3MTIA

The crystal structure of a rrna methylase from streptococcus thermophilus to 1.95a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
183
structure length
166
Chain Sequence
AMIKRPIHMSHDFLAEVLDDESIVVDATMGNGNDTAFLAGLSKKVYAFDVQEQALGKTSQRLSDLGIENTELILDGHENLDHYVREPIRAAIFNLGKPHTTLEAIEKILDRLEVGGRLAIMIYDMEKDAVLEYVIGLDQRVFTAMLYQPLNQINTPPFLVMLEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a rRNA Methylase from Streptococcus thermophilus to 1.95A
rcsb
source organism Streptococcus thermophilus
molecule tags Transferase
molecule keywords rRNA methylase
total genus 56
structure length 166
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06962 rRNA_methylase Putative rRNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3mtiA00
2ORED 4RX1A 4Y2HA 3DTNA 3GRZA 3M6UA 5FWDA 2ZSUA 2IH4A 5K0NA 2DPMA 2AVNA 5DTQA 2VP3A 3R0QA 3EPPA 5FADA 4CWAA 2EJUA 4KRGA 5DWQA 2K4MA 4QPNA 2HTEA 2OYRA 1R00A 4R8RA 2ZZNA 3C6MA 1O54A 2AOXA 3LCCA 1VPTA 2ESRA 2PY6A 3FTFA 3HVKA 2G72A 2YUIA 4GOLD 5CM2Z 3R6TA 5KS2A 3BWBA 3M6WA 1EG2A 4FS8A 5LQCA 3K6RA 3MQ2A 5KVAA 5DM0A 1UIRA 1WY7A 5FHRA 3A7EA 1EIZA 4HTFB 4PYNA 5CVUA 5FULA 1NBIA 1I9GA 5BW5A 4BLWA 2B9EA 3FPJA 4RTNA 3UWPA 2Y1XA 2PX2A 5GM2A 4P58A 2FHPA 4RTRA 4K6MA 3TM5A 2PJDA 3NDJA 3GXOA 4IV0A 5K0CA 2BZGA 2VDVE 3GRRA 3PB3A 1P1BA 5LSAA 5CCBA 3CVOA 5IKMA 3MCZA 4DQ0A 5CVVA 3VSEA 3THSA 1Q0TA 1SKMA 1ORHA 4YUWA 4PGGA 2HNKA 5FQNA 2OXTA 3KHKA 2YXDA 5C0OE 4RTLA 4EKGA 3OPNA 2ZVJA 3BT7A 2ZZMA 5E1DA 4RTJA 4XCXA 3LHDA 2WA1A 1VIDA 3M4XA 1ORIA 3HVIA 5ICFA 4GC5A 2NXJA 1D2HA 3CC8A 3HCDA 4L7VA 3HA7A 4P7KA 3ER9A 2O57A 4KIGA 1NW8A 3PT9A 4PYIA 1XCJA 3FUUA 5EZSA 4C06A 3B89A 4ER7A 2IDJA 3C0KA 3CJTA 2B25A 1JG2A 5DTMA 3P2EA 3C3YA 2NXEA 2P8JA 3I9FA 3TFWA 2PSSA 4MTLA 2GAFA 2PWYA 3BGDA 3FYDA 4U7PB 5BW4A 2ZTHA 4RSRA 3ORHA 5EQJB 4ISCA 4RTSA 3KR1A 1ZHFA 1YB2A 5D1NA 5DT2A 1IXKA 2IP2A 4BLUA 4E32A 4MHTA 2ZW9A 3UJ9A 1G38A 3ELYA 1UWVA 2FPOA 1G6Q1 2ZZKA 1KYZA 2JHPA 3LKDA 2HR1A 4PYJA 2XBMA 4HH4A 2B3TA 2PVCA 1L1EA 3LX6A 3NWBA 4YV2A 2JG3A 5HILA 1YFLA 3EMBA 3SSMA 1R74A 5ICEA 5E9QA 3P9CA 3OFKA 1P91A 2G70A 2PWPA 3UJAA 5GINE 2VZ9A 3GRUA 3MGGA 3SX0A 2ZULA 5ICGA 2FK7A 2HMYB 3H2BA 3LDUA 3GGDA 3ERCA 2FRXA 3MB5A 5CUQA 4X1OA 5EMLA 5CCXA 1Y8CA 2UYQA 3G5TA 3OZRA 5E1OA 3KPJA 3LDFA 4EK9A 2ZCJA 4LG1A 1UFKA 2VDUE 4C04A 4DZRA 3P2KA 5K0GA 4CKBA 2DULA 3K0BA 2JHCA 3QOXA 3OU6A 4RWZA 5EIFA 5C1IA 5EHIA 5F2NA 1G8SA 2OB1A 3NVMB 3SR4A 4IWNA 4PONA 4E2ZA 2IFTA 5K8VA 3FPEA 2Z6AA 2YXLA 1XCLA 1XVAA 4PWYA 5E8JA 4DCMA 2B78A 3EGIA 4C07A 3HEMA 5CIYA 4KDCA 4GQBA 3PVCA 5DX0A 5FWAA 3I53A 2NNWB 1F3LA 3Q7EA 4AZTA 1O9GA 3OZTA 5LR6A 3FRHA 4FSXA 2Q41A 4ZTBA 5GOZA 4RTQA 2NP7A 2PV0A 1FBNA 3DOUA 3LECA 3P97A 2IH5A 2YXEA 2FK8A 3EVFA 5EIWA 1MHTA 2G71A 3GJYA 4GEKA 5K0JA 2R3SA 3V97A 2ONYA 1FPQA 3KPVA 5EVJA 3GRVA 2I7CA 3NJRA 5D1HA 1NW7A 3MERA 3GCZA 2PXAA 3G2MA 3O4FA 2E5WA 3I58A 3PX2A 4AZVA 2ERCA 4WVLA 4BP3A 1RI1A 1X1DA 3KKZA 5IH3A 4HTFA 4DM3A 5K01A 5T6BA 2C7OA 3KQTA 1QAOA 5DTRA 2C7RA 3A4TA 2YTZA 4RVFA 1L3CA 2GLUA 3EVGA 3G8AA 4PYKA 2PT6A 3CGGA 4C4AA 1N7IA 2UZ4A 1VL5A 4X61A 4R6WA 3A26A 1NE2A 4M36A 4CKCA 3HM2A 4PIPA 5B1SA 3I64A 4ER3A 1P1CA 1QAQA 4PYLA 4KVZA 3C3PA 1JG4A 3DMHA 3V8VA 2V74B 2AOUA 2LD4A 2FCAA 5DM2A 5LQAA 3HP7A 5DXJA 5FQOA 2UYHA 3KQPA 3G8BA 3SM3A 1RI4A 9MHTA 2PLWA 4E2XA 1KR5A 2C7PA 1RJGA 3P8ZA 3OE4A 2XVAA 1L9KA 4V0RA 2IBTA 3EGEA 3JWGA 2EG5A 4XUEA 3KR9A 4OX9Y 4OA8A 5T64A 2IDKA 2XVMA 3OFJA 2AVDA 3RIEA 4DF3A 4E30A 3NVKI 5EOVA 1SUSA 4YMGA 8MHTA 2AN3A 5EEGA 2IPXA 2H00A 2N47A 3HA3A 2NP6A 2Y1WA 3G88A 4GC9A 4C03A 1X19A 2AR0A 2P3QA 2PBFA 3A27A 3T7SA 3AJDA 3MTIA 1YFJA 3P9IA 4HC4A 1O9HA 1QANA 2BR4A 2PT9A 5K03A 3BGIA 1NW3A 7MHTA 3HNRA 4KIFA 3G2PA 5FTWA 4KWCA 4POOA 4GUAA 3UZUA 2P3LA 3HCEA 3UBTA 3KPUA 3G89A 1EJ0A 3GRYA 1AQJA 1L3IA 2I62A 5FUBA 4E33A 4EQZA 3JWIA 4O29A 1QZZA 4AZSA 3BWMA 1INLA 1IY9A 3HVJA 1KPIA 4QQNA 3THRA 2GPYA 1F38A 2PGXA 2PX5A 3LSTA 1JSZA 4GBED 5E9WA 1JQ3A 1KYWA 1G8AA 1KXZA 1RI5A 4P7FA 1NV9A 4KDRA 3GNLA 3C6KA 1JSXA 1X1BA 3B3GA 3BKWA 5DM4A 2NXCA 3TKYA 5GIPE 1OR8A 3VC2A 2PXCA 1SUIA 2HWKA 4RVGA 3PTAA 3LCUA 3FTEA 5FA5A 4PCLA 3WSTA 3HCFA 2IGTA 3DR5A 1TW3A 4V0QA 4PNEA 3ER8A 3LBYA 3ELUA 3U81A 5K05A 1WG8A 4YUVA 1FP1D 2XYVA 4R6XA 5DXAA 4YMHA 3ELDA 5CVEA 5EPEA 3UFBA 2R6ZA 2F8LA 2QYOA 4YV1A 4EMSA 3OCJA 3GDHA 1R6AA 3FUXA 3IHTA 3NW9A 3MTEA 5ICCA 4AX8A 3MHTA 1MJFA 1NBHA 2AN5A 2JHAA 4RTMA 3EMDA 4FGZA 5DRTA 4UOEA 2ZIGA 3OZSA 2AOTB 5GWXA 2PX8A 2JH8A 2O07A 3IV6A 3GU3A 1AV6A 3B3FA 3GO4A 3KQVA 4XUCA 1JQDA 3BKXA 1QYRA 1RJEA 3LCVB 3TMAA 1AQIA 5GM1A 1HMYA 3QV2A 1Q0SA 5DPMA 4GF5A 2CL5A 3R3HA 4GOOD 3UJCA 3T7RA 3G7UA 1SQGA 1RJDA 3VC1A 4LECA 4JXJA 4DA4A 4FT2A 3P2IA 1D2CA 2OBFA 4ER6A 3HA5A 2EFJA 4AZWA 3CJQA 3DLCA 3B3JA 4ER5A 4PYOA 3AWIA 3DH0A 4HGYA 3UA3A 1XDSA 3DMFA 2Z6UA 1ZGAA 2CMHA 2GA9A 3DXYA 3ME5A 4R8SA 2EX4A 5EKUA 4F85A 3HCBA 5G02A 5C9ZA 5HOQA 3DP7A 4PYMA 3MCTA 3LL7A 2A14A 2YR0A 4QDJA 5U4XA 1VP3A 3REOA 5KQSA 4P7GA 1WS6A 3HCCA 4X60A 1I1NA 4FT4A 1YZHA 5P8WA 2G1PA 1B42A 3LDGA 1VE3A 2AOWA 3E7PA 1AF7A 2QE6A 3BWYA 1T43A 1M6EX 2OKCA 3EVEA 3NTVA 4CTJA 2JH9A 4QTTB 5HZMA 1G60A 1YF3A 4M37A 5EEHA 2BM8A 3LKZA 4FR0A 2HV9A 3O7WA 4E2YA 3B5IA 4PGHA 4FP9A 3TPZA 4CKEA 4KW7A 3F4KA 2ZBQA 4A6DA 2IIPA 4E31A 5DRYA 4CTKA 1XDZA 2WA2A 3GWZA 3NMUF 1VQ1A 5LQJA 5CVJA 3AXSA 5LQRA 1NV8A 3KQQA 2G8NA 3IYLW 2ONZA 2C7QA 2OPBA 1P39A 3DULA 2PX4A 3KPWA 3LGAA 2O06A 1XJ5A 4QVKA 3FZGA 4MWZA 1H1DA 3TKAA 1N2XA 1XDUA 3EVDA 3HCAA 3R24A 3AY0A 3CBGA 3NWEA 2P35A 4LWOA 2P1DA 1BHJA 2ADMA 3PFGA 3R9XB 5CVDA 3LBFA 3TM4A 5E1MA 4PYQA 2QRVA 3MAGA 5DX8A 4YUYA 4IKPA 4XUDA 2O0LA 2BM9A 3NDIA 2WK1A 2AOVA 2H1RA 3FYCA 3E8SA 2P3OA 3EVCA 4M7RA 4Y30A 3TOSA 5HIIA 3DXZA 5ERGB 1NW6A 4RYLA 3UJ7A 4HG2A 5EHGA 1BC5A 2KW5A 1V39A 1VBFA 1ZQ9A 3SSOA 5LQNA 4PCAA 3ELWA 1XTPA 4FZVA 3RODA 5BP7A 3OE5A 3X0DA 3BGVA 4QPPA 3P9KA 5F2OA 3RW9A 2AOUB 2CWWA 1QAMA 4RV9A 1EJ6A 4AUKA 5JR3A 3CKKA 1BKYA 3UJ6A 3OU2A 2AZTA 1VLMA 1RI3A 2ZWAA 3A7DA 3SSNA 5HIKA 2ZIFA 2ZFUA 2ZBRA 2NXNA 3DXXA 3BUSA 3M6XA 5MHTA 4BP1A 1TW2A 1Z3CA 3ANXA 3TQSA 4A6EA 2OO3A 2P7IA 3FPGA 4GOND 2GS9A 5E2AA 5HIJA 3SMQA 4DCGA 4EVIA 3HTXA 3LPMA 2VS1A 5E2BA 5K0FA 3CJRA 3S68A 4HRAA 3JWHA 2BR3A 1YZ3A 2PXXA 5KYGA 4MIKA 2P41A 3UJDA 1M0EA 3KQWA 1R8XA 4DKJA 3JWJA 1X1AA 1KIAA 1N7JA 3E23A 4RVHA 3TRKA 3AXTA 5M5BA 1KP9A 1R18A 3O31A 4GOMD 3KQSA 2I9KA 1JG3A 5FHQA 1SG9A 3T0IA 3EEYA 3PX3A 2P40A 3P71T 5EMKA 2AS0A 3FRIA 3Q87B 4CXMA 5LQKA 1DCTA 5EGSA 1ZKDA 4ER0A 4PINA 4E2WA 5LQUA 1KPHA 2ZIEA 1NT2A 5E9JA 2GB4A 5EKXA 5K0LA 2BR5A 5BXYA 5DX1A 2XYRA 4RVDA 5DLYA 2OB2A 5DSTA 4F84A 4RTPA 2ZWVA 1NKVA 3FUVA 3QOWA 2ZLBA 4OBXA 2Z6QA 5GIOE 1FJXA 2QM3A 1JTEA 3DLIA 4RTKA 2I6GA 1JTFA 3CCFA 2JJQA 4YV0A 2CKDA 3I5UA 4H0NA 3EGVA 4HSGA 2XYQA 3FPFA 3UA4A 2VDWA 3OU7A 3UJ8A 1PRYA 1ZG3A 3A25A 1YUBA 3G5LA 3KQYA 3SXJA 4YUXA 1KHHA 3BZBA 4WXHA 5E8RA 1BOOA 1XXLA 5HFJA 3EVZA 4DMGA 1EAMA 2EJTA 3FPHA 2IH2A 2FYTA 4RTOA 1WXXA 1JR4A 4QVGA 4C08A 3IEIA 3DMGA 3G2QA 1HNNA 3PFHA 3FTCA 1D2GA 3KR0A 4HGZA 4R05A 5KQRA 1KPGA 3DUWA 1JG1A 1DUSA 3TR6A 1EQAA 1JQEA 1L3BA 2OZVA 4OBWA 2V7EA 3EEOA 3EVBA 3GIWA 4E70A 1RI2A 2ZBPA 5EG5A 3KQMA 4QDKA 2AOTA 2BH2A 4IV8A 2NYUA 5FCDA 3G2OA 4B17A 1I4WA 2H11A 1U2ZA 3HVHA 2CMGA 3PLAE 4C05A 5K09A 5K0BA 2YQZA 2UYOA 1NW5A 5EC8A 5EMJA 2YVLA 10MHA 4OA5A 5JUWA 1SVUA 5DSXA 2QY6A 4Z2YA 1SQFA 1TPYA 2PKWA 3M33A 2GH1A 3FTDA 4LWPA 4QQKA 1IM8A 3M6VA 4YUZA 1DL5A 3BWCA 1FP2A 4FSDA 5GP1A 3KU1A 2QRVB 5E1BA 2UYCA 2YX1A 4MQ4A 3TLJA 1PJZA 2O05A 4U7TB 4M38A 3B7PA 3BXOA 3KR2A 3ID6C 5H02A 5EMMA 2B2CA 3T7TA 3D2LA 3VYWA 5K0EA 1RJFA 3KQOA 2AN4A 3SGLA 5DM1A 4F86A 3PS9A 5FA8A 3EVAA 4PIMA 4BLVA 1R8YA 5HEKA 3UJBA 4ATNA 3SVZA 2P7HA 1ZGJA 1VP9A 4NECA 5CD1A 1M6YA 3FUWA 4G56A 1WZNA 4P7JA 3E05A 4X63A 4OQEA 5EZQA 4EKIA 4BY9E 5HIMA 5T67A 2OY0A 1X1CA 1WXWA 4OQDA 4QTUB 3P9NA 5F2KA 2IBSA 3FUTA 4X41A 3KPYA 3L8DA 3M70A 1G55A
chains in the Genus database with same CATH superfamily
1D2RA 2M1XA 3DTNA 2WE8A 2L42A 1ZL2A 1CUZA 1YT5A 4XSVA 1PLLA 3M34A 3WMWA 3BTUA 3KYBA 4FKZA 4YPVA 4FEAA 4UMDA 3R0QA 3THWA 1YMVA 4M0MA 4J7AA 3ZWKA 1ELOA 4CWAA 4RZUA 2K4MA 5LIPA 1YTUA 5F9HA 5DNUA 1HV8A 1BFUA 4M1MA 4O02B 3RRJA 2X0JA 3TI7A 1HRKA 4C3VA 5CLLA 2QD5A 4I5IA 2QL5A 4BS9A 4BVKA 4Q16A 5J2UA 1OC4A 4QLOA 1F2UB 2NTYC 5G2OA 3W1VA 3UT5A 3BM5A 3LO5A 1U0GA 2H07A 4ZP1A 5JDCC 2CJPA 4A2CA 1WY7A 2FPUA 1WDKA 4J9VA 5FLXA 2R8ZA 3MMNA 4RAQA 4HLNA 4D2IA 3C8UA 5JISA 3HCNA 4F9FA 1ZESA 4L6IA 4A3SA 3ZWCA 2JZNA 2I7VA 2ZSJA 5KYKA 4N65A 2W2LA 1I7QB 2C2OA 2RB5A 1O1YA 1WQ4A 5L6LB 4P58A 5AFSA 2FHPA 1EGMB 1EQUA 1YS2X 4WJZA 3PFKA 2I29A 1OIVA 3BSSA 2QN6A 4MSUA 3F4BA 3M81A 5F52A 1JQAA 4ZZ0A 3RHSA 5FD8A 2OQRA 3IULA 1IYZA 1XK6A 4C6TA 5CDTA 1GNRA 2X8JA 4TV9B 4QNMA 3FMIA 5I8ZA 2V96A 2JFUA 3G9ZA 4YWJA 3K6SB 4EKGA 5A06A 5B7PA 4HNRA 5DYNA 3IXLA 3EFEA 1C4XA 3GAZA 2IP4A 1WXDA 2XYPA 2FQQA 1NR7A 2EXXA 4QU8A 4ZEVA 1SA0B 2GTIA 1TM2A 2ZYTX 2DWUA 3RYHA 3ZDBA 4LK2A 1XCJA 2R8BA 3TCXB 4L15A 1UJ6A 4DJAA 1KY5A 3L0OA 3M4YA 4Z1OA 2IDJA 2DUJA 1ULAA 4Q37A 3DZBA 4DVGA 3D6MA 4KQJA 1ODSA 1XPUA 3DG9A 1OIWA 4DNOA 1J2JA 3CSSA 5BVGB 1SZJG 3LT4A 3AP2A 4G1FA 4YAEA 421PA 3BGDA 2PD4A 1PT9A 2OXFA 4KGXA 4X84A 1UZNA 1GA6A 1IPEA 1M9NA 3RYFA 5IW8A 2A1TR 3GHYA 2XMZA 5H59A 1QMGA 3JD0A 1D4OA 1XT6A 3LKDA 3RC8A 4BQFA 1KMHB 1SCDA 1L2TA 1TRHA 1WCIA 2DG2A 4CFSA 2HA6A 5JQWA 4JXXA 1E1YA 3IUPA 1J0CA 1PGJA 1QZTA 3GFGA 1ECPA 3PK0A 4MLPA 4E15A 8ADHA 4TV8A 4M55A 4Y2QA 2CBGA 3G17A 3HO8A 3TRDA 1R0LA 1DFGA 5FUQA 4DV5B 2NZVG 1B0ZA 1F14A 1PQ4A 2QORA 1UOEA 2XW6A 3IQXA 5EJ7A 3AR5A 4FEEA 3LD9A 3ZLJA 2J0VA 1G7RA 2IHUA 1PT7A 2BRUA 4OJTA 3IHLA 4IDEA 3QQ5A 4TL6A 1G2OA 2J3EA 4ZAWA 3P2KA 3U80A 3ZV3A 3MYRA 3KP1A 2ZRQA 1L4UA 1ZGCA 2P4QA 3MTBA 4RACA 4H6XA 5C1IA 1E5DA 4TRJA 2M1ZA 1XQ6A 1XQ1A 4E2ZA 3U7GA 4ZAYA 1E1LA 2CMFA 3G0HA 1XMSA 3M1YA 2W11A 3IQWA 4XM0A 3RSQA 3SHVA 1PD0A 3HP1A 3BQMB 3I62A 2B78A 4HEQA 4XUGB 3SEAA 3RKRA 2Z2KA 4L5CA 2HRDA 2IS2A 1QUFA 1X13A 2RAUA 3B8EA 5BQOA 4C0JA 5BQPA 1HKHA 2CCJA 1MO3A 2X6RA 5EL0A 1WRBA 1E3EA 1N8NA 2VSFA 4K2AA 4C7KA 1H1LB 2QRMA 3K0KA 4HADA 4HO1X 4LY6A 1VI5A 1BFKA 4RTQA 2DHCA 1QLWA 4BL5A 4DMRA 5K0EA 4RFSA 3AF6A 2B6HA 2NZWA 2I99A 4RIFA 1M2OB 1HQYE 2D1YA 2CV0A 3BE5A 4Y2TA 5SY4A 3QHPA 2J9RA 1NW9B 2F9MA 1IUPA 3RV3A 1P7YA 2FSVA 3NJRA 1WW8A 2QRJA 2BTQA 3QQPA 4I50B 3TTSA 2JLWA 3LXRA 1XZLA 2LZ0A 4L57A 1QH0A 4PXYA 4RHEA 2R6GA 5JO0A 2PXAA 5TQJA 4FNOA 2Z9BA 3WQSB 2V7GA 2DY0A 3ZHXA 2H7VA 3W8EA 1YS7A 3TW8A 3SJUA 3TLZA 4EA9A 5LIRA 3C3EA 4JLBA 3RS8A 2YYSA 3ZJVA 3BFKA 4RVSA 3QKRA 1XLWA 2ZIVB 5DWVA 4I1OA 4X61A 1FLAA 1FTYA 1A71A 1ICIA 4MUKA 4CKCA 3U4DA 1IUNA 1H6DA 1P1CA 1XEFA 5CFNA 3RGGA 2E5LB 1XDDA 3F98A 3H0CA 1PEDA 3P19A 4NSNA 2DU8A 1CQZA 4XQCA 3WLFA 2RAPA 3U4MA 2BFEA 3AL2A 4F1WA 3WB0A 2PLAA 4XFJA 2GETA 2Y27A 4AJNA 3PUHA 3HB1A 4KXMA 4RMHA 6GPBA 1CPYA 1GTSA 4KMOA 4AG6A 3CNEA 3TQOA 3LYUA 3QVVA 4OQYA 4OMFG 2CSUA 2XVAA 4URYR 5AR1A 2GFHA 4Q9JA 4AYTA 4JMLA 5FO0A 5B2FA 1RC0A 4ERNA 4FFPA 1Y48E 1AQYA 4ONEA 2EHJA 4GYKA 1EUCB 4K9KA 3BXZA 2R1TA 2I66A 1AA9A 5CGZA 5JS6A 1UKYA 1Z26A 2IPXA 5DT9A 4OYYA 5F3WB 3HA3A 4WXPA 2NP6A 1E0KA 1Q1QA 1RWXA 4S24A 4MV0A 2A1TS 1KSFX 3AJDA 3MTIA 1D2NA 1XTRA 2JVIA 2VKQA 3GLSA 4O2BF 2G17A 3ZWBA 4D79A 1IC6A 1COZA 3BTSA 1RT9A 4GXRA 1W8DA 3ZU2A 2RGGA 5LKRA 5LB4A 1H85A 2Y9PB 1W93A 3KFXA 3QKWA 4MK4A 1E3JA 2X4IA 3LUBA 4ZZ3A 4JIGA 3MWGA 3PQ3A 2MYTA 2Q3FA 3ZS9A 3VKHA 1IOZA 4LUCA 5FPQA 1BX3A 2QXTA 2R68A 2X3UA 4LGMA 4EW3A 3E1KA 3Q88A 4GBMA 4RK1A 3NTLA 1YS6A 3M6IA 3OEYA 4IVPA 4XOUA 4E5NA 1HE2A 2IPLA 4LSZA 1ZI9A 2IPMA 1HEIA 5F3DA 5F35A 4Z3OA 3HI6A 2ISQA 2LCQA 1FDIA 1U3CA 1XCMA 1Z07A 4INAA 3RS4A 3SXPA 4YJKA 4GZ5A 1T4BA 2F1OA 4XD7A 1RWOA 2KBFA 2SHKA 1I6MA 1C8KA 1SUIA 1RR6A 1YACA 3LUDA 3QPUA 3X1DA 3LCUA 4Z1MD 4D4LA 3ER8A 1V8ZA 4P9NA 2CV1A 2F3SA 2XUOA 3EXFA 3Q1KA 3UMBA 1TC1A 3ELUA 3AUFA 4NBLA 3BRQA 4CDMA 2JK0A 4QUJA 2H65A 2O48X 1O94D 4J1TA 4WCFC 3U49A 4QG7A 3HP4A 3UCEA 5A3RA 5ICCA 4QBHA 2EHDA 4N0QA 1LSJA 4J0KA 1P60A 1PSZA 1KVSA 1WDMA 1DRKA 3FDXA 4R51A 2JIMA 5G0VA 4X1IB 3PD1A 1V4BA 5JHGB 4NCBA 4II2A 3L7IA 5CHYA 2O07A 1H0SA 5EMNA 1ZONA 4EOGA 4OQ4A 1V71A 4HH1A 5IYZF 5BSFA 1W0KD 4BNWA 5JWRA 1HMYA 1LV8A 3QV2A 1BXZA 4O3MA 4Z3KA 2PUFA 1UKZA 1YOVB 2FGJA 1CWUA 3F74A 3WMEA 1GGFA 4L75A 1Z6YA 2FPRA 1H1LA 1M73E 1TFUA 4JUBA 5BV8A 3GLIB 4DR1B 1YR6A 2AFIA 2EP8A 2LTAA 4BJ5A 1NSYA 2EV9A 5FBHA 3T4PA 1EUDA 4XPIA 3UA3A 2ZG6A 5EP2A 3DBLA 4ID3A 5JXWA 2ODBA 1LW6E 1Z12A 2BI8A 2EX4A 4RF5A 4ZIRB 5JCZA 2CUKA 4LDRA 1SWVA 4F8EA 1Q50A 3KOUA 4MXDA 1LSOA 1VP3A 2QMUA 4EHLA 2DWQA 1E6CA 1V8FA 3V2GA 2JIBA 3Q3JB 1T2VA 1FW6A 3ASUA 3FR7A 4IX1A 3W90A 3AI3A 3NTVA 1M6EX 5DGHA 1E1NA 2GGSA 1CRPA 4UFNA 3CNBA 3LUKA 4OATA 3C14C 2JD1A 5KU1A 3DLPX 3JAKB 4IIGA 1ML3A 5FWXB 4YMVA 4IZIA 5EIHA 4PGHA 3COYA 2PBZA 4PPQA 3JVVA 5FWXA 1Z6PA 3DOEA 3ZW8A 2IOFK 4BLTA 4DT1B 2UZ1A 1T9ZA 4N6NA 2LKDA 1J5PA 4CMCA 3ANTA 2V54A 3NGMA 4RD3A 2XCOA 4FDLA 3MAAC 4M0CA 2BKEA 4HNUA 1B8OA 3C74A 4Q1CA 5CDYA 2RGAA 2C7QA 2AQKA 2XQFA 3VZCA 221PA 2WM8A 4HGRA 4IO0A 5D3KA 3N2IA 3RSOA 1Z35A 1N5MA 1DV1A 2P35A 3OQNA 4U2EA 3C6XA 5BV7A 1X14A 3PF9A 4G23A 4DWOA 2EX1A 1DT5A 1NVGA 4KE6A 4XUDA 2VHYA 1TM5E 1ISJA 5KUTA 2C2BA 2WIAA 2Q4EA 2V7WA 3CVXA 1D1PA 1FRQA 3PQ2A 4EUHA 2J9XB 2R1TB 5C46F 1KJZA 2PL3A 5LB2A 1NBOA 3JRWA 1Y8AA 2I3AA 1ZOSA 3RV4A 1T1EA 2FE4A 3L92A 5EWJA 1XTPA 2BGLA 2DQSA 2VUSA 3D8SA 3RK0A 3TNLA 1QRTA 1U1FA 3F90A 5KQSA 1K5DA 1NN0A 3FYUC 4P83A 1XEAA 4LKRA 5AKIA 1FBTA 1UBEA 2ZJAA 2Q0QA 3KJZA 4BGDA 3LZ6A 3R3WA 2WWHA 2R7MA 2IIBA 1NBAA 2D1QA 3NC0C 5HDQA 1Z3CA 3IELA 3ZVKA 2JEOA 3BE6A 1CF4A 3PCRB 4KU4A 5E2AA 5G1NA 1SQ6A 3E5NA 3AM1A 4GZMA 3S1AA 2HB6A 3LQYA 4IEIA 2ACVA 2C2KA 3NIWA 3CEHA 4GVLA 1KVTA 4YAJA 1S89A 5ARCA 2GZHA 1GZVA 3TL6A 3UANA 2HDOA 1GSAA 1RHUA 2FLVA 4H3SA 1KU0A 4OD0A 1U94A 3P9SA 4RSMA 1FQJA 3IC5A 3NHZA 4QDTA 5JY6A 1AO0A 4RE5A 4XJVA 1M0EA 4KG7A 4LF9B 2UYYA 1U3FA 1SG9A 3VR4A 4NK4A 1O97C 4LV6A 4TTRA 4J1SA 4F3YA 5BSWA 4FZ5A 4RYDA 3M4JA 5DGDA 2CNLA 1MTOA 3OUUA 4DLBA 4QGBA 5JCJA 1Z4JA 4I6JA 1M2KA 1AZTA 2A58A 1VCHA 4KRXA 4PINA 5EKXA 1XL1A 1W29A 2C0PA 2YW2A 3U09A 3EDYA 2KQUA 4NQRA 3A2MA 4RVDA 5C53B 4L16A 3ZDCA 4LBZA 5B30A 3TX2A 4HBGA 4NYIQ 2CD7A 3TSAA 1YS9A 2CZCA 3L05A 4C4YA 4H0NA 1UEXC 1VG9B 2HPVA 1E1RA 2E4UA 3DOHA 3FROA 3L02A 3H97A 1H0HA 4HOYA 4C5CA 4DA7A 3ZD6A 5M3BA 1WZCA 3S2FA 1LSSA 1IOVA 5LMUB 2Q5HA 1G8HA 2JH3A 3AJEA 3BZBA 1TLLA 2BBTA 4HX5A 4NKRA 3SFZA 2GASA 2G9VA 1TZCA 2XKJE 3G13A 3E70C 3ROQA 5AVYA 3I30X 3K2BA 1CNFA 3FPHA 3GLVA 1YC5A 3QSYA 2M32A 3KB1A 4CR7A 3WY9A 3QVUA 4Q9HA 3G2QA 3U4CA 1NVTA 3CURA 2YMMA 3H1FA 5BR8B 3AFMA 4B3DA 2OT3B 3KHUA 3F7MA 3H3JA 2PZJA 5BO5A 2WHPB 4XEUA 5A1TA 4KQKA 3FGOA 3GIWA 4RF3A 3WWYA 3ZU5A 1T0HB 2AG5A 3L04A 4IOJA 3ROMA 3PHCA 1N5LA 1QRAA 2WABA 4C05A 4Q1FA 1DBIA 1SK8A 5JDCA 1E60A 2GHRA 3C1UA 3NEJA 1P0PA 1NP3A 4V3BA 1U9IA 5CM9C 4B3IA 4DLXA 2JAOA 3E03A 3P2OA 4GX0A 3RU9A 1WMBA 3PA6A 3DHEA 1D5CA 1ST2A 4B81A 1ZK4A 1K7XB 4QQKA 2FOXA 2CKMA 2F1JA 2NV0A 3FHJA 4JP8A 1EUZA 2W98A 4OYRA 5C8YA 1P6XA 3HDJA 5D01A 5EJFA 2MSCB 4C0XA 4C4TA 1PJZA 1XD2A 3LAWA 1WO8A 4H1VA 3T7TA 3V7FA 2XEXA 1PX2A 3Q8KA 2ZE6A 1RWVA 1R5NA 5DCUA 3FIUA 2PNFA 2UVPA 2W7TA 1PJ2A 1N6HA 2AN4A 3H1BA 3KOOA 2OC4A 4LGVA 4LJKA 4HUTA 5DIZA 4BLVA 3TXYA 1DIAA 3IR5A 2PJRA 1PNOA 3SQNA 4WK4B 5KX5F 1QCYA 3FPLA 4G4SO 1VP9A 3F78A 4DGQA 4NECA 4EHHA 1LFAA 5CD1A 1M6YA 3WZ2A 4I1PA 5IT9A 4YQZA 4OXKA 1DDGA 5EZQA 5I4KA 1T0IA 3F3SA 1VXRA 1YQGA 5IJXA 4CGYA 5ITZA 2X41A 4Q03A 4EHKA 1BSVA 2G83A 4B3TB 3WJ7A 2GCNA 1JVNA 1X7WA 4WK0B 3MOIA 3EZLA 2ODWA 2W6JD 3CN9A 4R1TA 3OCCA 3WP1B 4ACBA 4B2LA 4UDYX 3OX3A 4MW0A 2PK3A 2Z8ZA 1L5OA 5DGXA 4FCWA 3WNCA 3NC1C 2ORED 1XD8A 4ZJYA 1JFFA 3HPRA 1WD7A 5FWDA 3LQ2A 1FRZA 1KEPA 1R9MA 3P7MA 3QKSB 1F2TB 5IDVA 3WGMA 4W6QA 2QROA 3VU9A 4PM4A 5DTQA 1E66A 2PH7A 3TLAA 1IQUA 1ZEJA 3H7IA 4R1UA 2XUGA 4UE2A 2C57A 3H1TA 1EBFA 3P9QA 3QNMA 1YB4A 5ILOA 5LNK6 1G59A 4L8WB 5F21A 1E1KA 5IP5A 4GPBA 3U6BA 2BONA 2EKBA 2PEYA 1U2PA 2GZSA 3OJEA 4HK4A 1U63A 2R9VA 5CM2Z 4TRRA 2VAPA 4LRWA 4K9NA 3NBKA 3V9PA 2NPOA 4UFPA 1J42A 3JALA 3LOQA 2D13A 3TGPA 3QHQA 3ZXXA 3B2QA 1WNFA 3COVA 1IQ0A 1CXZA 1UODA 2UZ0A 1AC5A 3DTYA 1BNCA 3J7TA 5FNVF 3WTBA 3FPJA 4CFYA 4EA8A 1ISPA 3S1LA 2Y1XA 3SP1A 4YRQA 4B7ZA 1G3UA 1W44A 1EH5A 1P9OA 1Y7HA 2AG6A 4JBXA 4U0JA 4U6QA 5K0CA 2WJAA 1A98A 3IEMA 1A7JA 1Y3AA 2Z4TA 4QATA 4TUYA 5LFAA 2H3EA 1Z08A 4HYEA 3VSEA 2ATIA 4HEA1 3H0EA 3QU4A 5E2IA 1TD9A 3NKLA 3Q9NA 4IIEA 2GCPA 4WEQA 3FWHA 2LW7A 3UENA 2OCDA 4KXLA 4TOIA 4GOJA 4B48A 4JVLA 1EFVA 1Y9ZA 4JJIA 1YWGO 1BOFA 1XHFA 4LXQA 1U0FA 2BBSA 3MRSA 4KGVA 1ONSA 4NF2A 4OHRA 2KHZA 2WA1A 4IF6A 3K0HA 4LCJA 3BMNA 3WL7A 3HVIA 3WRYC 2VXBA 4TLDA 4KVAA 3HA7A 1G98A 1RBYA 2O2IA 2O57A 1KZ9A 2AKAB 3AEZA 2DUWA 2FWRA 2ZDQA 4Y2VA 3COSA 4WGFA 4BB9A 2CXNA 4BO5A 3IDZA 3B38A 5AM3A 4TWBA 2FF5A 2Q2OA 3TFWA 4A8PA 4JC0A 2VF5X 3SC2B 3LY5A 4HNVA 5CB6A 1ESCA 3TF5A 4G1CA 1ZHFA 1QOQB 2NSYA 4BLUA 4RMJA 1CJBA 7ADHA 4MHTA 1ADFA 2O3QA 2R6CA 3CRQA 3TOVA 4FGWA 2HR1A 1LTKA 1NKSA 2ECOA 3HACA 3OM1A 5L4LA 1GUZA 3RJTA 3LG2A 1GL9B 4DLZA 1JQJC 4KTTE 4NCHA 4Q9AA 3P0EA 1VLHA 3WO0A 4J0CA 4BGVA 1TXGA 1GGVA 2IX3A 1P91A 1B0AA 1ZM9A 2OEPA 4B3GA 1J56A 5KDDA 1P74A 3I1FA 1IN4A 3V3TA 1FNNA 1EK0A 2CFOA 2CBXA 2ZULA 4JVMA 5A3VA 3WIBA 2VP5A 4GP7A 3EAGA 1NZFA 2C3MA 1P5RA 3BHNA 3PNLA 4FJ0A 4I3FA 3LDUA 4LE2A 1QG6A 3SIXA 5JPDA 4ZCTA 3PF8A 2ZR9A 3LJKA 5KSPA 4AUMA 1Y3HA 4ZJZA 1K8QA 5E1OA 2F00A 2FR0A 1ECBA 3K9FC 1JHUA 4PW0A 2BEKA 1I4LD 2OXRA 3OHPA 4XFKA 4WKCA 2VHTA 5AVZA 5I7OA 3CE6A 3KT8A 3RWOA 5EIFA 4DLAA 1Z06A 3UIEA 2J32A 4ZAXA 1G8SA 5KAMA 3DO8A 5HPYB 3L6CA 5KSZA 2CT8A 4RWEA 2Z6AA 4ECAA 4OHZA 5DJ5A 3K32A 1S96A 1ZM2A 4GXTA 5CIYA 1S6YA 3LVFO 3VZRA 2GEUA 3F2IA 3H5IA 3MWEB 5TGDA 4BO0A 4D80A 1WE2A 4RESA 2CHFA 2XOKA 4C3ZA 1KFBB 3C41J 5H80A 2VDWB 1BFDA 4QASA 1JIJA 4JQOA 1JT2A 2SKDA 2BFOA 3IERA 1FBNA 2CLOB 1KI9A 2WFZA 2C9OA 1ESMA 1C9MA 2LGJA 4KFTA 1Y1KE 2HA0A 3U7EB 2YJTD 3JW8A 1SUAA 3QPWA 5IYZB 3WDKA 2XD9A 2CZQA 4HAZA 2QKYA 2QGZA 3AEQA 1ORDA 2GHTA 3NP7A 3DMPA 3QNWA 5KO2A 3VKVA 2JI8A 2AEEA 3MINB 4L0DA 4MVJD 3G2MA 3MJEA 5H68A 3K0SA 3PX2A 1YMUA 4AZVA 2AW5A 1KRWA 1RI1A 1G20A 1T5LA 1P44A 2AI2A 3KKZA 4MWSA 4F85A 6LDHA 5K01A 3MWDA 1VKZA 2XDAA 3B1KA 5T6BA 1O58A 1LK7A 1OSNA 4C78A 3GRAA 4Q01A 1G3RA 3IPXA 2GLUA 2NZ8A 5THKA 5JBIA 3LGSA 3BZUA 4LF6B 2YC4C 2I67A 3GT4A 4R6WA 3FJYA 3DAFA 2A0YA 1WBJB 2AMJA 3UV6A 1HDIA 4TMXA 1JDUA 4IVNA 2CNKA 2WE7A 5CG1A 4QRIA 4YRBA 1R50A 3HY3A 2Q46A 3TQQA 4BGUA 1E2QA 1E1CA 2A5LA 2QX7A 2R4TA 1BVRA 3H8WA 5DLDA 3JATB 3W9BA 2JFNA 5K3FA 1XK7A 1M34A 1J2EA 5AXCA 3K71B 2I3DA 2FPIA 3BB4A 5LA6A 1ODKA 4EUKA 4N0EA 2A0KA 1DC8A 3CINA 5HF6A 3IDQA 3LCJA 4YIHA 4FMDF 3I04M 2IBTA 1KZGB 4CCYA 3DOCA 4FBLA 1YQ9A 1JB1A 4TYYA 3Q7TA 3OTQA 4WACA 2CNOA 1TZMA 1C1DA 1QGUB 3HZZA 4RIIA 1Q1BA 3OFJA 3RYIA 4BEJA 1IG0A 2E1RA 3QLVC 2FZ4A 2LUOA 2HIMA 4IMRA 4DARA 1TQHA 4B80A 4RZQA 1MQ9A 1UDAA 1W48A 3MGCA 4BMNA 2P79A 3M1LA 4UE3S 3I6BA 5ERXA 2XLBA 1U3GA 5WRFA 2CNWA 4CLOA 5IH7A 2IP1A 2FZWA 2WUGA 4IYJA 2QTVA 3K0AA 4LN1A 2G6BA 5LOVA 5I7UA 3HUUA 3VISA 1LSUA 6Q21A 1Y5NA 4U7GA 4EQZA 4O29A 2L2QA 2WIBA 1AMNA 1NOJA 5F1YA 2HHHB 5LP6A 1T0BA 1JSZA 3PPIA 1R27A 2QI9C 2BF4A 4HEJA 1RI5A 1BN6A 2VI5A 4URWR 5JZ9A 3RCBA 4D3SA 1O4VA 1IZZA 2HMUA 1YJQA 3W6ZA 1CFZA 1YHYA 4O2BA 5CLQA 1JSXA 3B6MA 1QX3A 3LPCA 4E7PA 3AJ9A 4LBYA 3V7WA 5BURA 1DO0A 1XPJA 4INZA 5ALPA 3CXRA 5KSOA 3MLBA 4AZ3A 4WXRA 4I2VA 5E7JA 2QAJA 3E15A 4LZLA 1WVMA 4DMCA 3LBYA 3L6EA 3HCOA 3DDHA 2I7XA 3VA7A 2WILA 4ZV9A 3RC7A 1QH1A 4TTAA 4BVHA 1M8PA 2NO6A 1JR3E 3D43A 1DWUA 1GPJA 2YWGA 1R6AA 4QUAA 3AR9A 3GGSA 4ETWA 2AMYA 4DY4A 4AP9A 3CPJB 4EYKA 3EMKA 3H5RA 4DIUA 5SZJA 3V00A 2JHAA 3FNHA 4TN5A 1MTZA 1ZK3A 1NTRA 2I2CA 2K7ZA 4MGZR 1LK5A 3EISA 4QELA 4QXAA 5H5JA 4IQFA 1NJ6A 3LLCA 1L5HB 4TMFA 4ALKA 3H9JA 4J0HA 1ZP6A 4UAJA 4OHFA 1X42A 4TV8B 1VPWA 4YFVA 3KEOA 5CK5A 1JEJA 1R0CA 3K6JA 4V39A 4RZIA 3VC1A 3ZGOA 4K88A 4CQMB 3PHLA 1IZ8A 3TRHA 4DA4A 1PE0A 2VJMB 1BE8A 2P78A 2ZIXA 3KDPA 5AVRA 1Y81A 2HSGA 3B3JA 3DLCA 3HBAA 3LXXA 2GNAA 1X74A 2Q62A 1CVIA 5E6UA 2XT9A 2QUAA 4P0QB 1EFCA 1A88A 4L0MA 1L5KA 4DA0A 4ZWNA 1M1NB 2XCUA 1AT1A 2GRAA 4R5HA 3O47A 1GTG1 2QJOA 2CB0A 4N0DA 4B34A 4M1SA 2IITA 2ROQA 2XGGA 2BFMA 3H84A 3T12A 4ZO7A 3DE7X 2HJGA 1LPAB 1X2BA 3V2HA 2I71A 5I48A 1LCIA 2OZLA 4YBRA 1P61B 2DE0X 4EG0A 3IJPA 4MV5A 3W5JA 1KQNA 4NS1A 1J9ZA 1N2OA 5JQGB 3C2QA 5FO1A 1G60A 2Y2VA 4CKEB 3LKZA 3UK6A 2QZPA 1H2EA 3O7WA 821PA 1RBMA 4CKEA 4CV1A 4KW7A 4A6DA 4F8YA 1R6XA 2FF7A 1KMIY 2R5WA 3G0GA 3QM1A 4ON9A 3ND9A 2AFVA 3IDAA 4BMXA 4ILEA 4EGSA 1M7BA 4ZANA 7REQA 1BXRB 2F4VB 4ZEMA 3G1UA 5C32A 1Z4QA 3DAPA 5AJTA 4RA6A 1TA9A 2E1PA 3O4GA 4HNQA 3HGMA 1D7AA 4YS6A 1GFSA 1SU6A 3NWEA 3R9XB 5J59A 5K8CA 1BHJA 3GLUA 2KB0A 3FE2A 3ILVA 2WU8A 2WT8A 1U8XX 4Q7KA 2J5KA 5ALZA 2DOKA 3SIWA 1SKYB 1JQ5A 1VJDA 1YD7A 1W88A 5LZ5A 1NVAA 1GA4A 2BM9A 2MSLA 2WZCA 3D0RA 4L22A 3UB2A 4D57A 3AVYA 2P3OA 3EVCA 2O2EA 2OO5C 2CDRA 1G4HA 3B1FA 4TS1A 3JQBA 1L4MA 2GK6A 4J0FA 4QUBA 4X1KB 4Z0NA 3UJ7A 1HDGO 3PC3A 3V8QA 4JP2A 3ITDA 4OM7A 2A78A 2DT5A 2I2FA 1U7HA 1ZITA 2ZRHA 4JP1A 4IIBA 5AVJA 1VJRA 2ZYHA 2IHYA 5F2OA 2FUG6 2ZRDA 5JQGA 1D9ZA 3CKKA 2G1UA 3U7IA 2AYYA 2VT3A 4L8YA 2AJCA 3BMCA 2JJ2D 2CHEA 2G4VA 1YDFA 3JASB 1YQXA 4Y1EA 3HYRA 5GZ6A 5HIJA 2XXBA 3JD2A 3Q0EA 3AERA 5TS2A 5LA6F 4DYDA 2Z3WA 5EQTA 4DNPA 3B2NA 3LC7O 4JEHA 4NYIR 3JY6A 2JFOA 4ZVNA 3R3ZA 1W59A 2GCIA 1WXHA 1OXVA 4X7MA 1NPDA 4HRAA 2XOEA 2IEBA 1HDCA 4JS0A 5K5EA 2Y9MB 2G0AA 1IRIA 1N2ZA 3SQXA 1AKRA 1JAHA 4EW1A 1U8EA 2BTQB 4EGCB 1Z16A 1WXQA 3FRJA 4M0UA 4K2HA 2JI6A 4Q02A 3GLFB 3ETDA 1L7VC 3A1DA 2X58A 1R18A 1VMKA 3V4ZA 3KQSA 3KYDA 1KQPA 4PLHA 5JYDA 4W5OA 1Z68A 2P40A 3MFQA 5E7IA 3RE1A 1GITA 3ORQA 3RTCA 4D9FA 4BFTA 4RFVA 4J6EA 3ND6A 1N6LA 1CU1A 2IYZA 3WO1A 3W8NA 4ER0A 4RIHA 1C3LA 4AYXA 1UMBB 3GH1A 3SFTA 4E94A 5ALKA 2VPZA 3QBEA 1Z5VA 4U9HS 3TTXA 4BJ1A 4F84A 4M7WA 4XSGA 5H70A 2F55A 1YQTA 1M54A 1UJNA 4YK7A 2VH5R 1ZBDA 5FIUA 5JWHA 3VJLA 1ZNWA 3GJXC 3SQMA 3UF0A 4AURA 1YC2A 5A03A 5TRTA 1J1IA 1GSHA 2ZATA 3VBCA 4B47A 1FFWA 2IYAA 4MPDA 3F46A 3HZRA 3BFPA 1JKIA 1PJ8A 1PRYA 2QQGA 3NCHA 4I55F 4NZZA 5P21A 4MRAA 3ZHZA 4GRDA 4XLTA 4CUZA 1O3YA 1KF0A 2IHJA 4RETA 1JFVA 1AXEA 1NVUQ 1O5TA 3DTTA 5E8RA 3ZK9A 4BQIA 3RJ9A 3T4XA 3DVAB 2VT6A 1Z4KA 3D8BA 5KI6A 3FFTA 5CBKA 2QLLA 3A6GA 1E5LA 3CF0A 2IW3A 3JVEA 3GRCA 2P2GA 3BBLA 5AHOA 5JSHA 3IV9A 2GRJA 1VSQA 3QVXA 4X8LA 4C1BA 3ROXA 2MSDB 1DUSA 3STHA 3PIDA 5C5EA 2OCLA 1EQAA 4B44A 3T3EA 2JATA 2ZSKA 5IBQA 5LVAA 2ZBUA 5EG5A 4RPHA 3U3OA 2C97A 3VMMA 2JANA 5FFNA 1Y4UA 1NGSA 1YFKA 1NVDA 3A4NA 2C4VA 3EF3A 3T9FA 3FVRA 4GPD1 3VYUB 2RI0A 1GPLA 4KKXB 4LRQA 3VU3A 1VJ0A 3R7SA 4E5KA 2CXQA 5TC4A 2PS0A 2QTMA 4IMJB 1MFZA 2V4MA 3GQBA 3GA5A 3DBOB 5EC8A 4ZTUB 1WOMA 2FWNA 2VUHB 1RW4A 2AC2A 5DSXA 4FJ1A 5F4ZA 5KMGB 3CUYA 4BN0A 2WNSA 1QHFA 3T0FA 3QEMA 3CRVA 4I1UA 4A6XA 1ZJZA 4ZYYA 2J59A 1PFKA 3DV2A 3MXTA 4AKIA 3DFFA 1G8MA 4HHEA 1JH9A 3I72A 1BGXT 2Q9AA 2AHRA 3RVNA 1EUCA 4ZICA 3TOCA 4CCYB 1T34A 3R6DA 4X7PA 1YIDA 2Q49A 5C34B 1B74A 4YMSA 3T15A 1EVYA 2W6QA 2Z57A 3PHJA 4YGXB 1VKJA 2R66A 1UP7A 4LQDA 4CYMA 1ZUNB 5A2GA 4EB6B 1E7YA 5IUKC 2A9QA 5JNRA 1XZQA 4OB7A 4OLAA 3G79A 4X63A 2O8FB 3KVOA 1U8FO 1UWKA 5A3SA 2GRUA 2Y77A 1JJAA 4HN2A 4PG7A 3WSWA 2CLHB 1T8PA 1CHDA 3L7NA 3R7DA 5J4VA 1M67A 1SVSA 4NJMB 3CN7A 1RADA 4PO9A 2GM5A 1FMLA 4MR7B 3UMFA 2QXYA 4DAEA 1TLFA 4AECA 2ZAOA 1MCZA 1G55A 5I7FA 3H9BA 3IJRA 2YMQA 3FY4A 2G06A 3JQGB 2ZJ1A 4ZYWA 1TFRA 1PGNA 4KQFA 2XB4A 4Q3EA 3FNRA 2V7QA 4B6QA 1WTCA 3CGWA 1E7MA 4GEGA 4OB6A 3V48A 2R84A 4TKUB 1X7ZA 3FPAA 3ICEA 1JZSA 3P9PA 3MTDA 4GX1A 4MB2A 1XIVA 4KFSA 4OB8A 4U3JA 3NIBA 1A2KC 3GP5A 3SBDA 4EELA 3EPKA 4O3FA 1XP5A 4NAUA 1X70A 3O1JC 3AFOA 3FHCB 3PJFA 3CFYA 5E4TA 1ZUIA 2BEVB 4EIWA 2BFBB 2V7UA 1DQSA 3M6WA 3OKFA 1JHQA 1SNYA 3QVOA 5ELMA 1Y1TA 3RRXA 1F2UA 1DMSA 1JBQA 4JX8A 2X8BA 3PC2A 4WD3A 4Y6LA 2VN8A 1CJKC 5CVUA 5KVQA 4DRXB 3UPUA 1A3CA 3TI9A 1Q91A 3OT5A 3FBTA 4L28A 1I9GA 1Z56C 2NADA 2PHZA 2O1WA 4FXPA 1OTHA 1ULBA 2VC2B 3RLFA 3A4LA 4LNUA 3EE6A 5E3HA 4XWOA 1J39A 2GWRA 2PX2A 3DOFA 3MM4A 3EIFA 4UEWA 5LBUA 5CA1A 1EQ2A 5AWFC 3CH4B 3IT1A 2RE8A 5CW2A 3QPAA 4C7BA 4NL4H 5CCBA 4IFBA 3GGJA 4DQ0A 1TAQA 4RJTA 3QRWA 4WV3A 4EO4A 1XMQB 1DPGA 1NVFA 1PQYA 3B5EA 5F64A 3RIXA 2AKEA 3MJFA 4MYSA 2HNKA 1URPA 5EP1A 3A6DA 1NQOA 1SBHA 1T5DX 3JQAD 4PO8A 4RF2A 4UUPA 2IYOA 4KLAA 2W2LD 5DCLA 5KPDA 3H5AA 1KJNA 2HI0A 3TJRA 3C6ZA 2H85A 4NI5A 5B3JC 4XWKA 1VIDA 4NOMA 5IJZA 1NKTA 3VV3A 2BI4A 1XKXA 1ADYA 4DNFA 3VNRA 3CC8A 1FFCA 1F8XA 1DXHA 4IS3A 4NBSA 3HCWA 3U1BA 1KTIA 4MR9B 1K0UA 4P4SB 3TRFA 2OSBA 2IYFA 3Q10A 4M86A 2QZZA 1D6SA 1WX1A 2O2ZA 3C0KA 3NNDA 4UM5A 3VNAA 1RZVA 3QTBA 3FPKA 3Q9SA 4MTLA 2PWYA 3JALB 2AW3A 2RGNC 1L7QA 3MJSA 3NT5A 1IXKA 2PUBA 3IKMB 3O9MA 2GF9A 2ZW9A 2QRLA 2DCUA 2JFXA 2NG1A 1YKSA 3ELYA 4Y6OA 1G6Q1 3WLJA 3ET5A 1DX4A 2RH9B 3HU2A 4H1UA 4EFKA 4F2DA 2D5LA 3AHEA 1GRQA 3OIVA 3OUTA 3CLSC 3K9LA 3H8SA 3SSMA 1E5QA 4Z4FA 2AG0A 2AJBA 3OFKA 5EXDA 1L8OA 4C5AA 1GPKA 1H0RA 1U3WA 3AIOA 5CEFA 4ND7A 2PBLA 3GRUA 2L0XA 3SX0A 1CR4A 1I24A 2P9BA 1TIBA 5AKHA 4JEIA 1AQLA 3ZVMA 4OREX 5EMLA 2WG1A 4Q0MA 2NWQA 4EK9A 2BFAA 4TS3A 3GYBA 4IDPA 1HE1C 621PA 2DM6A 3AKEA 3TD6A 4GPIB 5I9IA 3E3LA 4EW2A 1HNWB 1Z8HA 4PQEA 2C54A 4DMHA 3EA0A 2WYIA 3FZEA 1BA2A 4R1QA 1T8WA 4KXFB 1B6SA 4IJUA 3COPA 2RI6A 3VYVA 2VDLB 3IH5A 3NDBB 3X3HA 4R0VA 1GSIA 5JH7B 2O8FA 3O2QB 4BQNA 1SU4A 2C5LA 3I53A 4WOKA 4YRPA 5A05A 1RXVA 2G4CA 1V9SA 3WYGA 2Q45A 3NDPA 4H35A 5HBGA 4ZTBA 4FU0A 4NAVA 4IUCS 2HLHA 2IL1A 3JZAA 4NV1A 1OWMA 1XF1A 3T95A 4DTCA 7AT1A 4YAOA 1H2AS 1IEQA 1GNPA 4RLHA 3TG2A 5L3RA 4HFNA 1Q1AA 1WOYA 4R9VA 3UAYA 2YXEA 3F5SA 2H08A 2I87A 4TSFA 3WIDA 3O73A 4D8WA 4L0CA 3FVWA 4ZI3A 1XHEA 5K3OA 4ZU3A 2ZSAA 3MJCA 5AXBA 1Y4AE 2X8JB 1JFSA 4OHWA 1MC4A 3O6VA 1U3DA 1EWQA 5HR5A 1JWBB 3HQ4O 5FYDA 5IH3A 1GCIA 2JJ1D 4PO3X 4PTLA 4RGVA 5C3UA 4W7SA 2Q0SA 5BUZA 4Y98A 1TNDA 3PGKA 5EVCA 1FYDA 2AX3A 2HD4A 3PHIA 1XLVA 4WNYA 1WHSB 4UAVA 5A4JA 1IQPA 1AKEA 3MUNA 5LJIA 1JHXA 3A10A 1P8AA 1GQRA 3I64A 3RS0A 2N1MA 1OB5A 1VIVA 1W8IA 2X3FA 1NI4B 4P6VF 4IR7A 4Q3OA 4XGRA 4BRSA 1DTWA 3T9CA 4CM3A 4E0BA 5GV8A 4QO8A 1Z2OX 2EF0A 3AHJA 4R4JA 3L4SO 5FLKA 1ZMRA 4W9NA 4OQZA 1LNZA 1J00A 1Y1QA 5LP1A 3H5TA 2PRJA 3TEFA 1CZNA 1JAZA 1LRLA 2X2EA 2H5IA 5TF4A 3GJ7A 1U1EA 1X0VA 4PSAA 3OZCA 1CY4A 1L7AA 1QJ4A 1KI4A 3C7CB 2GD1O 2ZRPA 4KSYA 3KR9A 4OF4A 5T41A 5GJVC 1F7VA 1CY6A 1FDSA 1XQVA 3ANMA 4HDSB 2IY7A 2SKEA 1JILA 2XB6A 1R64A 3JZMA 3RIEA 3OTOB 1M2JA 3HJGA 4M0DA 4MV4A 4DQKA 1NFQA 3DVQX 3ZKAA 3A27A 1C0EA 5FRDA 2EAUA 4BFWA 4XM1A 1QANA 2PT9A 3WKEA 1FVFA 2MR5A 4CNBA 3HNRA 4KIFA 2HQSA 4KWCA 3PJGA 3L7MA 4Q3BA 4BZZA 5IXYA 4GNKA 3GUVA 4RIGA 1OXTA 1T25A 3R2JA 5L8VA 1J07A 2I62A 1IJEA 2PS3A 1MA0A 1RM3A 3AUSA 4PR0A 2C92A 2PL1A 4LYFA 1QZZA 2XCSB 2K2QB 1P33A 1P4GA 1INLA 1NW4A 1L7MA 1RWNA 3A32A 3OAAA 1VJ1A 2WSSD 4L07A 5AHWA 2AC4A 4P84A 2GYVA 2C5FA 5SYAA 3ZOKA 1KYWA 3UH1A 1G8AA 1XMIA 1F60A 2F64A 4U7HA 1XRJA 5EQFA 3R9XA 4REMA 1BS2A 1RRVA 4H18A 1X1BA 3S2EA 1SGWA 4JBLA 5I9SA 5GIPE 4DXHA 2DETA 1GKLA 1CR2A 3WJ2A 4ZIRA 1M0TA 3GJSA 4WESB 3OESA 4PXAA 4DUPA 5LBIA 1FRVA 1UAYA 4URFA 4YUVA 4CDNA 3W6UA 4B43A 1TYBE 1ZD4A 5DXAA 4NMLA 1YVUA 1N5KA 3I9LA 1PR9A 1L5WA 1RLTA 4CM5A 2FW6A 2O2SA 3BILA 1KO5A 3KTOA 4EAAA 3OCYA 4YCCA 1U2SA 2FG7C 1RLOA 1MJFA 3B1JA 4O5OA 1T4CA 3PT5A 3OE1A 3JAKA 1YRAA 3BIJA 3HDHA 3NI2A 3KKQA 1DB3A 1Y7TA 3EMDA 4LIPD 4EY5A 1D03A 4PZYA 5B58T 1CE8A 1QYVA 3UWMA 4R9NA 1T1IA 4QT0A 1TEXA 2HLNA 4OKSA 1KI2A 3BKXA 3DF9A 1ZH0A 1RSZA 3VNUA 2R6JA 3UGTA 4CMIB 5IT4A 4P82A 1O94A 4WXYB 4F0JA 3RWMB 2HCFA 4DCJA 2D0PB 1UP4A 1U6KA 3PSAA 3T7RA 4JJFA 4HDQB 4RCVA 3E2MA 1N1DA 3C3CA 4BRZA 3RUEA 4G5RA 3EC1A 3ZDXB 2Z56A 4PYOA 4F12A 1FC0A 3AWIA 4B8ZA 3R9WA 1Y5LA 2AEMA 3G2JA 2QRKA 4FYYA 3DXYA 3WYCA 1P2VA 3OWHA 2BEWA 3Q3IA 3SX2A 2XQJA 4A1OA 5F5NA 4QJBA 5JYBA 1E3MA 2H2WA 5EZYB 4N7MA 4E13A 1ULTA 3ZWOA 4MUEA 4QEZA 3KZOA 5EAIA 4DY6A 2YUTA 1WS6A 3F8WA 4ZV4A 2POQX 1CEQA 3HE3A 3O8QA 4FMBB 4E6EA 9ABPA 1QHEA 2D62A 4PE5B 3PFIA 1THGA 3PKJA 3HMQA 4OEHA 4KPEC 4N8DA 5HGXA 1YZYA 3G5MA 1W7AA 3R5SA 4QG3A 2XWSA 1U4NA 2J1LA 1LPBB 2TS1A 2ZOSA 3ZV4A 2VVTA 1FSPA 1JDZA 2PUTA 4ENUA 2FZCA 2L18A 4JSYA 1WUIS 4PF1A 2OBBA 2GD6A 4AP5A 2B20A 3ICOA 4RU1A 5ALHA 4DIEA 1DG1G 4BBJA 1S2LA 4DLKA 2YASA 5KWJA 4K5QA 1NXOA 1VQ1A 1QWSA 1F9EA 3X1MA 1NV8A 2G8NA 2NVBA 1YI0A 3R0IA 2X8LA 4MPJA 2JI4A 4YP9A 3LTNC 3V6MA 1ZRSA 3ESCA 1CS0A 1FFAA 2CVFA 1AGXA 2ZM5A 3F4LA 2EBFX 1MW9X 5J4YA 1N3IA 4MARA 5AW7A 1A95A 3OY7A 1JMKC 1Z88A 2BOVA 3FSEA 4IG9A 1YS1X 1YUNA 2XGJA 3WK4A 2ZEJA 1SVIA 4LXGA 3QX3A 4QTZA 4IH4A 4BVJA 1RLIA 1IWOA 4O4JF 3NP9A 1T9HA 2PNJA 1NRIA 4PFJA 3ZWAA 1Z2NX 3BFJA 3PLRA 4RABA 4XE5A 3VR3A 3ZKWA 3ZBQA 3RODA 3IILA 3ABZA 4OO3A 4IPTA 5IM5A 2GCGA 4AUKA 3PXDA 2OLJA 1MXFA 1UBUS 3CUUA 1EVJA 3B52X 4IRXA 2FFJA 4G01B 5HKKD 5AW5A 2II6A 3W2GA 1B7GO 2ZBRA 3DXXA 4BVFA 2R1VB 3DM9B 1QRDA 1WVGA 5BUSA 2HCBA 1K7EB 4MB6A 2IIVA 3HZOA 3FPGA 4QUKA 2W2QA 2BMWA 1UPAA 1L7DA 2R6R1 1VE1A 1JJVA 2ATCA 4EI7A 4PAOA 3HUDA 3GL9A 4KL8S 4CEIB 5JSZA 3IB3A 4CCAA 4M22A 3OJWA 2RB4A 1JKXA 1Y1PA 1X1QA 2VWHA 2XLCA 1CR0A 2ZB3A 1V6AA 2NX2A 3AEQB 3NATA 4UNNA 4YH1A 5BT9A 5IASA 1OBVA 2O7RA 1FNBA 1N7JA 3AL3A 3QE0A 4A7PA 1C1YA 3U16A 1QS0A 2ZSDA 5JNLA 3LC2O 4IKEA 3DKKA 1GUYA 1OF1A 1UXIA 2AEJA 1DRVA 1M33A 1O6ZA 1TO2E 4TXHA 1L5ZA 4W5JA 1JIKA 4F7WA 4JHLA 5LP6B 2AWNA 3DW3X 1IXYA 3FNIA 2ZRAA 3KJIA 3VFDA 1OVMA 4EG4A 1DIHA 1GZHB 1SCIA 4Q3AA 2H31A 1DCTA 4DR7B 1II8A 1NT2A 2EZUA 3CLSD 3TZLA 1GPNA 1QGDA 4PNPA 1JZQA 3IQIX 3FNQA 2RGEA 3BN3A 4GLBA 2XMCA 4FD3A 2BE9A 3NALA 2ZLBA 1M6NA 4EYSA 1YE5A 3G0DA 4OHYA 1N4AA 4XX1A 1RTTA 2OCAA 1JTFA 3QELA 1DBRA 3T7KA 4BOYA 3FJOA 3QE3A 5CA0B 1A7KA 3E58A 2ANBA 3PA8A 3QSGA 4BMYA 4G8JA 4IMIB 2AE2A 5AI6A 1FP7A 1C3JA 1TYAE 2VT2A 3HKCB 5FAKA 4B45A 5K7SA 2A9JA 3A25A 2SBTA 1ABBA 4FK8A 2XXAA 1B23P 3LQ4A 3F73A 3GLIA 5TVGA 4BLPA 3RVSA 2HPHA 2ZRKA 5DP2A 2XRFA 4CM1A 2IJGX 3DZCA 3ES9A 3GEHA 5HTOA 1E69A 2AZMA 2W0SA 3UHAA 4OHXA 3V1KA 2K6GA 1UQTA 1SC3A 1SOWA 3HFRA 2CNDA 4FMPA 5IDYA 5JPIA 1SJ9A 1X7XB 2O2DA 2ZBPA 4B7XA 4KQIA 1XTVA 2Q0XA 4LJ4A 1E2IA 3PPWA 3QJGA 4KR7A 2J09A 5AVOA 2H11A 4IFTA 3HVHA 3ESBA 3PLAE 3S2UA 1R4MA 1ABEA 2B36A 2FMXA 2RKWA 3SYTA 1TT5A 1X15A 2PKQP 2UYOA 3E6AA 4JI2B 2WKPA 2O3UA 1VKRA 2LCFA 3DJYA 4TS9A 2VFAA 4QECA 1Y9JA 4QEKA 2MIIA 2YFQA 4ZD6A 3ZE8A 4EMTA 1A9XA 5HNKA 2H9AA 4NH4A 4BVEA 2I55A 2BGGA 3G2IA 4JQYA 4MAMA 4YREA 1FP2A 5LYYA 2AXPA 4BC0A 2QRVB 4DB2A 4J43A 2CGEA 3L5KA 3PQDA 4V0KA 2R8PA 4U7TB 4FFNA 5LYJB 1KARA 3DC7A 2XE4A 3VYWA 2HNAA 2DQ4A 3GOQA 1ZVKA 4IINA 4MR8B 4O4JB 5FL3A 4BZXA 5HKKA 3KQKA 3FHTA 2ZQYA 1QQ6A 2VO1A 3EW7A 2B8EA 1O08A 4WAUA 3ZI7A 2CFTA 1U2GC 4K81B 5I9TA 1ETUA 5CHEA 5J9FA 3O26A 2ZSEA 3EGWA 1XPOA 1I5EA 2XUAA 3KEQA 3T8YA 4BP8A 4Z49A 4PHHA 5BSKA 2J33A 2OSVA 1O8BA 1XO1A 3GGCA 2YJGA 2IOFA 3VPGA 1E8MA 1H5QA 4BLQA 1B76A 4CR8A 2J0UB 2O7NA 2J3LA 4UUQA 3RHTA 4I1RA 3T9EA 4UTVA 2WT9A 1YK0A 4KX5A 3D6VA 3SBXA 3DAYA 4FNAA 1JWAB 2PD3A 3AETA 4BNVA 3U3KA 1SEVA 3BDVA 1Q14A 4DEYA 5CB4A 3BXXA 1E1CB 4O2BB 4K9MA 3LYAA 4PLVA 3CG0A 1FXUA 2GD0A 2NTVA 1IUOA 3ZWXA 1H5NA 1O9BA 1YZLA 2EJUA 2WWTA 3SYLA 1WIWA 4RA9A 1IJFA 3TCNA 1KS2A 1F4LA 3P26A 4URXR 2BFFA 4QQFA 1QYWA 2X2FA 3QEOA 4DCNA 3NUQA 1N9ZA 2PY6A 5CT8A 1YAHA 4QPCA 4AO7A 2I91A 1MUUA 5HQ3B 4LFAB 3TK1A 2OM2A 2B92A 2P2LA 1UBHS 2D7DA 1XXHB 1JXQA 2D7JA 4CIAA 4O2AF 3IDSA 4YTEA 5FHRA 2XIQA 5FULA 4F4CA 2BGTA 1XUOA 2O5VA 4L6CA 4ZCSA 1ZVMA 1XZKA 1YVPA 2PUVA 3H18A 1LB1B 2QVLA 1Z33A 2JGJA 3FN4A 4Q4JA 4BVBA 1ILEA 3WLHA 2PJDA 5IWCA 1P6UA 1BX0A 2RC5A 1L7OA 3VR2D 2BEUB 4LZOA 1H66A 3VR4H 4B2IA 1XVUA 1XU7A 5AT1A 8GPBA 1FMJA 2UZAA 3AEKA 4B3HA 1BRMA 5EWLA 5D2CA 1ODCA 4ANFA 3COWA 1EZZA 1F2DA 3ECSA 1HI9A 2OXTA 3WA6A 3QU2A 5C0OE 1JDTA 2WNHA 1OLSB 3F3KA 4JX9A 4O1MA 3RM3A 3TSOA 2PX0A 3QW4B 3NTUA 2ZZMA 3IVAA 1BJRE 4LDZA 4CT4B 3HJRA 3U3DA 4NNPA 4XYGA 3V8RA 1QH8B 1S2OA 1X8XA 1ZD9A 1XJQA 3BIFA 1QYDA 1E3LA 2V9CA 1DEAA 3E8XA 1A77A 3IPLA 3N2KA 4ROSA 4I5EA 3QPVA 2MJLA 2D2XA 2Z5GA 2ZR0A 3QMMA 2PZGA 5AI9A 3GEEA 4MKFA 5BUQA 1LDNA 3C3YA 4FOOA 2P30A 2DPLA 1XN1A 4UARA 4WADA 2B1IA 1WMEA 1KSHA 1Z6AA 3BE8A 2C07A 3HFGA 4G07A 4JVNA 4KLRA 4OQFA 5FFFA 3S44A 4BGIA 1Q21A 5EYPA 4K1LA 4N76A 3EUFA 1QLHA 4CLHA 5BMVA 4JB3A 1UWVA 3L5OA 5F33A 1MP0A 1C4OA 2WVAA 3H42B 3LFTA 4HH4A 5AK6A 5DN6A 5FI3A 1OXMA 1YCHA 3WYDA 4ROTA 4BNLA 4EUEA 4RPLA 1YFLA 1UR5A 1SUDA 4I4TA 1ZLYA 2EFHB 4GWLA 1YCFA 3FSGD 2AR7A 4UTXA 3VDXA 4JJKA 3GR6A 1FPMA 3EULA 4NFYA 4TZ0A 4QGHA 4ZPJA 1EK6A 2QTHA 3AP1A 3BAZA 3QVGB 4WWHA 4Y2SA 5I7AA 3RHZA 2YY6A 1D09A 1YIOA 5A71A 4W9NC 1RHMA 2BD0A 2HDHA 3V33A 1CRLA 5KREA 4X1OA 1ZGGA 1IZ7A 3D6FA 2AXQA 3ADPA 2IELA 4OXYA 5ISMA 3DEFA 4QGGA 4AJ2A 4DZRA 1V7QA 5JADA 4MUYA 3NVAA 1IOLA 3BD9A 4J07A 4NOJA 2A7XA 3NH9A 1VRWA 2YJ6A 3TTWA 1MT3A 3T9BA 2J3JA 4RWZA 1D1TA 4OL9A 1ATIA 3OOYA 4ZEXA 2EIXA 1PQWA 1U1IA 2SCUB 3BA6A 3E1SA 2OL4A 3I76A 1GGKA 1YE3A 1Y1SA 1OW3B 3TBFA 1Z75A 2QSUA 3BIXA 3PVCA 3QFRA 2QV0A 4QUDA 3A06A 3CX8A 3SYMA 1QKIA 1SU7A 5K8IA 4EAQA 3EC2A 3RRYA 3TJMA 5LR6A 1Z28A 4LJ7A 5EYPB 1E4EA 3EXG2 5GOZA 4XX0A 4HPJB 4MP8A 4W5QA 2PKCA 5FR2A 2R85A 4C0BA 5LLDA 1M66A 1DWOA 3KLPX 3EN0A 3HJBA 4GW3A 4PBRA 2RMKA 1XD2B 4ERXA 2EFGA 4Z2AA 1DKUA 5ALUA 5C18A 1GV1A 2KLHA 1EFUA 5D6NA 3CY6A 2WJPA 3DE6X 3AONB 4I66A 2XXJA 2AF3C 3KUXA 4RC9A 3WRWA 4MQFA 2Q9CA 1DX9A 1TTPB 4FDMA 4AJHA 1XXHA 3JWPA 1SBZA 2BP7B 3IUJA 2GPBA 2PV7A 2P5YA 3SSAA 2QVCA 2RK4A 4L9WA 3RKUA 3VR2A 3W5VA 3WFZA 3T5AA 1NBWB 3M0EA 5HE9A 2CNNA 1UOOA 4PTZA 5HX7A 1S02A 4DIMA 1SCKA 3N3AC 1MEEA 4XGQA 1N7IA 4EEZA 1RZ3A 5DN6D 2NYRA 1PJCA 4ZOLB 4KHZA 1SUBA 1X6VA 2BF7A 1Y3CE 2Q3JA 3LP5A 4TLMB 1ZNXA 3NUZA 3W2IA 2GN2A 1TZBA 2YNMA 4YCJA 3WLRA 3EFHA 1Y9DA 4L4XA 2BMVA 3O4RA 3PWTA 2E4ZA 4HDRB 1KYVA 5EE1A 2YBEA 2YFKA 4NG5A 2IWHA 1RI4A 2CFIA 5F78A 5KNBA 2C7PA 2O20A 2PRSA 3C6YA 4I46A 5L3ZA 2J9GA 3V55A 3GPCA 1P4JA 3OE4A 3ZGNA 5JSUA 1GZ3A 1L9KA 1B41A 1W94A 3A0RB 2WU3A 3AVWA 1FJGB 1DIGA 3GX1A 2IDKA 3E9MA 3MPUA 4ESVA 2CL6X 2AN3A 4REQB 4WI1A 2Y1WA 4F04A 1X19A 1T5TA 5JSKA 3Q15C 1EEXB 2RHBA 1XWFA 2P62A 2ZTUA 1OFGA 4GDMA 4MS4A 4OHVA 1ZJWA 1NJ8A 4FUTA 5AP9A 1DAHA 4PQRA 5TVKA 1TUEA 4XM2A 4FXOA 4MI9A 3ND8A 4FSHA 2EW8A 1JQKA 4HPWA 3KQHA 2HU2A 1RC1A 2X23A 3WLSA 4C0AC 2A8YA 2OGTA 1UUFA 3M82A 4MWEA 2EERA 1H9BA 1OZ0A 4YAFA 3DE2X 4OLFA 1H2YA 1GUDA 2DFLA 3M5CA 1Z45A 1OFUX 2QTZA 3WI7A 4E22A 2MSNA 3KO8A 3MTGA 1E5XA 4OBEA 2TMYA 4DCOA 4KDRA 1XRPA 2HBRA 2REQB 3ZD9A 4DIFA 2CMKA 2D0IA 3GDWA 4PPNA 1KOJA 2I2WA 2LVBA 1P80A 1YR7A 1SKQA 3C1OA 4KAAA 3CLUC 3R74A 3EZNA 2FW1A 3EDOA 4Y6SA 3JZFA 4EF5A 4BNDA 1H2FA 3H8JA 3LVBA 4EATA 3AI1A 5LYJA 1T13A 3LRPA 4YMHA 3JSXA 1W73A 4RIEA 5FOTA 5IZCC 3URMA 3WNDA 4O4HB 1P5JA 4GL2A 1EWYA 1JPNA 1E9CA 2XF8A 3IB6A 1FTGA 1T2AA 3GN2A 3MTEA 4JUDX 3V46A 3K9GA 3WA7A 1ADBA 1TKAA 3IEXA 3QHAA 2VA9A 4M1KA 2AL7A 3WGOA 4Q05A 3M4ZA 4CE6A 2AOTB 2QX4A 1PNRA 2JH8A 3JU3A 3PE4A 4X1IA 5ER6A 3IP1A 5B7NA 3GN1A 3NIFB 4PZAA 1RJEA 4B2PA 3PEWA 1XTZA 1SULA 4B83A 3PGLA 5GM1A 1PFGA 3LBAA 5D6OA 1E0DA 1N7GA 1Q0SA 1S8AA 2Q8NA 4GF5A 3UK0A 2HA5A 3GY0A 3I6MA 3UJCA 5JASA 2VK1A 1GARA 4RCZA 4WN3A 3RTEA 1P9NA 1F2TA 4R1NA 2LCIA 3FOFC 3DE0X 5JD4A 4AZWA 2ZYUX 1SQSA 3I1JA 2AYZA 4HGYA 3I61A 3SIPA 3DMFA 3KD2A 1Z6ZA 5EIOA 2H1CA 3WIUA 5KTPA 4DQDA 2P69A 3W3AA 1MAUA 3VKWA 1IBCA 1XZCA 2F1IA 1ZIOA 3VHQA 1IQRA 1GPBA 5TF0A 3BMNB 4OJKA 4EUSA 5JNWA 2P0EA 3G9TA 1Q19A 3CH7A 3WHIA 1Z7GA 3RNLA 2IU3A 5ALTA 5A4AA 13PKA 3EPHA 3QOFA 4WY5A 3E9DA 1GQFA 3HWX1 3KZ1E 1A69A 4YXWA 3T9AA 3ZBTA 3LYHA 2P9YA 3E7PA 5F77A 3IIEA 4CTJA 4CBVA 2RBEA 4GMFA 4QTTB 5HZMA 3AYZB 4YWHA 1CIVA 1CNEA 1G5FA 2J5RA 4QBIA 1QKKA 3SBOA 5BOVA 1U1CA 4DILA 2IQ5A 2BDUA 2RFLA 2WHQA 3LK7A 3RRZA 2GFQA 4UUAA 4TWAA 1P17A 2X0KA 3OLQA 1RKQA 1W9HA 1ZJ6A 3LHFA 3FYTA 1XDZA 5DHSA 3GWZA 3G8DA 2IYRA 3AXSA 4TM8A 4AKSA 1ZKMA 2HSJA 1VHJA 2JVKA 2W42A 1RLMA 2OPBA 1OYWA 2PGAA 4DLVA 2V6GA 4NOKA 2GPAA 4HUQB 3TTYA 1S2IA 4RNCA 4Q93A 3RS3A 4C7JA 1X77A 2QSZA 4KQ1A 5CVDA 3IAAA 1JKJB 3O3OB 5HM8A 4YUYA 2QLFA 4GPTA 4IKPA 5KYYB 3AGPA 1GG2A 1OBHA 4AT1A 5IANA 3C3XA 4PBTA 1AK2A 3FZYA 4LHSA 2ZYSA 2MDTA 4M7RA 4Y30A 1WZIA 4C14A 1U04A 3A2NA 1JU3A 4CM9D 2P9JA 5H4HA 1L4FA 3BRSA 3CT4A 3DR3A 3J81k 1VBFA 2AUNA 4F2WA 5CLFA 3T4EA 3LT0A 5NLLA 2VDMB 3G2NA 3BJMA 4FQ8A 3ZVLA 4BNKA 1BQ3A 1HQKA 1MQ8B 4JLSA 3QYAA 3I45A 3M3PA 5HUHA 2AZTA 3THXB 3P32A 3DOJA 1VBKA 2GKOA 1K2WA 1K7CA 1DQNA 4H3HB 4BVLA 2DR0A 3BUSA 3ZJUA 4NP6A 4NBNA 4CVNA 4TTQA 3G0OA 2P7IA 5F9FA 2GS9A 4EVIA 1L5HA 3H2SA 3HFJA 1XVTA 2VS1A 4B6OA 2C1XA 3AYXB 2YIDA 3A31A 2WDPA 3BH6A 2COEA 4X44A 1XDWA 2QPOA 1SBNE 1U28A 2HYDA 4J4HA 2M6RA 2FUG1 4NYJQ 3V6LA 3VO2A 3FA2A 1H2WA 2XUPA 2JJYA 1T10A 2C5HA 2MMGA 3B3AA 4HDMB 3INRA 1GGMA 4KO2S 5ALOA 1D8TA 4KLNA 2JJ2A 3TTVA 2WQ7A 4A4DA 2FMIA 1OZGA 1WEKA 4V2UA 3LWBA 5EMKA 1QCDA 4C1NA 2UKDA 5IC5A 3IVXA 5BV0A 2ZUEA 4BPBA 1BEZA 1KPHA 4R9RA 4P5EA 1BMFD 1LX7A 5E9JA 5K0LA 3NRCA 5HIAA 1P2SA 5KKAA 1KFCB 1W0JA 3JD4A 3PQ7A 1CZHA 4JOBA 3DFKA 2Y1EA 5IJ9A 3CCBA 2EFDB 1EGQA 2CKDA 2ZUVA 3I5UA 5HGJA 3QVTA 3V4OA 5H9WA 3S40A 4PFKA 3FR8A 4IJVA 4Z7JA 3T3NA 2OKGA 1PT5A 1ZXLA 3OOWA 4ZOBA 1R8QA 1FQWA 3FDFA 3X1JA 3OX2A 3V7UA 3R0VA 4C20A 2HW8A 2G0NA 3HYTA 5H81A 4B6JA 3HCPA 4CV2A 3NYWA 5CNMA 4RY9A 3BL8A 1AX9A 2X86A 2MYUA 2O23A 2MT9A 3CO5A 3DMGA 5JAHA 3I92A 5KQRA 1G42A 2M98A 5ED0A 2WJ4A 1P0MA 3UK7A 2BE7A 2NVUB 2DVMA 1L3BA 4AWBA 3VO8A 1T3TA 2F3PA 5SZKB 1RI2A 4JDUA 1WAMA 1ZGBA 1RACA 4M0PA 5LM3A 4IV8A 3QVWA 4UPDA 3W04A 1MB9A 3ESQA 3G2OA 4P3OA 4BTVA 1LRJA 1OCEA 3E3MA 3BMQB 1YA8A 3U44A 2XNKA 1TK9A 2QDXA 4M3NA 4MO2A 3JARB 1O97D 4G0OA 1AKVA 4DBVO 2C9MA 2AFHB 3ETEA 5ALEA 5L45A 1CJVC 1NW5A 1Y7LA 3NONA 3E2IA 1J25A 4OFBA 1D6MA 1SVUA 4I1SA 2WM9B 2G80A 1UXHA 3BXGA 4MNTA 4O59O 4K9LA 2XEDA 3JATA 4MB0A 2RIPA 3R6GA 3WKAA 1F6BA 2CDCA 1IM8A 4DN6A 2FWPA 3EARA 2GZ3A 3FB4A 5FBVB 1CFJA 4R69A 3WICA 1SPXA 4GLOA 1WQ3A 2YWBA 3TLJA 4WLOA 3DVRX 2J6BA 3G6WA 5KDLA 5H02A 3U6KA 1ZICA 1W4LA 3A0UA 2ZRMA 4Q3KA 3L1IA 1RJFA 2E9SA 2FQXA 2Y4OA 3IO5A 1RP1A 1L4LA 4AMZA 5DM1A 3L8ZA 1T5OA 2HK7A 3CISA 2JGKA 2ZJ2A 3ASVA 4PIMA 4ATNA 1ZGHA 4EWLA 1L5MA 3D31A 2C3PA 2FMFA 2P4HX 3D8UA 3QLEA 3SVZA 2ZJ8A 1JI0A 2GPTA 1AS2A 2OFPA 3HYLA 4IHJA 4JEUA 4P8RA 1FSFA 3PPYA 3AGQA 4LRSB 4R40A 4TWRA 1C7RA 4B46A 5BR1A 2AMFA 1K89A 1R10A 1G20E 1USWA 4HD8A 5T67A 4ZK6A 1UPTA 5C37A 2F1KA 3P9NA 3IT0A 3LHKA 1RAIA 2OC9A 3AESA 4ENPA 4BBPA 4WXEA 4I1IA 2N46A 3NV7A 1DC5A 2CLDX 4NU8X 1WCWA 1G7SA 1T0JB 1PDVA 2OAGA 1AXRA 3IIJA 3WTCA 2GN1A 3H2HA 4LRYA 1XMJA 3W5CA 3PE3A 1C1HA 3A2KA 3LZCA 5AJXA 2X42A 3NPAA 3MOSA 5JJ5A 1QHHA 1CQIA 4S2EA 4PAMA 1I3NA 3BH0A 3QKIA 3U37A 4C4XA 1NN5A 5JJCA 1JG7A 1P1FA 4J0JA 4JGIA 4RLFA 4D8YA 3EPPA 1RABA 3T5BA 5BQXA 2HQOA 1FJ2A 4H3VA 2HTEA 1NVEA 5BNWA 2OYRA 3VUEA 1LA2A 1BMFA 1RWMA 1W75A 2EKDA 4PQFA 4Z1MA 3N07A 4D41A 1OT5A 1G3MA 5CBPB 3UGJA 1MO2A 3D8RA 2ESRA 2GZDA 4KCGA 3EDRA 3MXOA 4BXOB 1P19A 3HVKA 1JEQB 2XUZA 4D26A 1XTKA 3EZ9A 1ETHA 4OQNA 4GVPA 1EB9A 5F1KA 1R9NA 1WTAA 3K6RA 1DP4A 4RMIA 5HZGA 1IRXA 4Q3DA 1E9FA 1KHTA 2FWAA 3IAXA 3WLPA 1U9IC 1FYFA 3PYXA 5A0FA 2JBAB 1KNXA 4I9UA 3HYSA 5TPWB 3QKRB 3L0SA 3NNNA 1U5AA 4PC7A 1AUPA 4NNOA 3NNSA 4LF5B 1DDOA 3GRRA 3GLIE 5LSAA 5DYWA 1JS1X 1KO1A 4Y1RA 2FE1A 3EDMA 4UDNA 2IZ0A 2QIOA 2VDKB 3RVJA 1N8KA 1Q2XA 3UQZA 1P9RA 3L8HA 1RVV1 2FQWA 2QA5A 1CUYA 4HUQA 4YUWA 3PI6A 4TYNA 4Z4EA 4F9TA 1ZWKA 1USIA 1LDEA 4EY6A 1SBTA 1U2EA 3EX7C 2FPSA 4N1AA 1KYYA 2WMOB 2ZYVX 3BT7A 5ABPA 1QB7A 3INGA 3HUTA 4IILA 3S27A 2P2ZA 1TCUA 1PR5A 4ND8A 5EMHA 3ER9A 2X77A 3DBLB 1T15A 3ADDA 1MD9A 3PNOA 2LV8A 1AM4D 2G5TA 1MVLA 1HDOA 3C15C 4IXDA 4LMBA 3RJZA 1QZ3A 5ESWA 4Z6KA 3R3UA 5BVGA 2LWIA 1JG2A 2W2XA 4IDCA 5DTMA 2J7KA 4RK4A 4XKJA 3MK31 3VHXA 1QHIA 1Z2AA 2I1QA 4U7PB 3FMVA 4JSRA 4NONA 4BGEA 1XFDA 4D4HA 5BW4A 5BY2A 4M83A 1ID1A 4BNFA 2IYXA 1OI7A 4DXDA 1E6UA 3KOYA 4NH0A 5A5DA 1CY2A 1KJYA 2OYSA 3NHUA 2NQTA 2E48A 1RKBA 1KAQA 2NNLD 3CRZA 1N2GA 5EHQA 5IK2D 5K99A 1I2ZA 4QOHA 3IIMA 3SKXA 2ZT5A 4M8NE 3AVOA 1Y8ZA 3TR0A 1L1EA 4HAUA 2JGAA 3I4CA 5KOJB 2CXRA 1M2VB 4D3DA 1XAGA 3CLTC 3GMSA 3IKJA 2GLXA 3V2IA 3ZNQA 5ICEA 4EB0A 1DKRA 4F6LA 3GLHB 1O0CA 5AIBA 2Q4BA 2YNMC 1P3Y1 2IKSA 2DRIA 2EFYA 4H2DA 2X9VA 4DEXA 1MVOA 3PTZA 3R8CA 3UO8B 1QP8A 4OHBA 8ATCA 3BXEA 5CCXA 2WD7A 1JLLA 2BLLA 3H9QA 1Q3KA 2I4NA 3O0DA 5E3JA 3PEFA 1Y8QB 1ZW6A 5MN4A 2ARKA 2PBRA 3UKDA 2FGKA 4PC6A 3CEJA 3SR4A 2C29D 3QYPA 3HABA 1OGIA 4MS1A 2R6AA 5MGBA 1XCLA 4PLGA 1XZJA 3LBHA 3PHHA 1JLKA 3PI7A 4DQUA 1I6KA 1X92A 1M72A 4S1OA 3BCRA 1QPZA 1X8JA 3KBOA 1QSGA 3C7KA 4W9RA 3EK2A 2NU8A 3DE5X 2LBPA 3IURA 3WG9A 1EP9A 3TIXB 4NDZA 1PS9A 1U0NA 1ZRNA 5FWYA 3BSYA 1JAXA 1C0KA 1M2OA 1U8UA 3DO6A 4UJ5A 5DEIA 3WRYA 1O0BA 3EHDA 1R0WA 3EVFA 4K3VA 5DIFA 5KOIA 4RHFA 3RVLA 3NAZA 3H0KA 2FG6C 4HWGA 4O2LA 2E4VA 1FPQA 3KPVA 5F23A 3K9CA 3HRIA 4IYRA 3O4HA 2C5EA 2NO7A 4CF5A 5H4GA 4DV0B 1MAAA 1Q92A 3AR3A 2ADOA 3OZXA 3PC6A 4OXXA 1PDWA 3HNPA 4YEDA 1T5BA 2ONJA 1XZHA 2VCHA 4AX4A 1SG0A 1U7TA 3LU1A 5HZKA 1O77A 4Y9DA 2XMPA 1KWGA 3R7BA 1RCTE 3D2AA 3OO0A 4EY3A 2QR5A