OCLA 3EPRA 5DSZA 3OJCA 1ODIA 3L0YA 4KGXA 4I5DA 4NU5A 2ONZA 5KUTA 2RD2A 5K0TA 1N5OX 1PW7A 1XROA 2VPIA 4HNQA 4HPXB 3TB6A 5EHXA 4RTKA 1AX9A 2ZVJA 3TTYA 1TK9A 4MRSA 1MC4A 4ALMA 4MIYA 4KQ6A 3Q0IA 4QGSA 3AH8A 2W2PA 4IQFA 2EBFX 4PBSA 4CLXA 4NCIA 2CHUA 2JL1A 3Q3VA 3H4VA 4R8LA 1XJWA 1Y4AE 2LRHA 4AZ0A 1H5UA 5LP6A 4QYWA 4GPAA 4W5WA 1I2AA 2R0QC 2BR5A 3BSSA 4MB2A 2XJ4A 3TBKA 1PDWA 5K7SA 2FMIA 4MHOA 4PW0A 5FR1A 4CU5A 4EJFA 4OB6A 2DECA 5TARA 3S40A 4XEHA 5GGYA 5AW7A 5I6DA 4QASA 1G55A 1IEWA 1SNYA 1XTUA 1DZ3A 4QDTA 4XW2A 3TW8B 1P7ZA 1CZOA 1NMXA 2CNWA 2X22A 1KMCA 4HXYA 1LNZA 5ESWA 3S29A 1JEOA 1V25A 3PKJA 5LWHA 3H2HA 3LUDA 4AUNA 4Y67A 1XXHE 3EARA 3ECCA 3CZ4A 5EJIA 1M2KA 1X38A 4A8JA 4JYZA 4MI1A 3AC0A 1XQWA 3SJZA 1PT9A 1IZ7A 3VR2D 1TD1A 1N9ZA 1SOWA 4UU0A 1KJJA 2NTYC 3CR8A 4NAHA 4R3WA 1YSCA 4YONB 1RQPA 3NNSA 4IYJA 4WXHA 5IKMA 2G4CA 2XDQB 4L8FA 3UXEA 3WR5A 4ZDWA 3ZH2A 1FX0A 3ZWCA 1A5ZA 4LV6A 3DBVO 1ZGJA 3L6BA 3QIAA 3TMKA 1KVQA 3IERA 3JCZA 4IWYA 4L8LA 1EM8B 4I55F 3ZIAA 4RQUA 2FZEA 1D6NA 1C9NA 1JH8A 4O4IA 3C97A 1BH2A 3Q3EA 4KWHA 1EQUA 4NV3A 2CWDA 4B3XA 4J9VA 1L4EA 3NWBA 1UXJA 4NATA 3O1LA 5DHTA 4R2XA 2JFPA 1KP2A 4KLAA 4PGAA 3HPRA 2ERXA 4WXPA 3T12A 4MAMA 4G4GA 3SKXA 1ISHA 1K6IA 5AIAA 4XQEA 2R5WA 1GVHA 1DKMA 2IUYA 5JFOA 1E1LA 4RVNA 5LMUB 1MVOA 2BFCA 1XMXA 4GP7A 4UD6A 3X1MA 4D56A 2V1UA 4MI6A 2NP7A 4B2IA 1GO2A 3IBGA 3QE3A 1CP2A 1ZX1A 5DYTA 4DMUB 5ALMA 1TIPA 4JUDX 5A2QA 1Z83A 3I04M 4OQFA 1ZPDA 2QW1A 4EEZA 3EXAA 1OX4B 2JH9A 3A6EA 2J6BA 3IOMA 3W05A 5LBUA 2WFLB 3CZ5A 2IPOA 2JFBA 5HGJA 2P62A 4N3AA 4P33A 4QQNA 1WL8A 4Q6BA 2QEQA 1CUJA 1QAMA 3HJGA 4LYFA 1VG8A 4CQNA 2HLDA 4JXXA 4FU0A 1NBWB 2X5KO 3M3DA 4M1WA 4PXYA 4KE8A 4BQOA 4CKBB 1T1JA 5CA1F 4LF5B 5C81A 2WHEA 3E7PA 1GFIA 3AHGA 3QVMA 3H0KA 3ZE7A 4D4LA 3P27A 3T52A 2UYCA 1C9JA 1S5PA 1CE8B 4C22A 5G41A 1Y8AA 1Y8CA 2O5VA 2ONCA 13PKA 1LLDA 2PH3A 3IAUA 5AXDA 2GERA 1DEOA 3CEHA 1LVUA 2R6DA 1JSLA 3ZU4A 3RADC 3OEEA 2HU5A 3O90A 2GDZA 3S8YA 2ZKLA 2BELA 4I8DA 4MUKA 3C3EA 3UB4A 4CMBA 3CRRA 4C20A 1F8GA 5TQJA 1MFPA 1OR8A 2ZTLA 3R3VA 3IQWA 2XQIA 3A4VA 4HLUA 4KBGA 1JHVA 3JZDA 5TMEA 1OLUB 1EUQA 3PUHA 2XCOA 3L7JA 3E7WA 1RQXA 5LPNA 4W1SA 3DFZA 4TRJA 3OAAA 4ZRDA 5TQVA 2XHEA 1UJNA 2I6UA 4BRWA 4JIMA 4L08A 4MUMA 4I4TB 1NXOA 1OYVA 1D2MA 1C3LA 2OHXA 3QU9A 2DKFA 4QUHA 1DP4A 4FCWA 4E5MA 4EYEA 2EDAA 3C4JA 4RF5A 4MS3B 4XQGA 5ERYA 2ZBFA 1KH1A 4LZPA 4PYOA 4RH1A 3SVTA 4FN4A 3BG5A 4A92A 1B0UA 2BKLA 3CT4A 2HJVA 3TJRA 1WUYA 4PCAA 2C4WA 2OFOA 1WCIB 4PHCA 4RHEA 2BM1A 4KPUB 5EE0A 5FWDA 3C85A 2EDCA 1PZGA 2X13A 3D59A 3TE6A 2EP8A 1IHDA 1P33A 2YW9A 1QGDA 2EFCB 2J7PA 1Z8HA 2VC2B 2QRQA 3EVTA 3MGGA 4M7PA 4KRYA 2K7ZA 1Y5RA 5IMBA 3RYTC 2FSHA 3GFBA 4BJHB 1QZXA 1VFPA 3E5MA 1XNRB 4MRAA 5K3FA 1WZCA 1T5DX 1T8WA 1R6TA 1ZD8A 5HQ3B 4TUYB 1C3EA 4HNAA 2QRKA 4I4TF 1N77A 1RBZA 1PWXA 2I9PA 3DL7A 3JQ9C 3I58A 3MWDB 3VDNB 4DLUA 1RQRA 3F8SA 2YINC 2WD9A 3Q9LA 5CYPA 1FS4A 3ZWKA 1P3DA 4HQ0A 3KJGA 4MR9B 3DEFA 5FI3A 5LA6B 2JCXA 4Z4FA 2X3YA 3ZEAA 4E30A 3GUYA 2WU8A 4QYXA 2JLWA 1X7XB 2VZ8A 2QUHA 3VSCA 3PLAE 2H29A 3DVSX 5B36A 4C0XA 4HVCA 4LBVA 4A23A 3BE5A 4JY7A 3WGVA 5A02A 4TMVA 1W36B 2O6LA 3FYUB 1G9SA 1Y1TA 3V8RA 4MGZR 4BQSA 3REQA 3NTVA 3G59A 4YACA 3VO1A 2XNKA 3EGDB 4LPSA 4X8OA 2D62A 2NXJA 3HKDA 3PJEA 2R1TB 4DAOA 3DBRA 1WCYA 4ZT4A 4FZ3A 1EEHA 1FNDA 4NK5A 4MVJE 3CLSD 1D2CA 1Y5NA 4FGLA 3SF8A 1TYAE 4EW2A 5HM6A 1SIUA 5BW6B 3W06A 3BXFA 3DG9A 3H86A 2QMOA 4HYEA 1SVSA 2R4TA 1TZJA 2VRWA 1N2XA 2XOKD 1BOOA 3N28A 4Q0MA 2QMZA 1D9ZA 1NVBA 2A35A 2DUNA 2YHSA 1RSZA 1UBGA 3RCBA 5I4BA 2VHXA 3DAHA 4KGDA 5DX1A 3BL6A 2DVMA 4X54A 3I83A 2ZIWB 3Q9SA 4CF3A 2ZIEA 5JAOA 4RMNA 1W36C 3T41A 2CXTA 1XHFA 3HDQA 5C5DA 4KFCA 4EHNA 2QXTA 2NO9A 5BXQC 3LL4A 4CLRA 4ALNA 1EUCA 2ZUTA 4QG7A 1GKLA 1UMBB 4Q3OA 3KKZA 3S4YA 4KMMA 3WO1A 1W36D 2I1LA 2MSLA 2GN2A 5LN1A 3FZNA 3HGQA 1BU5A 2IKQA 3EF1A 3CEAA 2BKAA 3F6PA 5TGDA 4CTKA 3HSYA 3SQLA 5KYNA 1CVLA 1NYRA 1UK6A 4LJRA 3EVZA 1UDBA 3ZWOA 1ZJ4A 1U3WA 1A7AA 3FDJA 2VDQB 4I99A 1UWLA 1S8FA 3ABOB 3P19A 2DKOA 4N47A 1TA4A 4YYEA 4M9RA 1N3YA 5JE8A 2I6FA 3W2HA 1E4OA 4YXWA 1ZSYA 1QQAA 1MRZA 3D6AA 3TLBA 2BFBA 3CFYA 1E1CB 1NQUA 4FLEA 1N8KA 4DQKA 4ENSA 3TLZA 2PKQO 2I9KA 1N5JA 3AERA 1WB6A 1DAHA 2ZB4A 1JHZA 4IO1A 1EP9A 3AZPA 4Q9IA 3AKEA 5K0SA 1OKKD 5JYEA 3VDXA 4P32A 2ZWVA 5E7IA 2MINB 2PK3A 1KI3A 1NRWA 3F3KA 5TPWA 4XAQA 4BQRA 2BMVA 2O3QA 5BVGB 4DBVO 3CRVA 4MI3A 2E1RA 2AXPA 1PR6A 3LDAA 1Q0HA 3QKTA 3QUCA 4CW7A 2XDYA 2JCBA 2YVUA 1AS3A 1RP7A 2CLOB 3RUHA 1AB5A 1UKEA 3HJAA 3R7DA 1PWHA 3RS5A 3KKEA 3CEPB 2XGMA 1SG6A 1XZAA 1SXJC 2FF5A 1YL7A 2PZEA 4DLLA 1PJSA 1GZ4A 2ZWPA 1MTOA 4R1TA 1M83A 2Z57A 3SMQA 1N6NA 4W8GA 1W44A 4GZ3A 3N0TA 1KBOA 1K86A 3A1CA 4R7ZA 3ZH9B 3E22A 4EY5A 3PT5A 1EWVA 3OWXA 3CH4B 5ALDA 4ZODA 5BRNA 1CJMA 4I4LA 3UUWA 1H0HA 1S3IA 2JGEA 3FCCA 4NBNA 4MSUA 2COEA 4ON9A 5FFFA 2M1XA 1VKHA 3NWPA 3WJ2A 3H3XA 1DC4A 1P2SA 2GILA 3LT0A 2RARA 5SZJA 3CX7A 4OXNA 2Q3FA 1P74A 4C5AA 3AR8A 2XYGA 3ZGLA 1A9RA 3GRVA 4RKWA 1CETA 1QIJA 3B5IA 3AGQA 3BRSA 3BH7A 3LVRE 4YS6A 3W5BA 1GPBA 4Y2GA 2ZWIA 4Z51A 1A88A 3JV7A 3DUFB 4FCVA 3IC5A 5SZHB 3VH1A 3WZMA 4WPGA 4ZYWA 3DMGA 3R3HA 2JGDA 3SS9X 1SXJB 1IIRA 3PFHA 2PD6A 2CLIB 4H7FA 4MIOA 2C03A 2R6ZA 3FDIA 4J07A 4L75A 2C2BA 4YCBA 3S1LA 1KYTA 3O5AA 3PZBA 3BB3A 3G0IA 4PSDA 4F9FA 3O21A 3IQDB 1MB9A 3F3MA 1M8JA 2BGGA 1LWNA 1SVNA 5JDIA 1BA3A 1CEXA 1T0JB 4H1UA 2RHMA 3OCVA 1TMOA 2ORYA 3SIWA 3V4ZA 4D6PA 1I10A 2C4TA 2IX9A 3T1YB 4JI4B 2P6OA 2CFTA 5CDTA 1RI1A 3R76A 1ZVKA 1B6TA 3M6MD 3RWMB 3W7VA 3RVLA 4C21A 1XFDA 3CUEF 1TCAA 1M0TA 1CS0B 1ZESA 2VJOA 3FLAA 3LO5A 4NJEA 1BXRA 1JAYA 4UKDA 3DDWA 1LU9A 1WX1A 3VR3A 4UHDA 4MGEA 3KDPA 4JP2A 4MPTA 4OGKA 1KS9A 2DWCA 3SFVA 2G28A 3VR4D 3W9UA 2ADFA 4ZGWA 1KZHA 4FEEA 1RFLA 4DRXB 5EPUA 1G7TA 2PU7A 2RHGB 4FDAA 4YRJA 3QSGA 1RIFA 1GITA 2G5GX 3CPHA 5IJZA 5K2MA 4KVAA 3LUPA 3D2BA 3K20A 4GM4A 3ZBPA 1NXXA 2FPIB 4UHBA 1Z22A 2DE0X 5D2CA 3DQQA 4PFKA 4IBOA 1O9HA 3RJ9A 3CT6A 3SYMA 5L4SA 1SD2A 4EPRA 1VIYA 1T9HA 2D2IA 3ZCPA 4E1AA 2DFNA 4W82A 4PQFA 1W0KA 1SKQA 1ZQ9A 3IAAA 1K4MA 2JIPA 4LVCA 2AZ4A 3DZCA 3AP3A 4I8XA 3W04A 3B9QA 1JU3A 2OHHA 1ITZA 2POCA 2LD4A 2YZ7A 4HB2A 3ADCA 1O0BA 4JB0A 5AMXA 1SZCA 5BN4A 1VYUA 2PDAA 2XNJA 3G5LA 3L0DA 4FYYA 4OB8A 4AM8A 3S55A 2D2VA 3HKEA 4QFMA 5AI4A 4ZVNA 3WKBA 1YFLA 4ZOBA 4BXOA 4HRAA 4X7PA 2IL1A 1XJCA 2ONYA 1QFMA 2X58A 1IZ9A 3VV2A 2B7BA 1Z4IA 1G6OA 1TVCA 3K16A 4RHTA 3I52A 4N3NA 4C0KA 1RXVA 1PR1A 4O8CA 3HSSA 2ZTUA 3EQ2A 3N8IA 4KG7A 4HEJA 5IULC 5EJ6A 1IXYA 4CM6A 1VFNA 3INRA 1NMQA 3LQ1A 4ZKDA 1K88A 2DJIA 4E22A 4B40A 4BDSA 1GNPA 4G85A 2BEVA 3N2KB 4M76B 2WIDA 4FLFA 4Z1OA 5EJ9A 3S1SA 3SIPA 3DE7X 4AMZA 4FYJA 3QA3E 4MVXA 3HRHA 4E31A 4FM9A 3A1EA 1P9LA 1DJPA 3SJCA 1YZNA 3TJMA 4TYYA 2XITA 4IHQA 3GFQA 2O8EB 3E7XA 3I01M 2IZ7A 3K4PA 3COWA 2E85A 2R8EA 1KE1A 2YY5A 3DPIA 1Z7YA 4V0QA 2F1IA 3M0EA 1I4LD 3ESDA 4PR3A 5AKEA 3L0PA 3JASA 3BWVA 5HF8A 1YOVB 4DQUA 2ACVA 5IC6A 1V11B 2VATA 1OREA 4O2LA 5I8ZA 4F2PA 3BEDA 4PYJA 3BGOS 3VMFA 5K20A 3QYAA 1B6RA 5F35A 4NDAA 2AB0A 4PU0A 5EHZA 2EZTA 4EARA 2B36A 1BWSA 3QMPA 5EWMA 1J39A 3QELA 1N25A 5K4AA 3MRTA 1ZO8A 2F64A 3ANNA 2YHAA 3DE1X 3GHHA 4FCCA 3W6PA 2FEAA 5MHTA 2EARA 2EX0A 1FUUA 2OORA 1ZKMA 2REOA 2WMDA 3PIIA 4GW3A 5DT2A 5K0NA 1KXJA 3BXEA 4MW7A 2QZZA 3QKWA 2OHIA 4H6PA 4U5QA 2OXFA 3D0KA 3PHLA 5TPZA 2ZDGA 3IEVA 1ZM2A 1P6UA 4P3YA 4QOSA 2CEAA 4EQ6B 4D9HA 1USWA 2Q49A 2ZSHA 4B44A 1DL5A 1RYEA 1NVXQ 5BSMA 4A36A 1SXIA 2V7GA 4AN0A 1NVVQ 1QUEA 2ENUA 4TYPA 3TKLA 2OC9A 3PNOA 3E9QA 4XH9B 1A2KC 3X3HA 1YS7A 1C3XA 2CNNA 2HBRA 521PA 4J0CA 3TLKA 3RS2A 5EIBC 3N07A 2ZPUA 2RJ3A 5EUBA 5FOVA 1G7CA 2I4OA 3DC2A 2CJFA 4FHEA 4RMJA 5DBOA 1MEJA 2RH4A 2XCRB 3F5SA 4ITUA 3TCKA 1K89A 3BK1A 5I3CA 5HF9A 5J4KA 3F1LA 3TOVA 1A8SA 3I5UA 4IRUB 1FSPA 5EWLB 2G0NA 4PXAA 1GCGA 2O4CA 4YQYA 2QL7A 3GJXC 3R3SA 3I72A 1EAYA 1PF7E 3SNKA 3KUCA 2ZYUX 1FSFA 3GBSA 4TYMA 1MV5A 2RHCA 4I2VA 3CLSC 2BHLA 4ZIRB 4M0UA 2XUAA 3EQZA 3MELA 4R9VA 5I9TA 4HDOB 1T2AA 3RKUA 3RC9A 4KQCA 1H4QA 3RTGA 2ATEA 5ALSA 4AY5A 3I2HA 4EOGA 3RTCA 3JZAA 4BPBA 4G65A 3JQBA 3BVPA 2WQ7A 5E9QA 5B5SA 1TADA 1YR2A 4H35A 1JQ5A 1SRRA 3H0CA 4LY0A 3SSMA 4JYBA 3SF0A 4KX5A 1F4VA 3GUZA 4FFOA 3BM5A 1CEQA 1EP1B 4BLVA 3GG9A 1Z0AA 1DKLA 2AC4A 2QN7A 4GMDA 3HP1A 4B4UA 1RPAA 3B82A 1GA1A 3C8ZA 5HDQA 3WBJA 1FQWA 1QTIA 4XWKA 2OBFA 2RE8A 2WJIA 3E9RA 3F49S 3L2OB 1RZRD 3CUSA 4E3ZA 3ZLJA 4PSVA 1TJYA 1JDPA 1U3TA 3P2OA 4KAJA 4BNWA 4B3TB 4IS3A 1E2JA 5ILQA 1VLVA 4NOMA 4TXLA 4DF3A 1PT8A 4X6YA 2V6FA 4TMKA 5IJAA 2WF7A 2AIRA 2DPMA 1U4NA 4L7QA 1T9KA 1JJFA 1YNOA 1Z73A 3INYA 2HD4A 2PSHA 1QP0A 5CLGA 3ILVA 2N0SA 2VR1A 3OLVA 5L9AA 1FY2A 3H5IA 2X1LA 3M1AA 4J2HA 4QEZA 3UENA 4DBLC 1T4BA 2J46A 2QT0A 1NI4A 3WK8A 5B55A 2VF7A 2UYYA 4FQ8A 4TV8F 5FWXB 3V4RA 2WKWA 1UBOS 4NH4A 3STHA 3LY7A 4CIDA 4LDJA 5U9CA 3FR8A 2QMYA 2BFMA 2WPNA 6Q21A 2P2YA 4KQ2A 4EKGA 4Q4HB 1T5SA 4Y1RA 2CHFA 5IVKA 5H4GA 5IMSA 3DE0X 3OFVA 2GJ8A 1JQLB 2Y1EA 1JJ7A 4LK3A 3C3XA 3EDYA 1PCXA 2C2GA 2FKNA 1IY2A 5FTLA 3ASZA 4IEEA 1VCNA 4PZUA 2JFVA 4X93A 1J0DA 1UPTA 1ZGGA 3P2IA 1SHLA 2QTZA 1UMCA 1N9KA 4RY2A 2NV0A 2Q6OA 2ZRQA 4CI9A 1P7PA 3G1WA 4CTOA 2FWMX 1PL7A 2NX2A 3ZI0A 1GN8A 2R8RA 3P0JA 3K6JA 3QOWA 4DNFA 5F12A 2GBGA 2I2WA 1V7CA 2HDWA 3NBMA 1V9SA 1XCPA 2H8KA 1U0JA 1XR3A 2J9RA 4NECA 1YZTA 1FFXB 1VQ1A 1DTSA 3PUVA 4L78A 5A1TA 1GY8A 4MITA 2HNKA 2W4MA 4ZAZA 2OCPA 1SN7A 1L5HA 2WNHA 1KR5A 3IMEA 3AUAA 4D3YA 5ITWA 3B6IA 1OGJA 2H16A 3DPUA 4B0PA 2CN1A 3ESZA 2CXOA 1C7JA 1RFGE 4P86A 3L7YA 3Q7PA 4ENUA 1JR3A 5IASA 2FZLA 1Z26A 2NVUA 2Q0XA 2SKCA 3NPMA 5FHQA 5KWJA 4KQ1A 3I9JA 3KB6A 4B75A 4CV3A 1MVLA 1ULBA 4IZHA 4S0ZA 3FYCA 1DKNA 1CRQA 2J7PD 3UQZA 1H05A 4YRLA 3FMVA 2ZITA 3AEYA 1KTVA 3OZBA 2VF5X 1QO0A 4O08A 4FKZA 5FOSA 1L1FA 5F1OA 2BCJQ 3QBEA 4Y2PA 1JIIA 2AR7A 2V58A 4PLYA 5HIIA 4YV7A 3BF8A 1SOAA 3PI7A 4FGSA 2O8EA 3I04A 1X86B 4YDSA 3EW7A 4ER6A 1SUEA 3MTDA 1M2JA 4QOFA 3RFTA 3W4JA 4GLLA 1C0KA 3U0BA 4NCNA 1JEYB 1I3KA 3CLTD 2W42A 3OCZA 4ER5A 4IDGA 1R9JA 1X1BA 4R6WA 4RADA 1KO1A 2HIGA 1SU8A 1FS6A 2WJVA 4I1RA 3OOEA 4LRWA 1YJQA 2VNHA 3JY6A 2V7QD 3C1UA 2DUJA 2H85A 3OKFA 4DS3A 1EA7A 1C14A 1QGYA 1YL6A 5HQ3A 4WCDA 3FCOA 4I6JA 1DB3A 2OM2A 3IR7A 4HXFB 3SSOA 1QX3A 1Q11A 1T8YA 2W00A 5BMVF 1E2PA 1ZVMA 4ML3A 3CZPA 5AJVB 1VPTA 3G9UA 3MRVA 1BJRE 2VP2A 3TMYA 3GJ3A 1YCGA 5BWOA 5IWAB 4LE0A 2H57A 4OL0A 3RUEA 1ZCAA 4DCPA 4IKEA 1MOQA 1DE0A 2V55B 2WZDA 2JLZA 4MRVA 2WJWA 4QATA 4RPIA 2RAFA 1H2AS 5F1YA 4CM9D 2FDCA 2X5OA 4YB8A 1NQOA 4GPBA 3I28A 2BFEB 1NVTA 4XCVA 1OLXB 4C08A 2G1UA 2HLDD 1H2BA 2A78A 2XVYA 2ZS7A 3DXZA 3HACA 4O5AA 4Q37A 4Y7CA 2QW0X 3GNTA 1YZGA 4LZWA 4H1HA 1F5NA 3UZUA 3BTSA 2FW8A 3X2SA 1M8FA 4OHXA 4ZAGA 5CG1A 5BQFA 3VKHA 1GEGA 3GY0A 1OFIA 1KPIA 3SF8B 4A6PA 4W9MC 3ZCQA 1J06A 3LTEA 3OCJA 1U2DC 4EHHA 3VHXA 1JILA 1RKVA 2UDPA 2JEOA 2ID4A 3H42B 4XYMA 5LZ8A 1V47A 4DJJA 3HL0A 1AXRA 1PNVA 4QYIB 2NU9B 3QLVC 4KBFA 1JHDA 2JFOA 3WG9A 1SCAA 3RS9A 2IDKA 3DHWC 1DNPA 3LS2A 5JD6A 4RL4A 1ECBA 1GGEA 1RM0A 1ZITA 3OZRA 4H17A 4DQLA 2VOEA 1R0CA 2YOGA 4DMKA 5KPDA 4F4UA 3U7FB 2MOKA 3IOEA 3JQ7B 3SYNA 2YUIA 3FLBA 3OQ1A 2O50A 3AF0A 3ZY3A 1Z39A 2WA2A 3D9QX 4PY2A 3NIWA 5KNLA 4AS1A 3NAMA 3OOJA 3D2AA 4JBWA 4WJZA 4Z86A 4PNPA 1K4YA 1QTRA 2ZRHA 4HAUA 5HMMA 2E4UA 3KQSA 2B82A 3PLRA 5AO9A 4DLWA 4FOSA 3ZIAD 2QI9C 1J8VA 4KMOA 1H2WA 5B58T 2PR2A 3V7UA 3U4DA 2WFAA 1XHEA 3AFHA 4R9RA 1Y3IA 1YQ9A 3ZY6A 3NO4A 1SWWA 3U4MA 5CK5A 1TRKA 4ETNA 2HA6A 2Y1XA 1YZ3A 1JHMA 3HEAA 4EGFA 5CBKA 5IKEA 2JK1A 4YJ3A 3OEHA 2O8BB 1I0IA 2BGLA 2FX3A 2NACA 1ILWA 4JK3A 4CF4A 4D8YA 3D2LA 4WWHA 3W9BA 3TM5A 5C52B 1MB0A 5AQEA 4Z99A 3HNRA 2OKGA 4KL8S 4XLZA 3V1LA 1C2YA 1L5KA 4DT1B 4UPVA 2Y4OA 3IH5A 2WYWA 3OZDA 1I2CA 2AI3A 1FTWA 1ZS9A 4J6EA 5IAAA 3JYNA 3MMXA 1VGVA 5B3JA 1M72A 3O8BA 4G8BA 4NFHA 1MLDA 3RWOA 2B4RO 2I7TA 2CV0A 4YJHA 1US8B 4ZHQF 4DSTA 1N2IA 4Q18A 3VHRA 4IJ6A 4ZHSA 1GIAA 1QHEA 4Q93A 1G8HA 4OFBA 5E4YA 2W2XA 2V0GA 1VBKA 1SVWA 4BQFA 1UPBA 3RV4A 2GK7A 3ROGA 5FH9A 2VUIB 5CIQA 3JAWA 2QYHA 1JHPA 1S1MA 3DW3X 1JW9B 2QMQA 4BNVA 5TEWA 4B6FA 5AJZA 5EPEA 5KAMA 3ZHBA 5H3CA 1GU1A 2PXXA 2GBLC 2FP3A 3F8TA 3N3BC 4MKZA 3R6WA 4BBJA 3ABZA 2PEYA 3LLMA 4AXXA 1ST2A 1W2WB 2Q5HA 1G17A 1UM9B 1Y1KE 1JSZA 5EE9A 5IABA 2V7EA 2WFMA 4FS3A 4IY1A 3ZWVA 3A1FA 3AU8A 2XB8A 3PF9A 4X7MA 4F96A 2FRDA 1Y4UA 4LQCA 5L4LA 5LOVB 2EW1A 1C0LA 2H52A 4BFXA 2WIBA 1K3UB 1MQ8B 4FFNA 2QQEA 2XGGA 2JZNA 3AR5A 1D3AA 1OE0A 2G17A 3M5WA 4V0MA 3NHLA 2XUJA 5IDYA 3ELDA 2V3VA 3VC1A 4C6TA 1N4DA 4K6FA 1KQGA 1I33A 2CXNA 2H8GA 5H1YA 4Q3LA 1DAOA 4BMSA 2ZS8A 5IJ9B 5MFZA 1XIVA 1U0LA 4MKRA 1OLUA 1EFTA 1DIHA 1VE6A 1YRBA 4X45A 4UE2A 3EXHB 2V6JA 2A88A 2EOAA 4MV6A 1GGKA 1ECCA 4BMOB 3UMGA 3W3ZB 2VQSA 5B64A 4Q3CA 3U4GA 3T7CA 3VH3A 4ERXA 4YXWD 5AP9A 1ADYA 1GYRA 1Z0UA 2Y4NA 3IFSA 3KJXA 3BRWA 1B7GO 3ND5A 3P52A 1KE2A 1ZINA 4MV7A 4IFEA 1AMOA 2YY7A 3KAPA 1X0VA 4EA9A 3D6UA 3PFKA 2HJSA 2XR1A 3A2NA 2R4QA 4FR2A 1XRNA 1XYGA 1TZBA 2WM2A 4QYTA 5FI1B 1QR6A 5EIAA 1AOXA 1JX6A 1IN5A 1T5OA 4PLGA 4Q4LA 3ENWA 2P11A 4ZU6X 2IHUA 4D4IA 3SFZA 3D3NA 3HPQA 2G4VA 2CW5A 3HYCA 1J0CA 3S2IA 1T9GS 3GRYA 2WUFA 3K1AB 3U3OA 3W6ZA 4NESA 2PD4A 2H07A 2XD4A 4BCCA 3GO4A 1QNLA 1I5RA 3RUDA 3WHLA 3IUEA 4S1PA 1FVHA 1R5BA 4FDMA 3EXHC 3NDJA 2CXSA 1NG1A 2WABA 3KALA 2GVNA 4TLLB 2H4ZA 5FEMA 5CAEB 1ZM7A 3IKMB 3V1MA 4A10A 4YX9A 5JS8A 1ULUA 3LCVB 3M9WA 4Z4GA 3EPHA 4HK4A 2VDUE 4WFKA 4MR9A 1YO6A 2O14A 2VTDA 3SM3A 4EHIA 1TMGE 4DV6B 1H93A 1HT0A 1XZEA 1M10A 1H8EA 2AMFA 2LR0A 4YRFA 1ELOA 5HR5A 4CODB 2IEBA 4NK4A 4HDNA 2ZBRA 5DYGA 3QOYA 3LPDA 2XXAB 2Q50A 3QLUA 1KO5A 4P36A 3ORHA 1SVOA 1OTHA 2OVFA 3FYUA 4IMRA 4OD0A 3SIXA 1RU3A 2V7UA 2JFNA 2N1MA 4R2WA 4KOAA 4K6GA 3ZDYB 4C4AA 1F06A 4IXMA 3PQDA 2BEWB 2HHCA 2BEJA 3EY4A 4IGAA 1G38A 3ILHA 5BR7A 2JJ1D 1O08A 2CDNA 4P58A 1OOEA 1MQAA 2VJLA 4ARVA 1IBMB 4UTOA 3KPVA 5D7BA 4C2AA 4BTVA 4MJ7A 2PWPA 3HLYA 2Q4RA 4HYQA 4OMDA 3SAJA 4RTOA 4NXNB 3PXAA 3JQAD 1RYMA 4C7VA 3WDSA 2Y27A 5DW0A 4OQZA 1U04A 3LH5A 3E2IA 1RHUA 1D07A 3ZC3A 4HLCA 5AHOA 3K9FC 3HY4A 1YJXA 4GXTA 2ZUCA 3LPLA 4RL6A 1DRVA 1L4YA 1FRNA 3MIZA 3PNKA 4KZPA 1D2EA 3RKRA 1EUDB 2HBYA 2IPLA 4BLTA 2I29A 1FDRA 5JLJA 3NWOA 2AOUA 1I8TA 2B25A 3PGXA 3ZZ0A 5B1EA 4HX9A 3N39C 3G88A 4MQBA 4U2GA 4Z6KA 2E4WA 4DLVA 4M86A 3QVUA 4F6RB 5A7FA 3NZEA 3PKIA 5FLXA 1QBKC 5FUWA 4X1KB 3KRTA 3I73A 5AOCA 5FULA 1CJBA 2F8TA 3JQ8A 2HKIA 1DXHA 2O1WA 4JX8A 1ZBQA 2WP0A 1N3BA 4LCBA 5B2EA 1CB0A 3RRMA 1G7RA 4GE3A 4M83A 2V8OA 4AG3A 3E1SA 4K3VA 3OEWA 4EB8A 3JWPA 1BAPA 3R5TA 2W6JA 5IVPA 3EFBA 3WL5A 2CE7A 3HNOA 1GNVA 2ZJYA 4U8HA 4Y9RA 1Q2XA 1NE7A 2JJQA 2I3DA 2NPOA 3GARA 1PQWA 4PCVA 5I7EA 2HJ9A 2A33A 4OM7A 1UMDB 3NWJA 2H00A 3DKVA 3GDHA 3JXEA 5BRJA 3JYOA 4NYMQ 5HFJA 5KYUA 3MCTA 4LYDA 2GYWA 4Y3UA 3PC4A 3A1UA 5IT0A 4N48A 2JS7A 1PFKA 1M0WA 3LBHA 4RM3A 3OICA 3A11A 3R9KA 4Q1AA 3H11B 4C07A 5DM1A 1R3DA 4XFDA 1TM5E 1A5TA 4E4RA 1WVIA 5IBPA 5TPWB 4A8TA 4BNNA 1PDVA 4KQKA 3ZYCA 2X1VA 2VL7A 3QX8A 3I5YA 2W6NA 4RXUA 3B1JA 4IOLA 1W4AA 2Y2UA 3HU3A 1KY4A 4CMEC 3P0IA 4F97A 4JS0A 2WIGA 4EBBA 2W2VA 4WXYB 2TSYB 1IVYA 1CDDA 4Q48A 3FI9A 1D7AA 1VXRA 3TSZA 5B6PA 1GUDA 3CH7A 2JD0A 1GQ2A 1DRWA 2DWUA 1Z12A 2R2GA 1M2VA 3GDWA 4G1BA 5FTNA 5A9TA 1J7JA 3GN1A 1MUUA 3M4JA 1KJWA 4PRZA 2BONA 3M3HA 3MTAA 1SC6A 1IY1A 2YFYA 3CTMA 4MW1A 3G3EA 4X1IB 1Y3AA 5H81A 1Q6YA 4BJ1A 3FCYA 1H4TA 2ALJA 1MG5A 2R6CA 2CXHA 3DVQX 2OHVA 1WA5A 2CFRA 2DTXA 4K2HA 5K45A 1I9GA 1JPVA 4JL6A 2QR5A 3F3YA 2X0EA 4B7CA 4B82A 2WD7B 4PEVA 5E6UA 1FC0A 3WMRA 1O0SA 3Q3GE 1IEXA 3JWIA 1VRWA 4G8CA 4IQGA 4YHBA 3ZHRA 5BVHA 4EPVA 1DX6A 4BNJA 1EUYA 1TAGA 2OOKA 3VR5A 3OX1A 1FK8A 1CUCA 3OQPA 4F06A 5I8PA 1E9SA 3DNMA 5EIXA 2FGKA 1QGUA 1V39A 4BBAA 5HJ5A 4YRTA 4R3NA 4FHDA 4LXHA 1ADBA 2IYLD 3ZE6A 1EMDA 5E7JA 2AEMA 2WYIA 3H97A 3DDSA 2VP9A 4B87A 4ZEMA 4FTWA 1KC3A 4XCQA 3QA9A 1KI6A 1NXVA 2B5WA 1TTHA 1FTNA 1HK7A 5LQJA 2A9FA 5KI6A 2VTVA 3G49A 4AMBA 1P39A 1KI4A 3I8XA 2RBKA 3VNQA 5IJ9A 5KOYA 4D4GA 4NU0A 4HTFA 5SZIA 1BC5A 3MJ4A 2EIXA 4J0IA 5D7NA 1GXSA 1T5BA 4YQZA 1QPZA 5L8VA 1QVWA 3T9AA 2G70A 3C41J 5P21A 1EJ2A 4GX5A 3LKDA 3C7DB 4D4JA 5KVAA 3WGGA 5ESRA 4F4JA 4CQMD 1NG9A 4MB6A 3H7IA 1JTFA 4YCSA 3IHTA 5LXTF 4CYMA 5ILOA 3GFFA 4JC5A 4BMDA 1SULA 1ODJA 2FOLA 2O7VA 4BOYA 4DBZA 1G8YA 1PFGA 1QHFA 1W9HA 3N86A 1M6VA 2PLFA 3GRZA 2ZBQA 4Y2HA 3RGWS 1SCDA 1NBEA 3NRJA 221PA 3ZDBA 2RGRA 1MT0A 2ROQA 5AJHA 1OFUX 4M0DA 4K5QA 3HJCA 3E18A 1NP3A 1I2ZA 3U62A 2GN8A 2CLMB 2HSZA 5AXBA 3T9BA 3ZKWB 5CFMA 4RSGA 1DRUA 5A4FS 4XYEA 3SHWA 1WE2A 3WLJA 2BKXA 3AJRA 3I8OA 2QVYX 3D8NA 2V7BA 4U7GA 4YWHA 2VXYA 1LI5A 4OFWA 5DTQA 1NQVA 4GECA 1VMIA 1TEXA 3B2EA 4AVYA 3BK2A 4BWGA 1EI9A 2ZU6A 3V7WA 4RK1A 4BWVA 5JBQA 3I62A 5ELXA 5HZGA 3KPJA 1N5KA 5TVGA 3M1IA 3SHFA 4ANFA 2WJGA 3KT0A 1ZK0A 2B61A 3URKA 1TO6A 2ZVQX 2RC5A 3DFKA 1PG0A 4H6XA 4ARZB 1F8YA 1V43A 4V24A 3ZD8A 2WT8A 3RU7A 4L1KA 1D9XA 4NZZA 1Z45A 1H9CA 4IVRA 1HDEA 4DKXA 4EUNA 4YCNA 1TUGA 1LTKA 4Q1FA 5EKSA 2ONJA 2V6MA 1XK7A 4P98A 3NTXA 4X0EA 5JBIA 1VG1A 1RTTA 1RD4A 2LWIA 2OLKA 3BZUA 3ET5A 3LK6A 3N2LA 3BJEA 3DOEA 5DBGA 3HJNA 5FDFA 2GM5A 1A50B 1Q91A 2AFIA 2P1DA 3JX9A 2BE7A 4LGCA 4U6QA 4YUXA 3KCQA 3UWDA 3PXCX 4MVCA 5CJJA 2JAWA 1NMYA 1A7KA 4H7EA 4N9WA 1SU6A 1S1CA 3ESXA 3PNLA 4DR6B 3U3MA 3FKQA 1J23A 1I4TD 1N8TA 1U3CA 2BOVA 1GKUB 2GEBA 2RK6A 2WMYA 1T0PA 2C1ZA 2X9GA 3LXRA 4IS2A 3TDKA 5L3RA 1ZH0A 3T5DA 4EFNA 3EIUA 3NBUA 4EP1A 3MCAA 5DHUA 5JTUA 2QQFA 1WVGA 5A7GA 3WOVA 1FNBA 2FFRA 2QAGB 3MGBA 1I6LA 5FA5A 3LZDA 3OFSA 5K51A 4R1NA 1PT5A 5JZVA 5EQTA 1SURA 1CBUA 2NTNA 5KNDA 4KSBA 5CGQB 2OV2A 4YT2A 2JAOA 2QA5A 3GG2A 1H4VB 4X97A 4OQDA 1CFZA 5G0UA 1BCSB 3TWOA 4C7OA 4DIUA 1XT6A 1TZCA 1JFRA 3ZHOA 4P3PA 2XGOA 5CT5A 3TAXA 2WJ4A 4I1OA 3MGCA 2DBYA 1EWQA 4AS3A 5F21A 3KFXA 4M9SA 1TU3A 2J0UA 1P18A 3T34A 1ILEA 4PCUA 5BNZA 3B1WA 3ECAA 4G25A 3ELYA 4P38A 5TB5A 3CNEA 4GWLA 4M4SA 4B4VA 4DWVA 2CNBA 4QWWA 1CF2O 3HC7A 4WNCA 5HCNA 5KNDD 5DRYA 4B4WA 4L3OA 1QDUA 4INAA 2CL5A 3CV3A 2V5AA 4IHJB 1KP3A 1KO4A 2HV8A 2WA1A 1NMEA 1DQYA 2YVLA 2YDYA 1R6XA 4GQIA 4NMHA 4LZLA 2QLMA 4CDGA 4QTZA 3W1VA 4UHCA 4X7RA 3K4HA 4EQ6A 9ATCA 5B1DA 3WDLA 4Q34A 5DLDA 4AF6A 1MZVA 2W83A 4FYWA 2XUQA 1U0RA 3O26A 2R86A 5T6MA 4DM4A 1CDEA 1V26A 2QYSA 4FE7A 1AMNA 3WAJA 1JEYA 1TYCA 2IYZA 4BS9A 3B6EA 3DOHA 1MAUA 1DGQA 1FBTA 1GILA 5AKLA 1EVZA 3ACCA 5F7OA 4TQUS 1G6Q1 1QFXA 1E2GA 1YS4A 4YT5A 1O0CA 4ZOAA 5A06A 3NT5A 1KDOA 3EBOA 2OMEA 1Z2AA 4W7HA 3VJKA 4Z2YA 2JNWA 1QNFA 2O3JA 2P4SA 4XTRA 4OI1A 3D1VA 3S2ZA 1ENYA 1U8CB 1LD3A 1VA5A 5A3JA 4MRMB 1KBZA 1CDZA 3BKXA 4GOOD 3ZW8A 1SO8A 3MFYA 1AG9A 3QH4A 4RVUA 5ALGA 1T2FA 2NOAA 1FJXA 3AXSA 3N05A 4HMQA 1O6GA 3GGPA 5JD4A 1UBCA 2G83A 3EVBA 5EHNA 1XDSA 2PXCA 5KNBD 3SOZA 1H2FA 2WSMA 3EDMA 3GFVA 5JMTA 2QPOA 1EVJA 2H7VA 2PH1A 3DE2X 4BGUA 4DWOA 2OWEA 4Q7JB 2I62A 3EFOA 4H7DA 3K35A 2XB9A 4UE6A 1JG7A 1QH0A 3FWYA 3LUCA 5SICE 2W98A 4P34A 2P2NA 2IVZA 3H8SA 3CHYA 1PQ4A 2YMLA 2JI6A 1XLUA 2EW8A 2VHYA 4UD2A 1CIJA 1FF9A 2JD2A 1RZUA 1JLSA 4NYIR 3RS8A 1X7WB 4K6HA 1EXDA 4FYVA 4MCAA 5KWIA 1R6BX 4XPZA 2Z09A 4RWZA 5CH5A 2J5KA 2DAPA 3H4IA 3NYWA 4YPFA 1AKWA 3KR1A 5K99A 3TQSA 4PHTA 1HDIA 1T1EA 2HL6A 2JLXA 5AT1A 3FKJA 3BCUA 3K9LA 3ZN2A 2E48A 3PFNA 2CMGA 1VJDA 3L01A 3LHDA 2ODWA 1LSOA 4JKOA 4N5HX 4LXTA 3WIVA 1NBAA 1VYHA 2EU8A 3KZOA 1VJCA 1VSTA 4HEA6 2X76A 3ZNPA 3PWKA 4ZO6A 3DZKA 5HKAA 1J9ZA 3A2MA 1F2VA 1RMTA 1XZPA 2W6CX 3MINA 3BFJA 3MT9A 2H31A 3LYAA 1ORTA 1W35A 4TTRA 2F48A 4NNOA 5JZMA 3JYQA 3A2LA 1JA0A 2OENG 1U6JA 1EFLA 1X7HA 2ODPA 4LMRA 5M3BA 1HO3A 2VQ6A 3KSDO 4TL9A 2E55A 3U9SA 1JHYA 2VNAA 5B1YA 3OM8A 4KKVA 2NZXA 5JUWA 2B6HA 3FZYA 2XZPA 2XNDD 1TZ2A 4HRXA 4X6LA 3JQGB 1TEHA 5A4AA 1JVBA 5L45A 5KKCA 3L7OA 1U7OA 3SWWA 2J3QA 3DZFA 4RTJA 1E60A 2AXQA 2QT9A 3GMIA 2QZ4A 1S02A 4G5SA 5CHYA 1DAGA 2G07A 2XSZA 3ZWWA 2ISCA 2XECA 1QH8A 3JATB 3R7BA 1H9AA 3V8VA 2WF6A 1CD5A 1PZNA 2C0QA 3JALA 1P73A 2IUEA 5AM1A 4WOJA 3B8HA 4ETIA 1DADA 2GPNA 3OX4A 4W6ZA 3W4KA 4X3PA 4X8LA 2B9EA 5SYMA 1KO7A 1NHGA 1NE2A 2CHGA 2E6UX 2IVFA 2GK4A 4HZUB 4Q01A 1WABA 4DVJA 1KNQA 1YS2X 2RAPA 3G02A 4Q4JB 2D8MA 3EOBI 4FGZA 4P5EA 3ZGYA 2FFJA 5C53B 2XUPA 1A9XB 3FUUA 3EGIA 2KBEA 1BDIA 4NCAA 2IDMA 3AUFA 4QT0A 5T8KA 4RKFA 3ZCSA 4EUFA 2ZTHA 3ZXUB 4Y1GA 3KV3O 4XXHA 4JI6B 4V1CA 1M7BA 4UTPA 3TG2A 2OXCA 1J33A 1L6IA 2L42A 5JEEA 2NT4A 3CGWA 5KTMA 3ZWDA 5K03A 1FTYA 1NNEA 5U4QA 3EB9A 2Q8QA 3V1NA 4C7KA 4ZEOA 2NNWB 4INZA 3KSMA 1NR1A 2C9BA 4IQ8A 4EWLA 3DL2A 4ER7A 4X65B 1FFAA 3ISVA 3UFBA 1GT6A 1X1DA 1ZCZA 3II6X 5FTMA 5CEJA 2XMZA 1NM5A 4B6JA 3ICCA 4J49A 2E0IA 1DEXA 2X14A 4W1PA 2VJAA 3RVPA 2P9CA 3K9WA 3SCZA 4MGIR 1ZVVA 3MRSA 1NXPA 1U7UA 2BGWA 4FEAA 4OA5A 4WVLA 1L7EA 2C9ZA 2G63A 3QXHA 1KZ4A 2WIKA 4RE5A 2AN9A 3LXMA 2NU7B 4F1JA 3LPCA 3H6HA 1CS0A 5AUNB 4G0XA 5JD5A 1J9EA 1JEJA 3VTZA 4EK9A 5B6IA 1XVUA 1GYPA 4NFYA 4I1PA 5EZYA 2BFCB 4NE9A 4AY3A 3E9EA 2WT9A 1SBQA 1RXEA 5CX4A 1GUZA 1NI3A 4E51A 1PGPA 3FOCA 1CQXA 2XUKA 3BD9A 4PNZA 1CUBA 2H6EA 4QPJC 5DTEA 1UM9A 4BHTA 5F3WB 5C1PA 1XMVA 3QG5A 2P4UA 2R47A 2R11A 3FYUC 3EF3A 4XQCA 1YJBA 4ALJA 3STTA 2ZUWA 2C5HA 4XARA 2H5IA 1V1MB 2HRRA 2PSSA 4C5CA 2YMMA 4UE3S 5JVDF 1XQVA