3MU0A

Comparison of the character and the speed of x-ray-induced structural changes of porcine pancreatic elastase at two temperatures, 100 and 15k. the data set was collected from region a of the crystal. third step of radiation damage
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 66
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mu0A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mu0A01
2ZHEH 1QTFA 4A7IB 4X1QU 1QRWA 2Z94A 1KDQA 1GMCF 1HAIH 3O8CA 4XSKU 3MO3A 4PROA 2EI8A 2D2DA 1XKBC 4F49A 1QQ4A 4HZHA 1DANH 2GT7A 1ETTH 4Y6DA 3SUDA 2YNBA 4MG3A 4BTIB 2Y81A 3SOSA 3K9XB 1A5HA 3EA8A 1MKWK 1G3CA 2VWLA 5G4BA 1Z8JB 3K6YA 2Z6BD 3E0NB 5A2MH 3U69H 2BD2A 4JMYA 2BD4A 1P2OA 1RXPA 4HGCA 1BRCE 4GUXA 1ZYOA 1GHZA 1FV9A 1UK4A 1ZGVA 4B71A 4X2VA 2Y80A 2R0KA 5TJXA 4BANB 5J4QA 1PPFE 2VVUA 2FTMA 1PPGE 3S9AA 3RXGA 1D3QB 1NFXA 4FUIA 3MTYA 2CXVA 1ETRH 2GX4A 2FWWA 4CRDA 3HK6B 8LPRA 4UFGH 3TVJB 2GCHG 3BEIB 2G4UA 1GJAB 3Q00A 3ZZ3A 4AG2A 1O2TA 1L2EA 4A6LA 3STIA 4CR9A 2ZGJA 3BTDE 3ZZ5A 1HCGA 1EZSC 4R0IA 1UCYE 2QC2A 1HJ9A 3HPTB 1BMAA 3E91A 1GBIA 2GZ9A 1QJ6B 1P03A 1C5VA 1AUJA 1MUEB 1BTXA 3GY6A 4BAHB 3EAJA 4ISHH 2AMPA 2G55A 1NN6A 4Y0YE 3A87A 2ZZUH 2Q6DA 2IN2A 4IBLH 1SMFE 4NCYA 4ZHMU 2IJOB 2GCHF 1BITA 3A86A 3MYWA 2Q6FA 4DGJA 2VIDA 3C1KA 4I7YH 1FZZA 1D3PB 3ELAH 3SHCH 3SO3A 3GCNA 4XBBA 4X6PA 4UONA 2Q1JA 1IQGA 3ZV8A 1C4U2 3DA9B 4K1EA 1Y8TA 3UUZA 1GI4A 1AQ7A 2UUYA 2ALPA 5F8TA 2W3KA 4FUEA 5F8XA 4TY6A 5F03A 1MZDA 2O9QA 1JBUH 2Y7ZA 1O2XA 2F9PA 3PO1B 1TIOA 2ZGHA 4Q2KA 3ZVGA 1GHAF 2FTLE 1LMWB 4WMFA 1UCYK 1FMGA 4K3JA 3DD2H 1FPCH 3E16B 4F4OC 1SGNE 2PKSB 2GVFA 3SJOA 1Z8IB 1EJNA 3A7TA 3BTGE 2OCVB 5C1YA 1ELVA 2ZTYA 2C93B 1P2IA 3KF2A 1KY9A 1PPCE 4FU7A 3GY3A 2FOFA 1FPHH 1ELFA 3PTNA 1D4PB 2BX3A 3RC6A 3RXKA 4A5TS 1V2LT 1C1NA 1C5XB 3PMBB 4INKA 1T8NA 3VGCB 2WYJA 3BTQE 1SVPA 1C5RA 3ZZ4A 5A8YA 3DHKH 3RU4T 2VGCB 1EP5A 4NSVA 1W7XH 1QL9A 1EOJA 3RXBA 1TX6A 2NU3E 5AFYH 3SV9A 1OWHA 2OQ5A 3ATWA 3QLPH 1EQ9A 1ZHMA 1O3IA 4GHTA 1P01A 1BBRK 3TH2H 2ZCHP 4ZMAH 1TGTA 3QTVH 4BTTB 1F5KU 3MU4A 1QB9A 2ZNKH 1O2KA 1TNJA 3ZZDA 2QN5T 1UVTH 2BDCA 1CT0E 1XUFA 1QA7A 4AORA 3TNTA 2PLXA 4KTSA 1XX9A 3TPIZ 3V13A 4OS6A 2ZQ1A 1P10A 6GCHG 1GHXH 1AO5A 1GMHG 1C1WH 3ZVAA 1BTPA 4B75A 2FDAA 2JETB 3O8RA 3LDXH 4X2YA 1A0JA 1QJ1B 3H5CB 1O2SA 3E90B 1EZUC 1C1VH 3Q76A 3I77A 2JKHA 1ANCA 3HK3B 1UMAH 1SGPE 2ASUB 3SGAE 1OP2A 2A45B 4AG1A 2HNTC 5FX5A 1ACBE 1V2UT 2FXRA 2Y5HA 1CE5A 3ENSB 3URCA 1UVUH 4NZLA 1XUJA 5LGOA 1ZSLA 4TY7A 3LH3A 5C1UA 3PB1E 3QTOH 4X8VH 3MU0A 3PROA 1GI1A 4AFZA 2GKVE 3N7OA 3LH1A 8GCHG 2R2MB 1PJPA 1AZZA 2FLRH 1K1IA 3FP7E 5EGMA 6GCHF 5GXPA 1TMTH 8ESTE 2A2XH 2ZFPH 3UWIA 4ZKSU 4BAMB 1LVBA 1C1MA 5DP8A 1ZZZA 1QGFA 1ELDE 2ZTZA 3MH5A 4B73A 1OP8A 1RIWC 3GY5A 4A1XA 3KN2A 5DP5A 1SI5H 3DFLA 1YCPM 1IQMA 3BEFB 3T5FH 2XXLA 1GJ6A 2VWMA 1EB1H 2G4TA 1FN8A 2H5DA 1CHGA 3RMOH 4ISNA 1QIXB 2XNIA 1TBZH 2GD4B 2V3OH 1O2YA 2FI4E 3D23A 5EXLA 3UPEA 1V2PT 1O2NA 1LHDH 2FX4A 2GZ7A 1P9UA 1QRZA 1ANDA 2F83A 2QXGA 4B74A 1AB9B 3TJNA 3K6ZA 1GJ4H 1O3JA 1MBQA 4CREA 3IITA 2VIPA 3P8FA 3SU5A 1XXDA 1P3EA 3GY8A 4RN6A 2UWLA 3RXSA 2XC4A 2OP9A 1Y3XA 3A80A 1P8VC 1TGBA 1XM1A 3BTFE 1SHYA 1E37B 3UTUH 2BX4A 1NRRH 2A5IA 5GIBA 1YKTA 1QA0A 1AN1E 3Q3KA 1SSXA 5B6OA 1C2DA 2BLQA 3MU1A 3T27A 1U6QA 2J4IA 3A83A 4WMEA 1O2GH 5FCRA 1HAXB 3QZRA 2YOLA 2XCFA 3RXEA 5GWZA 3ODDA 1C2GA 2C4FH 4B2AA 4ABDA 1F2SE 5E0GA 2J95A 2SNWA 4AOQA 1XVMA 1BRBE 4A1TA 3HATH 3RXFA 4I8HA 2VNTA 4Y8XA 1VCQA 1F0RA 3RXDA 3R3GB 4X6NA 1E34B 3STJA 3SV6A 1BQYA 1SGFG 1V2RT 3DFJA 2Y5FA 4X8TH 1GBDA 5E2OA 4GAWA 3ZVEA 1AE5A 3RM2H 1PPZA 1TFXA 3SNCA 3TK6A 2FP7B 1IQJA 1BMNH 1JWTA 2FYRA 3SNEA 1UK2A 2OBQA 5DKMA 5H4IB 1ZHRA 1GBTA 2HWLB 4O97A 1UK3A 3M5LA 4Q7YA 3SN8A 2P3TB 3SQEE 3AVZA 1C1PA 4X8UH 7GCHG 1FY5A 1GBKA 1C5MD 2WPLS 1EZXC 3VXFH 4ZHLU 3MFJA 1DXWA 3LGVA 1PYTD 3GCOA 1FAXA 2ODPA 1SHHB 1TGNA 1C5QA 1EX3A 2J94A 2FPZA 3KCGH 3B8JA 1Q3XA 2OINA 1FIZA 4QT8C 1GVZA 3U9AH 1ESAA 3QK1A 3RC4A 3BIVH 3FVFB 3SU6A 2C8XB 1YGCH 1WYKA 4Y79A 1TQ0B 1FNIA 3P8NA 4B2BA 1TB6H 1GBLA 2J92A 2VH0A 3G01A 1G3BA 4IN1A 4DG4A 4RKJB 1Z1JA 7GCHF 5K7RA 1LVYA 2EC9H 2Y6TA 3TJVA 1SGCA 1HLTH 1OS8A 1FUJA 3U98H 1C2EA 1NS3A 2XWAA 4VGCB 1NTPA 2CF8H 3V12A 3RXMA 3RXQA 1P11E 5JPMH 1GI7B 1ELCA 1HYLA 3PO1C 3M5OA 1W13U 4DOQA 1FIWA 1YPEH 1C5ZB 1DFPA 4GSOA 2W26A 1V2NT 1UHBA 2AH4X 2BD5A 1BTZA 6CHAB 2R9PA 3BV9B 1HBTH 1SFIA 1SLWB 3GICB 4ISIH 4CH2B 1L1NA 1EAXA 4MNVA 1A5GH 1P2JA 5FX6A 2BOHB 1IQLA 2PKSC 2ZC9H 4TYDA 1GCDA 4KELA 3W94A 1G36A 3P17H 4SGBE 1HFDA 3SGQE 5C3NA 3MWIU 2TGPZ 3P6ZB 1A5IA 1L0ZA 4XOJA 1GJBB 2AERH 1Y5AT 4BXWA 1YCPH 1EXFA 2AGGX 2BD7A 2V35A 3LKWA 3O8DA 4I32A 2ZQ2A 2D8WA 3VGCC 2NU4E 3LGTA 2OBOA 2VGCC 3TGIE 1QFKH 3VB7A 1G32B 4H6SB 3PM3A 1QB6A 1LPKB 1UTKA 1N1LA 3F9GA 2B8OH 1GHWH 3K65B 3OU0A 5DP6A 3T25A 5HYOA 4DVAU 2VIVA 5HMAA 1FAKH 1SLXB 2GCTB 3BTEE 2ZDNA 1EUFA 1TPAE 1O3EA 1GL1A 1TE0A 2STAE 2ZTXA 1KSNA 1O39A 1Z1IA 1LHEH 1NZQH 2GDDA 1S85A 2C8ZB 1F92A 4DW2U 4GLYA 1GJ9B 2FOBA 2Z9IA 1G3DA 2Z7FE 1TWXB 2BLVA 3ZVBA 3UY9A 4KP0A 5FPTA 2F3CE 3OY5U 2JETC 1OWIA 1IQHA 1GWAA 1P2KA 1S6HA 1HUTH 1BOQA 1TNLA 1C2MA 1V2JT 1HIAB 5J4SA 1ZPBA 2J2UA 3D49H 4MLFB 1C9PA 1XMNB 1XUIA 1DY9A 1GJ7B 1THRH 1V3XA 2DUCA 4D7FA 4IMZA 1RD3B 2RA0A 1PPHE 3RMLH 2FOCA 1WV7H 2Y5GA 4CBNA 1TALA 1OYQA 2PTCE 2XBVA 4Z6AH 1YM0A 1C2FA 2ZDVH 4O9VA 2I6QA 3LGYA 5A8ZA 4I8GA 1NROH 3RXPA 1T7CA 3O8BA 3CP7A 1UTLM 3MNCA 2BLWA 1ZMLA 1IQEA 4NGAH 4ZKOU 4K60A 3S9BA 1NM6A 4ZXYH 1TA2A 3UQVA 3KL6A 3PLPA 2ZDKA 3GYMA 3E8LA 1DLKB 1C1TA 1VGCB 1DPOA 3KEEA 1O32A 3SGBE 3QGNB 4K1SA 1G30B 4WY3A 2R3UA 1WBGB 2ZGXH 4ABEA 2W7SA 1KXCA 1GJDB 1KXFA 2KAIB 2ZU1A 4AB9A 4XBCA 3A85A 2F9NA 1C9TA 1FN6A 1NFUA 2CMYA 2A5KA 3UWJH 1N8OB 5T6GA 1AB9C 1H9IE 4D9RA 1GJ8B 3OY6U 3GCHB 2VJ1A 1YPHE 3SU4A 1C4V2 2HLCA 5L30H 1Y3UA 3UQOA 4NG9H 4YESB 1ESBA 4TWYA 4JK6A 5C2ZA 1O5AB 3ZV9A 3RM0H 2JH6D 3SV2H 1O2UA 4LZ4B 3BTTE 1QR3E 1XUKA 1ELEE 1FXYA 1VITG 2PSXA 3R0FA 1O30A 1SGEE 1GL0E 4AZ2B 4XFQA 4INHA 4WF8A 4KGAA 1LCYA 4E7NA 1HPGA 4AFUA 3LC3A 1V2WT 2BTCE 2XC0A 4NIVA 1P2MA 4AYVB 2PGBB 2BM2A 4OS7A 3A8AA 2BXTH 1DWCH 3F68H 1UTJA 1V2MT 1GHAG 2FI5E 4BTUB 2HGTH 1HAVB 4X1SU 1TMBH 2GV7A 2GGVB 1ANEA 1K21H 3LONA 4HFPB 3T62A 1GI0A 1F5LA 2R3YA 1VITF 3FZZA 4D76A 1TMUH 1X7AC 1QQUA 2J38A 2C3SA 1RTLA 3TGKE 3VPKA 2CHAB 1YLDA 1MCTA 4A1VA 2QAAA 1QBOA 2FI3E 1A0HB 3B9FH 1FQ3A 1BRUP 1GCTB 3SUFA 3UR6A 3QO6A 1IQFA 3M7TA 1S0RA 3S7KB 1Z6EA 1EKBB 2OD3B 1P12E 2P3FH 1M9UA 1A1RA 1TPPA 2XCNA 3EYDA 1THPB 1EJAA 3RXLA 1FY1A 1AFQB 1O35A 4Y7AA 2BQ6B 3TU7H 1V2VT 4JZEH 5E2PA 4I8JA 1ANBA 3KQBA 2BLOA 1P57B 2A4QA 2FMJA 3E3TA 3MU5A 5FPYA 2BDBA 2LNCA 3VB6A 1AGJA 2A4RA 2XBXA 3NWUA 1L1GA 2WV4A 4CRGA 1Y59T 2ZCLP 3B23B 4YLUA 4GVUA 4LXBH 5JB9S 1V2TT 2ZHFH 5I46H 4IMQA 1B7XB 2F9OA 1W12U 4YO9A 2BHGA 1GG6C 4UFFH 3CENA 3P70B 5JB8S 3Q3XA 2GMTB 2FX6A 4CRAA 1HRTH 3KIDU 2XTTB 4ABJA 1MKXK 1SGYE 5T6FA 2BVSH 3QZQA 1OWKA 1CVWH 4OS5A 3GISB 3TK5A 2O8LA 3LJJA 3SHAH 2CGAA 1J9CH 4THNH 1A3BH 1Y3YA 5F8ZA 2QGRA 5CHAB 5JBTA 4H6TA 3QX5H 2AFQB 3BEUA 3Q3YA 1DY8A 1WAYB 1O3CA 3H7TA 4KTUA 1O5BB 4HTCH 4Z0KA 3MO9A 1BUIA 1AUTC 2FOHA 5DGJA 4U2WA 1WTHD 1K1LA 5A0AE 1S83A 1AKSB 4ABIA 1FY3A 2FOMB 5HXFA 2BQ7B 3RXCA 1ID5H 1PYTC 2FYQA 3U8TH 6CHAC 4KTCA 1ZJDA 1G9IE 1FY8E 1FI8A 4E7RG 2ZECA 1VCPA 4ABFA 1HV7A 3SU1A 1LHCH 3PMHB 1G37A 1GMDF 3PLBA 3M35A 3MNXA 2H9TH 2CV3A 3MHWU 4J2YB 1GI6A 2H2ZA 1INCA 4Q7XA 1OPHB 4Y7BA 2G5VA 3AAVA 1NRPH 3BN9A 3RU4E 1VJ9U 3M37A 5FPSA 5LH8A 3MH4A 1GI5A 2ODYB 2BDHA 3F9EA 2ANYA 1WTGH 4OS4A 2ZFRH 1WSSH 5FHTA 1B0EA 4NWKA 2AEIH 1ZR0A 2B5TB 2VVCA 2BY9X 1AMHA 1O3KA 2WUBA 4WVPE 1AHTH 2BD8A 4GCHF 1C2LA 4OGYA 1TLDA 2H1UA 1O2WA 1SGQE 1IAUA 4K69A 1J15A 1HAZB 3TLOA 2GCTC 3AW1A 2QXJA 2WPJS 1Z8RA 3FFGA 4X1PU 1UTNA 2ODQA 1HB0B 3V0XA 1W2KH 1CT4E 4YOIA 1TQ7B 1XUGA 1ZRKA 1P09A 2RG3A 1EASA 2GTBA 3A7YA 4D7GA 1NU7B 1P02A 2VIQA 4MVNA 3K2UA 3FAOA 4OS1A 2ZGCA 5T3HA 1GVKB 1D9IA 2QF3A 4E06H 2PKAB 4ASHA 2ZDLA 3I29A 3W95A 5K0HA 1AY6H 1EP6A 3MNBA 2F9VA 4X0WU 1MH0A 3T28A 1JRTA 1LVMA 1YPKH 3TJUA 5DP3A 2BY8X 5A8XA 1DXPA 3A7ZA 1C1QA 3I78A 3UR9A 1C5YB 2F91A 4YT6H 1YC0A 4GPGA 1F5RA 1MKWH 1Z6JH 2A4OA 4WMDA 7ESTE 2TRMA 1GHYH 4CRCA 1EAUA 1YPGH 3BTWE 1SLUB 4WH6A 5ESBA 5IDKA 1ESTA 1P2QA 1O5DH 5DO4H 3F9FA 1GDQA 3FP6E 1IHTH 5DG6A 1ZRBA 4J1YA 5AFZH 2ZFTA 1NY22 5GCHF 4DIHH 1DOJA 3RMNH 1C1UH 3SJIA 2PUXB 3QN7A 2SGPE 3AAUA 1TBRH 2OTVA 4CRFA 1ZMNA 2K1QA 2XBWA 1A7SA 1TBQH 2CN0H 2B0FA 5FBIA 3MMGA 1VGCC 2D1JA 2HVXA 4BAKB 1J17T 1QNJA 2ZPQA 1DUEA 1EOLA 5FXLA 1SR5C 1C2KA 3ZZ6A 1TABE 1TPSA 1SPJA 3BIUH 3SZNA 5CE1A 1DDJA 1TNGA 3PWBA 4FUFA 3ESTA 2BY6X 2BB4A 1N8OC 2Z9KA 2ZCKP 4FUCA 1WCZA 1JMOH 1QHRB 3SORA 4ZUHA 3SV8A 1DX5M 3GCHC 3ZVDA 1GVLA 3RC5A 1BTWA 1E0FD 4NIYA 3P92A 3LT3A 2TIOA 2B7DH 1S6FA 1C1SA 1RFNA 5HM9A 1GHBG 1J8AA 1O2MA 2BY5X 4ABAA 4NSYA 1ZMJA 1DITH 4K5ZA 2ZU5A 3KNXA 3RU4D 2ESTE 1O3NA 1C5UA 1ELAA 4CHAB 1C2HA 1QL8A 1K1MA 2PUQH 1HAHH 4DIIH 1EAWA 2BZ6H 1ZPZA 3Q77A 4FU8A 1EPTB 1IQKA 3A8BA 2G8TA 5EODA 2FM2A 1TOMH 1WQVH 1O5FH 2SFAA 4FXGH 2QXHA 1HAOH 1EAIA 1SQOA 2WPIS 1NRNH 3GDSA 4TPYA 4AYYB 1C2IA 1KXEA 3HGPA 1TRMA 1ELTA 4WJG2 1GHBF 1O3AA 1DVAH 4JZDH 1ZLRA 3TH4H 1NU9A 4CR5A 1Z71A 1AVXA 1XUHA 2P3UB 3RXHA 1UCYH 5ETXA 2UWPA 2CHAC 3WY8A 3ZZBA 4B2CA 2BDAA 2P16A 3GCTG 4NA8A 4JCNA 4E05H 1GCTC 2IOTA 4RSPA 1IHSH 3DUXH 4IW4E 5EU8A 2FOEA 2OC7A 1TAWA 1NRQH 5C5OA 4BNRA 1MD8A 2A7HA 3HKJB 2FIRH 1KLIH 1Q31A 1AFQC 1W14U 1Y5UT 1YF4A 2ZHDA 2I6SA 1GI9B 2GT8A 4JZFH 5A0BA 6ESTA 3MOCA 2OXSA 1GBBA 4KKDA 1BJUA 2QIQA 3UNRA 1SGDE 1H9HE 1FY4A 1DWBH 3LU9B 4LZ1H 5AHGH 5T6DA 3GCTF 1CSOE 4IC5A 1MD7A 1KYNA 2QA9E 4AGJA 2A7CA 2AMQA 4MQAA 2ZWLH 3ZZ7A 3URDA 1VJAU 2BZAA 2VU8E 2SGEE 3TK9A 1HIAA 1OP0A 2ALVA 1OWDA 2FODA 2GMTC 4K2YA 2AIQA 1MTNB 1BBRH 2AYWA 2O8WA 3KHVA 1ZSKA 2QY0B 5DPAA 3CS7A 1MTSA 4FUJA 1KTSB 2WV5A 4U01A 4I8LA 3VB3A 4H42U 3AW0A 2BD3A 2RA3A 1ELBA 3BG4B 5CHAC 4FVDA 2C8YB 2HPPH 1TX7A 3BF6H 2FS8A 3LPRA 2BQWB 2QYIA 4Y11E 4JYTA 4UEHH 3PMJA 2Z9JA 1PQ5A 2SGDE 2STBE 3NPSA 1W8BH 2RCEA 2ZEBA 2ZU3A 1RGQA 6LPRA 3HKIB 1LTOA 1BMLA 3GY2A 3P95A 1ABIH 3IG6B 3LJOA 4NA9H 1DSTA 1BJVA 2AGIX 3NUMA 1K9OE 2QV1A 3RP2A 1C5SA 4RKOB 1BRAA 1GPZA 1JXPA 4LK4A 2V6NA 2ZPRA 1GBJA 3SI3H 1OWEA 1G2LA 3ATIA 1OYTH 1O33A 4FUBA 4X8SH 2XBYA 1SQTA 2QF0A 2KAIA 4B1TA 2B9LA 1ZJKA 2OLGA 2WPMS 4AN7A 1A61H 2BXUH 2Z3EA 5C1XA 2ZKSA 3T29A 4BXSA 1H1BA 1C5PA 1SGFA 1BA8B 4NZQA 2BMGB 1O3OA 1F0TA 2PFEA 2TGDA 4K1TA 1MZAA 3OSYA 2PR3A 2WPHS 1DT2A 5SGAE 1LVOA 4WXVA 5DP7A 1C5TA 2PW8H 5TCCA 2G5NA 2G51A 4NFFA 1RRKA 1V2OT 2ZG0H 3A89A 4IC6A 2A31A 1VR1H 1N6XA 2ZPSA 4JZ1A 5GDSH 1SL3A 1C1OA 2P8OB 4MPWA 5EQSA 2ZFQH 3ZZAA 1ZOMA 2P59A 1AU8A 1FLEE 1NRSH 1P9SA 1N6YA 3VEQB 1K22H 3UNSA 3RXIA 1T32A 3ZZ8A 3SU3A 1ARBA 3A7WA 4NIXA 3TJOA 3M7UA 1YPHC 3RUOA 4ABBA 1ZHPA 1KXBA 4YOJA 4YLQH 1VCWA 2UWOA 1A2CH 4YM9A 1AI8H 1O3GA 2H5CA 1A46H 1HAVA 1CGHA 3E1XB 1FONA 4O03A 1B5GH 4Y8YA 2UUJB 1EB2A 1OKXA 1HNEE 1SC8U 5IYTA 3SV7A 3LOXA 3M3VA 1UTOA 1HAPH 3U8OH 3T2NA 3GYLB 1GDUA 5L2YH 1O2RA 1VZQH 1P06A 1PPBH 3GY4A 1SLVB 4R8TB 4MPUA 2XW9A 1A0LA 1BIOA 2O8MA 3RXAA 1W0YH 1C5NH 3A81A 1TRNA 5ABWA 1SFQB 3TIUA 5C20A 1IOEA 3MH6A 1RTKA 4MTBA 5BRRE 2VH6A 4YTAA 1AVWA 1SOTA 2AGEX 1Y5BT 3GDVA 2BOKA 1JOUB 1W11U 1NFWA 2VWNA 1NT1A 2A5AA 4MNWA 3FZDA 1RS0A 2W5EA 1O2QA 3A88A 1SGTA 1KDQB 2CF9H 4JYUH 4WXIA 2PHBA 1V2ST 3ZYDA 1CA0B 3EQ0H 4ISOA 3SQHE 1LKBA 4MPVA 2WYGA 2PGQB 3ZVFA 4X2WA 2QCYA 2ZIQH 5GJ4B 4UE7H 1K28D 5EW2H 3VB4A 3U8RH 1T8MA 2VWOA 1MTWA 2A4GA 5FAHA 1T8OA 4ZHAA 3MU8A 4NWLA 2BD9A 2O8UA 1KLTA 1FJSA 3SBKA 1MTVA 5TCAA 1CA8B 4ABGA 2WPKS 3NK8A 2ZFFH 1V2QT 2ILNA 1UTPA 2W7UA 3CS0A 1CBWB 1D6WA 3EDXB 1EJMA 1AWHB 4X6MA 2C8WB 1O3FA 3F6UH 5JBBS 3PYHA 3MI4A 2ZDAH 1KTTB 5EQRA 2G81E 1TONA 3SNBA 3UIRA 3JZ1B 4YZUA 1AKSA 2FZZA 3ODFA 1PFXC 2FOAA 4UDWH 1WQSA 9ESTA 1UVPA 1SOZA 3M7QA 1S81A 3SJ9A 1SBWA 1F7ZA 1W10U 3EGKH 1E38B 2GDEH 2OUAA 5AF9H 4IN2A 3UOPA 1H4WA 4CHAC 3SU2A 3U1JB 1UJ1A 3RLYH 2VVVA 1BBRE 1O5CB 2ZGBH 2GZ8A 3S0NA 4XBDA 1EPTC 1JIRA 4AFQA 5EW1H 1QJ7B 3RXRA 1D3DB 2ZF0H 1O2HA 2FEQH 1SQAA 3PWCA 5C5NA 5ESTE 4NFEA 1A3EH 1O2VA 1BTUA 1MTUA 2P93A 4AFSA 4BOHA 1K1OA 1P2NA 1TX8A 1DICA 2BYAX 1Q2WA 1S5SA 2BVRH 4MNYA 1WOFA 1EZQA 5HGGA 4DJZB 1DWDH 1YBWA 1GMDG 3ZYEA 1BB0B 3SI4H 1HDTH 3A82A 1Y3WA 5HM2A 3KQEA 2Q6GA 3PTBA 4VGCC 2YNAA 4Y76A 4FUDA 3PMAB 1S0QA 2H9HA 4OGXA 3PV4A 1J16A 3GY7A 1AIXH 1F0UA 5LPRA 3M5MA 3TGJE 2VIOA 1CT2E 4NIWA 1P04A 3KQCA 4X6OA 2SNVA 1YPMH 1SG8B 1NC6A 1ETSH 2Y7XA 1A4WH 2SGFE 3F1SB 7LPRA 1YCPK 3BSQA 4GCHG 4ZAEA 3NZIA 2PKAA 4DURA 4YT7H 2PTNA 3NXPA 1S84A 3SNDA 3UFAA 2WINI 2EA3A 5L6NH 1W3CA 1O5EH 1GGDB 3LC5A 5E0JA 4MDSA 3LGIA 3UREA 4FUGA 3U1IB 1XVOA 2OC1A 1ABJH 1ARCA 2TBSA 2XYAA 1MTNC 3NKKA 2R0LA 3D62A 1O3PB 2GP9B 2ZI2H 1T4VH 4CRBA 2M5TA 2D26C 5JDUB 1QRXA 4ZKNU 1MQ6A 4GHQA 3MNSA 5EPNA 2FOGA 2PSYA 3OYPA 3BG4C 2AMDA 3RLWH 4BAOB 1HJAB 1V6DA 3L33A 2A7JA 4X2XA 1BMMH 4HI3A 4XE4A 5EQQA 3C27B 1YLCA 1AD8H 1YPLH 4ESTE 2P94A 5PTPA 1ZTLA 2Z9LA 2EEKA 1AE8H 4FU9A 1O31A 2BY7X 2ZDMA 1NPMA 5DJ7A 1MU8B 2UUKB 1V2KT 3BTKE 1L4ZA 3QUMP 3LGWA 3BTHE 3LIWA 1ZGIA 3MH7A 2VB0A 1H8IH 2HOBA 4U30A 4ZKRU 4FVBA 1DE7H 2FLBH 1KXDA 3A8CA 4TPIZ 1DS2E 1NO9H 1RTFB 1CU1A 1QB1A 1QL7A 1GMHF 2P95A 3OX7U 4I8KA 1TGSZ 2QXIA 4OS2A 3SW2B 2PWXA 3AASA 3F9HA 5GCHG 1QY6A 3KQDA 1LHFH 3MO6A 1AWFH 4AGKA 3VB5A 2HNTE 4A92A 2ANMH 1D6RA 3LGUA 3RXOA 1LDTT 1LPZB 3M36A 1K2I1 1TYNA 2HPQH 2J9NA 3BG8A 3UNQA 1MU6B 1O2LA 1MCVA 2HNTF 2RDLA 1C5WB 1YP9A 3A8DA 4DCDA 1JIMA 1NFYA 1HAGE 4YOGA 3S69A 8GCHF 4X1RU 2TGTA 1BHXF 1PQ7A 2Z9GA 1C5OH 2TGAA 2HRVA 1LQEA 3QDZB 5FCKA 5A09A 2NU0E 1OSSA 1G2MA 4WWYA 3TH3H 2P8OC 2HALA 3V3MA 2CJIA 4D8NA 2ULLA 1OX1A 2ANKH 1AVGH 1GBMA 2JH5D 1ELGA 1BTHH 4LOYH 4SGAE 1L1JA 1OXGA 1CQQA 3M3TA 1ORFA 2ZHQH 3M61U 5LPEA 1AZ8A 1MAXA 1AFEH 4M7GA 1HXFH 1K1NA 1EPTA 4JZIA 4Q7ZA 2SGAA 3GDUA 1IQIA 1H9LB 5LPFA 1HGTH 3RDZA 1OWJA 1DWEH 1L4DA 1TGCA 2A32A 1LPGB 2ZHWH 4ZH8A 5F6MA 1J14A 1F0SA 1GI2A 1O2JA 2FO9A 4UFEH 5EXNA 4BAQB 2NU1E 4MNXA 3RXJA 4D9QA 3H7OA 1GI8B 4XDEA 3A84A 1UVOA 1D3TB 2DE8A 1YYY1 5JBCS 4Y71A 4ABHA 5JYIA 3A7XA 3D65E 3V7TA 3TNSA 1GI3A 1LHGH 1UTMA 1GHVH 1UVSH 1Z7KA 4H4FA 1O3LA 1SGRE 1TNKA 4Y10E 4B76A 4IGDA 1W0ZU 3SJKA 4UD9H 1P0SH 2IPHA 1CGJE 1FDPA 2NWNA 1O3HA 3ATLA 4AB8A 1XKAC 1GBFA 1T4UH 4O3TA 1WU1A 2ZFSA 3UOUA 4DT7B 1TNHA 1TA6A 2A1DB 1O2ZA 1DSUA 2TPIZ 5EG4A 3RXUA 2EI7A 2AIPA 1UTQA 1TOCB 1XXFA 3ZZ9A 2JH0D 3P8OA 1CA0C 4JYVH 2V0BA 4K8BA 3L6PA 1W7GH 2UUFB 2FS9A 5A0CA 1O5GH 1C2JA 1E35B 1QURH 3VXEH 4DY7B 2VINA 2F9UA 4ZXXH 2ZU4A 3EA9A 3S7HB 1O34A 1ZTJA 3RMMH 2A0QB 2G52A 3E0PB 3JZ2B 3M5NA 1QBVH 1H8DH 1T31A 2ZP0H 2XRCA 1HJ8A 3OTJE 1C5LH 1IQNA 1LQDB 2Y82A 4X1NU 3RXVA 1YPJH 1GG6B 4FUHA 1CBWC 3SJ8A 1GJCB 1MAYA 1B0FA 1ZPCA 1DM4B 4AX9H 3ITIA 5E0HA 1Y3VA 2F9BH 3QGJA 5EXMA 5E8EH 1OOKB 1VITH 3SUGA 1O0DH 2R2WU 3L3TA 3TITA 3GOVB 1LO6A 3ZVCA 2FESH 4I31A 1MKXH 1O3BA 2XC5A 4NA7A 1C1RA 1O37A 5I25A 1BCUH 2C90B 2H9EH 1O3MA 1GDNA 1KLJH 1SB1H 1MBMA 1CO7E 5EOKA 5AVDA 4CH8B 1KIGH 3SU0A 1K1JA 2SGQE 4WH8A 4IS5A 3NCLA 4TWWA 5C67A 1PPEE 1DLEA 3M3SA 1O36A 3FANA 3BTME 1SGIB 4K8YA 1TRYA 5FBEA 2NU2E 4INLA 4ISLA 1JRSA 3SNAA 2G00A 4O3UA 1THSH 3KGPA 1TPOA 2ANWA 4Y8ZA 1UO6A 3VFEA 1ZTKA 2XWBI 3ZZCA 3HGNA 5JBAS 1CHOG 1O38A 1DUAA 4Y0ZE 2DE9A 1PQ8A 1MMJN 1O3DA 2THFB 4ZROA 2WUCA 1GBCA 3ATMA 1ZSJA 1P3CA 1QCPA 5L2ZH 3IWMA 5CMXH 2PV9B 2OQUA 1BHXB 3QWCH 1NESE 1TNIA 4MPXA 1HAYB 1BZXE 2EI6A 2ZO3H 2LPRA 1T8LA 1RJXB 2Z3DA 3E6PH 2BDIA 3FP8E 4Q80A 4U32A 1EATA 1HXEH 1P05A 2Z3CA 2V3HH 2GV6A 3P8GA 9LPRA 1O2IA 1PQAA 1Z8GA 3SUEA 1GJ5H 2O8TA 2H6MA 1BTYA 1O2OA 2OC0A 3RXTA 1GBHA 5EPYA 4CBOA 1MQ5A 1RIWB 1CHOF 1KXAA 1UHBB 7KMEH 1BDAA 3PLKA 1E36B 1GGDC 1GBAA 1CGIE 1GMCG 3ATKA 3EA7A 5DP4A 2ZU2A 2J34A 3EE0B 1C4Y2 5BPEA 2VIWA 3A7VA 5GPIB 2AS9A 2ZA5A 1GBEA 4UFDH 5DK1A 2W3IA 1G3EA 1K1PA 1O2PA 1S82A 3DT0H 4JK5A 1LKAA 1BT7A 5DP9A 1HJAC 2BDGA 1WUNH 2BVXH 4I33A 2OC8A 1QBNA 3T26A 3S9CA 2BDYA 2A2QH 8KME2
chains in the Genus database with same CATH superfamily
2ZHEH 1QTFA 4A7IB 4X1QU 1QRWA 2Z94A 1KDQA 1GMCF 1HAIH 3O8CA 4XSKU 3MO3A 4PROA 2EI8A 2D2DA 1XKBC 4F49A 2KCYA 1QQ4A 4HZHA 1DANH 2GT7A 1ETTH 2JIZD 4Y6DA 3SUDA 2YNBA 4MG3A 4BTIB 2Y81A 5KGOA 3SOSA 3K9XB 1A5HA 3EA8A 1MKWK 1G3CA 2VWLA 5G4BA 1Z8JB 3K6YA 2Z6BD 3E0NB 5A2MH 3U69H 2BD2A 4JMYA 2BD4A 1P2OA 1RXPA 4HGCA 1BRCE 4GUXA 1ZYOA 1GHZA 1FV9A 1UK4A 2VBCA 1ZGVA 4B71A 4X2VA 2Y80A 2R0KA 5TJXA 4BANB 5J4QA 1PPFE 2VVUA 2FTMA 1PPGE 3S9AA 3RXGA 1D3QB 1NFXA 4FUIA 3MTYA 2CXVA 1ETRH 2GX4A 2FWWA 4CRDA 3HK6B 8LPRA 4UFGH 3TVJB 2GCHG 3BEIB 2G4UA 1GJAB 2KR7A 3Q00A 3ZZ3A 4AG2A 1O2TA 1L2EA 4A6LA 3STIA 4CR9A 2ZGJA 3BTDE 3ZZ5A 1HCGA 1EZSC 4R0IA 1UCYE 2QC2A 1HJ9A 3HPTB 1BMAA 3E91A 1GBIA 2GZ9A 1QJ6B 1P03A 1C5VA 1AUJA 1MUEB 1BTXA 3GY6A 4BAHB 3EAJA 4ISHH 2AMPA 2G55A 1NN6A 4Y0YE 3A87A 2ZZUH 2Q6DA 2IN2A 4IBLH 1SMFE 4NCYA 4ZHMU 2IJOB 2GCHF 1BITA 3A86A 3MYWA 2Q6FA 4DGJA 2VIDA 3C1KA 4I7YH 1FZZA 1D3PB 3ELAH 3SHCH 3SO3A 3CNRA 3GCNA 4XBBA 4X6PA 4UONA 2Q1JA 1IQGA 3ZV8A 3SZEA 1C4U2 3DA9B 4K1EA 1Y8TA 3UUZA 1GI4A 1AQ7A 2UUYA 2ALPA 5F8TA 2W3KA 4FUEA 5F8XA 4TY6A 5F03A 1MZDA 2O9QA 1JBUH 2Y7ZA 1O2XA 2F9PA 3PO1B 1TIOA 2ZGHA 4Q2KA 3ZVGA 1GHAF 2FTLE 1LMWB 4WMFA 1UCYK 1FMGA 4K3JA 3F3BA 5C0TA 3DD2H 1FPCH 3E16B 4F4OC 1SGNE 2PKSB 4RT0A 2GVFA 3SJOA 1Z8IB 1EJNA 3A7TA 3BTGE 2OCVB 5C1YA 1ELVA 2ZTYA 2C93B 1P2IA 3KF2A 1KY9A 1PPCE 4FU7A 3GY3A 2FOFA 1FPHH 1ELFA 3PTNA 1D4PB 2BX3A 3RC6A 3RXKA 4A5TS 1V2LT 1C1NA 1C5XB 3PMBB 4INKA 1T8NA 3VGCB 2WYJA 3BTQE 1SVPA 1C5RA 3ZZ4A 5A8YA 3DHKH 3RU4T 2VGCB 1EP5A 4NSVA 1W7XH 1QL9A 1EOJA 3RXBA 1TX6A 2NU3E 5AFYH 3SV9A 1OWHA 4Q4LA 2OQ5A 3ATWA 3QLPH 1EQ9A 1ZHMA 1O3IA 4GHTA 1P01A 1BBRK 3TH2H 2ZCHP 4ZMAH 1TGTA 3QTVH 4BTTB 1F5KU 3MU4A 1QB9A 2ZNKH 1O2KA 1TNJA 4ACAA 3ZZDA 2QN5T 1UVTH 2BDCA 1CT0E 1XUFA 1QA7A 4AORA 3TNTA 2PLXA 4KTSA 1XX9A 3TPIZ 3V13A 4OS6A 2ZQ1A 1P10A 6GCHG 1GHXH 1AO5A 1YWUA 1W0JD 1GMHG 1C1WH 3ZVAA 1BTPA 4B75A 2FDAA 2JETB 3O8RA 3LDXH 4X2YA 1A0JA 1QJ1B 3H5CB 3OAAD 1O2SA 3E90B 1EZUC 1C1VH 3Q76A 3I77A 5EJLA 2JKHA 1ANCA 3HK3B 1UMAH 1SGPE 2ASUB 3SGAE 1OP2A 2A45B 4AG1A 1H8ED 2HNTC 5FX5A 1ACBE 1V2UT 2FXRA 2Y5HA 1CE5A 3ENSB 3URCA 1UVUH 4NZLA 1XUJA 5LGOA 1ZSLA 4TY7A 3LH3A 5C1UA 3PB1E 3QTOH 4X8VH 3MU0A 3PROA 1GI1A 4AFZA 2GKVE 3N7OA 3LH1A 8GCHG 2R2MB 1PJPA 1AZZA 2FLRH 1K1IA 3FP7E 5EGMA 6GCHF 5GXPA 1TMTH 8ESTE 2A2XH 2ZFPH 3UWIA 4ZKSU 4BAMB 1LVBA 1C1MA 5DP8A 2GJGA 2KFWA 1ZZZA 1QGFA 1ELDE 2ZTZA 3MH5A 4B73A 1OP8A 3PV2A 1RIWC 3GY5A 4A1XA 3KN2A 5DP5A 1SI5H 3DFLA 1YCPM 1IQMA 3BEFB 3T5FH 2XXLA 1GJ6A 2VWMA 1EB1H 2G4TA 1FN8A 2H5DA 1CHGA 3RMOH 4ISNA 1QIXB 2XNIA 4M9FA 1TBZH 2GD4B 2V3OH 1O2YA 2FI4E 3D23A 5EXLA 3UPEA 1V2PT 1O2NA 1LHDH 2FX4A 2GZ7A 1P9UA 1QRZA 3F2FA 1ANDA 2F83A 2QXGA 4B74A 1AB9B 3TJNA 3K6ZA 1GJ4H 1O3JA 1MBQA 4CREA 3IITA 2VIPA 3P8FA 3SU5A 1XXDA 1P3EA 3GY8A 4OM9A 4Q63A 4RN6A 2UWLA 3RXSA 4DT4A 2XC4A 2OP9A 1Y3XA 3A80A 1P8VC 1TGBA 1XM1A 3BTFE 1SHYA 1E37B 3UTUH 2BX4A 1NRRH 2A5IA 5GIBA 1YKTA 1QA0A 1AN1E 4XD7D 3Q3KA 1SSXA 5B6OA 1C2DA 2BLQA 3MU1A 3T27A 1U6QA 2J4IA 3A83A 4WMEA 1O2GH 5FCRA 1HAXB 3QZRA 2YOLA 2XCFA 3RXEA 5GWZA 3ODDA 3FN8A 1C2GA 2C4FH 4B2AA 4ABDA 1F2SE 5E0GA 2J95A 2SNWA 2KZ4A 4AOQA 1XVMA 1BRBE 4A1TA 3HATH 3RXFA 4I8HA 2VNTA 2QF5A 4Y8XA 1VCQA 1F0RA 3RXDA 3R3GB 4X6NA 1E34B 3STJA 3SV6A 1BQYA 1SGFG 1V2RT 3DFJA 2Y5FA 4X8TH 1GBDA 5E2OA 4GAWA 3ZVEA 1AE5A 3RM2H 1PPZA 1TFXA 3SNCA 3TK6A 2FP7B 1IQJA 1BMNH 4ASUD 1JWTA 2FYRA 3SNEA 1UK2A 2OBQA 5CHBA 1E79D 5DKMA 3DCLA 5H4IB 1ZHRA 1GBTA 2WSSD 2HWLB 4O97A 1UK3A 3M5LA 1YLNA 4Q7YA 3SN8A 2P3TB 3SQEE 3AVZA 1C1PA 4X8UH 7GCHG 1FY5A 1GBKA 1C5MD 2WPLS 1EZXC 3VXFH 4ZHLU 3MFJA 1DXWA 3LGVA 1PYTD 3GCOA 1FAXA 2ODPA 1SHHB 1TGNA 1C5QA 1EX3A 2J94A 2FPZA 3KCGH 3B8JA 1Q3XA 2OINA 1FIZA 4QT8C 1GVZA 3U9AH 1ESAA 3QK1A 3RC4A 3BIVH 3FVFB 3SU6A 2C8XB 1YGCH 1WYKA 4Y79A 1TQ0B 1FNIA 3P8NA 4B2BA 1TB6H 1GBLA 2J92A 2VH0A 3G01A 1G3BA 4IN1A 4DG4A 4RKJB 1Z1JA 7GCHF 5K7RA 1LVYA 1OHHD 2EC9H 2Y6TA 3TJVA 1SGCA 1HLTH 1OS8A 1FUJA 3U98H 1C2EA 1NS3A 2XWAA 4VGCB 1NTPA 2CF8H 3V12A 3RXMA 3RXQA 1P11E 5JPMH 1GI7B 1ELCA 1HYLA 3PO1C 3M5OA 1W13U 4DOQA 1FIWA 1YPEH 1C5ZB 1DFPA 4GSOA 2W26A 4P00A 1V2NT 1UHBA 3U28C 2AH4X 2BD5A 1BTZA 6CHAB 2R9PA 3BV9B 1HBTH 1SFIA 1SLWB 3GICB 4ISIH 4CH2B 1L1NA 1EAXA 4MNVA 2LELA 1A5GH 1P2JA 5FX6A 2BOHB 1IQLA 2PKSC 2ZC9H 3OE7D 4TYDA 1GCDA 4KELA 3W94A 1G36A 3P17H 4SGBE 1E1QD 1HFDA 2W6ID 3SGQE 5C3NA 3MWIU 2TGPZ 3P6ZB 1A5IA 1L0ZA 4XOJA 1GJBB 2AERH 1Y5AT 4BXWA 1YCPH 1EXFA 2AGGX 2BD7A 2V35A 3LKWA 3O8DA 4I32A 2ZQ2A 2WHXA 2D8WA 3VGCC 2NU4E 3LGTA 2OBOA 2VGCC 3TGIE 2EQNA 1QFKH 3VB7A 1G32B 4H6SB 3PM3A 1QB6A 1LPKB 1UTKA 1N1LA 3F9GA 2B8OH 1GHWH 3K65B 3KYGA 3OU0A 5DP6A 3T25A 5HYOA 4DVAU 2VIVA 5HMAA 1FAKH 1SLXB 2GCTB 3BTEE 2ZDNA 1EUFA 1TPAE 1O3EA 1GL1A 1TE0A 2STAE 2YMSB 2ZTXA 1KSNA 1O39A 1Z1IA 1LHEH 1NZQH 2GDDA 1COWD 1S85A 2C8ZB 1F92A 4DW2U 4GLYA 1GJ9B 2FOBA 2Z9IA 1G3DA 2Z7FE 1TWXB 2J98B 2BLVA 3ZVBA 3UY9A 4KP0A 5FPTA 2F3CE 3OY5U 2JETC 1OWIA 1IQHA 1GWAA 1P2KA 1S6HA 1HUTH 1BOQA 2AHME 1TNLA 1C2MA 1V2JT 1HIAB 3N99A 5J4SA 1ZPBA 2J2UA 3D49H 4MLFB 1C9PA 1XMNB 1XUIA 1DY9A 1GJ7B 1THRH 1V3XA 2DUCA 4D7FA 4IMZA 1RD3B 2RA0A 1PPHE 3RMLH 2FOCA 1WV7H 2Y5GA 4CBNA 1TALA 4TSFD 1OYQA 2PTCE 2XBVA 4Z6AH 1YM0A 2HLDD 1C2FA 2ZDVH 4O9VA 2I6QA 3LGYA 5A8ZA 4I8GA 1NROH 3RXPA 1T7CA 3O8BA 3CP7A 1UTLM 3MNCA 2BLWA 1ZMLA 3UB0A 1IQEA 4NGAH 4ZKOU 2W6JD 4K60A 3S9BA 1NM6A 4ZXYH 1TA2A 3UQVA 4XRNA 3KL6A 3PLPA 2ZDKA 3GYMA 3E8LA 1DLKB 1C1TA 3H09A 1S6LA 1VGCB 1DPOA 3KEEA 1O32A 3SGBE 3QGNB 4K1SA 1G30B 4WY3A 2R3UA 1WBGB 2ZGXH 1FX0B 4ABEA 2W7SA 1KXCA 1GJDB 1KXFA 2KAIB 2ZU1A 4AB9A 4XBCA 3A85A 3AK5A 2F9NA 1C9TA 1FN6A 1NFUA 2CMYA 2WZQA 2A5KA 3UWJH 1N8OB 5T6GA 1AB9C 1H9IE 4D9RA 1GJ8B 3OY6U 3GCHB 2VJ1A 1YPHE 3SU4A 1C4V2 2HLCA 5L30H 1Y3UA 3UQOA 4NG9H 4YESB 1ESBA 4TWYA 4JK6A 5C2ZA 1O5AB 1WXRA 3ZV9A 3RM0H 2JH6D 3SV2H 1O2UA 4LZ4B 3BTTE 1QR3E 1XUKA 1ELEE 1FXYA 1VITG 2PSXA 3R0FA 1O30A 1SGEE 1GL0E 4AZ2B 4XFQA 4INHA 4WF8A 4KGAA 1LCYA 4E7NA 1HPGA 4AFUA 3LC3A 1V2WT 2BTCE 2XC0A 4NIVA 1P2MA 4AYVB 2PGBB 2BM2A 4OS7A 3A8AA 2BXTH 1DWCH 3F68H 1UTJA 1V2MT 1GHAG 2FI5E 4BTUB 2HGTH 1HAVB 4X1SU 1TMBH 2GV7A 1H8HD 2GGVB 1ANEA 1K21H 3LONA 4HFPB 3T62A 1GI0A 1F5LA 2R3YA 1VITF 3FZZA 4D76A 1TMUH 1X7AC 1QQUA 2J38A 2C3SA 1RTLA 3TGKE 3VPKA 2CHAB 1YLDA 1MCTA 4A1VA 2QAAA 1QBOA 2FI3E 1UW7A 1A0HB 3B9FH 1FQ3A 1BRUP 1GCTB 3SUFA 2V3MA 3UR6A 3QO6A 5C17A 1IQFA 3M7TA 1S0RA 3S7KB 1Z6EA 2L6OA 1EKBB 2OD3B 1P12E 2P3FH 1M9UA 1A1RA 1TPPA 2XCNA 3EYDA 1THPB 1EJAA 3RXLA 1FY1A 1AFQB 1O35A 4Y7AA 2BQ6B 3WWFA 3TU7H 1V2VT 4JZEH 5E2PA 4I8JA 1ANBA 3KQBA 2BLOA 1P57B 2A4QA 2FMJA 3E3TA 3MU5A 5FPYA 5F53A 2BDBA 2LNCA 3VB6A 1AGJA 2A4RA 2XBXA 3NWUA 1L1GA 2WV4A 4CRGA 1Y59T 2ZCLP 3B23B 4YLUA 4GVUA 4LXBH 5JB9S 1V2TT 2ZHFH 5I46H 4IMQA 1B7XB 2F9OA 1W12U 4YO9A 2BHGA 1GG6C 4UFFH 3CENA 3P70B 5JB8S 3Q3XA 2GMTB 2FX6A 4CRAA 1HRTH 3KIDU 2XTTB 4ABJA 1MKXK 1SGYE 5T6FA 2BVSH 3QZQA 1OWKA 1CVWH 4OS5A 3GISB 2KCAA 3TK5A 2O8LA 3LJJA 4FETA 3SHAH 2CGAA 1J9CH 4THNH 1A3BH 1Y3YA 5F8ZA 2QGRA 3OEHD 5CHAB 5JBTA 1YY3A 4H6TA 3QX5H 2AFQB 3BEUA 3Q3YA 5B6LA 1DY8A 1WAYB 1O3CA 3H7TA 4KTUA 1O5BB 2QF4A 4HTCH 4Z0KA 3MO9A 1BUIA 1AUTC 2FOHA 5DGJA 4U2WA 1WTHD 1K1LA 5A0AE 1S83A 1AKSB 4ABIA 1FY3A 2FOMB 5HXFA 2BQ7B 5EIYA 3RXCA 1ID5H 1PYTC 2FYQA 3U8TH 6CHAC 4KTCA 1ZJDA 1G9IE 4TT3D 1FY8E 1FI8A 4B6FA 4E7RG 2ZECA 1VCPA 4ABFA 1HV7A 3SU1A 1LHCH 3PMHB 1G37A 1GMDF 3PLBA 3M35A 3MNXA 2H9TH 2CV3A 3MHWU 4J2YB 1GI6A 2H2ZA 1INCA 4Q7XA 1OPHB 4Y7BA 2G5VA 3AAVA 1NRPH 3BN9A 3RU4E 1VJ9U 3M37A 5FPSA 5LH8A 3MH4A 4HG6A 1GI5A 2ODYB 2BDHA 2KCPA 3F9EA 2ANYA 1WTGH 4OS4A 2ZFRH 1BMFD 1WSSH 5FHTA 1B0EA 4NWKA 2AEIH 1ZR0A 2B5TB 4RI0A 2VVCA 2BY9X 1AMHA 1O3KA 2WUBA 4WVPE 1AHTH 2BD8A 4GCHF 1C2LA 4OGYA 1TLDA 2H1UA 1O2WA 1SGQE 1IAUA 4K69A 1J15A 1HAZB 3TLOA 3PRBA 2GCTC 3AW1A 2QXJA 2WPJS 2XOKD 1Z8RA 3FFGA 4X1PU 1UTNA 2ODQA 1HB0B 2YMSC 3V0XA 1W2KH 1CT4E 4YOIA 1TQ7B 1XUGA 1ZRKA 1P09A 2RG3A 1EASA 2GTBA 3A7YA 4D7GA 1NU7B 1P02A 2VIQA 4MVNA 3K2UA 3FAOA 4OS1A 2ZGCA 5T3HA 1GVKB 1D9IA 2QF3A 4E06H 2PKAB 4ASHA 2ZDLA 3I29A 3W95A 5K0HA 1AY6H 1EP6A 3MNBA 2F9VA 4X0WU 1MH0A 3T28A 1JRTA 1LVMA 1YPKH 3TJUA 5DP3A 2BY8X 5A8XA 1DXPA 3A7ZA 1C1QA 3I78A 3UR9A 1C5YB 2F91A 4YT6H 1YC0A 4GPGA 1F5RA 1MKWH 1Z6JH 2A4OA 4WMDA 4I86A 7ESTE 2TRMA 1GHYH 4CRCA 1EAUA 1YPGH 3BTWE 1SLUB 3F2HA 4WH6A 5ESBA 1ESTA 5FL7D 5IDKA 1P2QA 1O5DH 5DO4H 3F9FA 1GDQA 3FP6E 1IHTH 5DG6A 1ZRBA 4J1YA 5AFZH 2ZFTA 1NY22 5GCHF 4DIHH 1DOJA 3RMNH 1C1UH 3SJIA 2RDEA 2PUXB 3QN7A 2SGPE 3AAUA 1TBRH 2OTVA 4CRFA 1ZMNA 2F4LA 2K1QA 2XBWA 1A7SA 1TBQH 2CN0H 2B0FA 5FBIA 3MMGA 1VGCC 2D1JA 2HVXA 4BAKB 1J17T 1QNJA 2ZPQA 1DUEA 1EOLA 5FXLA 1SR5C 1C2KA 3ZZ6A 3OTPA 1TABE 1TPSA 1SPJA 3BIUH 3SZNA 5CE1A 1DDJA 1TNGA 3PWBA 4FUFA 3ESTA 2BY6X 2BB4A 1N8OC 2Z9KA 2ZCKP 4FUCA 1WCZA 1JMOH 1QHRB 3SORA 4ZUHA 3SV8A 1DX5M 3GCHC 3ZVDA 1GVLA 3RC5A 1BTWA 1E0FD 3KYFA 4NIYA 1NBME 3P92A 3LT3A 2TIOA 2B7DH 1S6FA 3PV5A 1C1SA 1RFNA 5HM9A 1GHBG 1J8AA 1O2MA 2BY5X 4ABAA 4NSYA 1ZMJA 1DITH 4K5ZA 2ZU5A 3KNXA 3RU4D 2ESTE 1O3NA 1C5UA 1ELAA 4CHAB 1C2HA 1QL8A 2WV9A 3F0PA 1K1MA 2PUQH 1HAHH 4DIIH 1EAWA 2BZ6H 1ZPZA 3Q77A 4FU8A 1EPTB 1IQKA 3A8BA 2G8TA 5EODA 2FM2A 1TOMH 1WQVH 1O5FH 2SFAA 4FXGH 2QXHA 1HAOH 1EAIA 1SQOA 2WPIS 1NRNH 3GDSA 4TPYA 4AYYB 1C2IA 1KXEA 3HGPA 5HIYA 1TRMA 1ELTA 4WJG2 1GHBF 1EFRD 1O3AA 1DVAH 4JZDH 1ZLRA 3TH4H 1NU9A 4CR5A 1Z71A 1AVXA 1XUHA 2P3UB 3RXHA 3DSPA 3SYJA 1UCYH 5ETXA 2UWPA 2CHAC 3WY8A 3ZZBA 4B2CA 2KM0A 2BDAA 2P16A 3GCTG 4NA8A 4JCNA 4E05H 1GCTC 2IOTA 4F48B 4RSPA 1IHSH 3DUXH 4IW4E 5EU8A 2FOEA 2OC7A 1TAWA 1NRQH 5C5OA 4BNRA 1MD8A 2A7HA 3HKJB 2FIRH 1KLIH 1Q31A 1AFQC 1W14U 1Y5UT 1YF4A 2ZHDA 2I6SA 1GI9B 2GT8A 4JZFH 5A0BA 6ESTA 3MOCA 2OXSA 1GBBA 2HVYB 4KKDA 1BJUA 2QIQA 3UNRA 1SGDE 1H9HE 2J98A 2KX4A 1FY4A 1DWBH 3LU9B 4LZ1H 5AHGH 5T6DA 3GCTF 1CSOE 4IC5A 1MD7A 1KYNA 2QA9E 4AGJA 2A7CA 2AMQA 4MQAA 2ZWLH 3ZZ7A 3URDA 1VJAU 2BZAA 2VU8E 2JJ2D 2SGEE 3TK9A 1HIAA 1OP0A 2ALVA 1OWDA 2FODA 2GMTC 4K2YA 2AIQA 1MTNB 1BBRH 2AYWA 2O8WA 3KHVA 1ZSKA 2QY0B 5DPAA 3CS7A 1MTSA 4FUJA 1KTSB 2WV5A 4U01A 4I8LA 3VB3A 4H42U 3AW0A 2BD3A 2RA3A 1ELBA 3BG4B 5CHAC 4FVDA 2C8YB 2HPPH 1TX7A 3BF6H 2FS8A 3LPRA 2BQWB 2QYIA 4Y11E 4JYTA 4UEHH 3PMJA 2Z9JA 1PQ5A 3WW7A 2SGDE 2STBE 3NPSA 1W8BH 2RCEA 2ZEBA 2ZU3A 1RGQA 6LPRA 3HKIB 1LTOA 1BMLA 3GY2A 3P95A 1ABIH 3IG6B 3LJOA 4NA9H 2RFKC 1DSTA 1BJVA 2AGIX 3NUMA 1K9OE 2QV1A 4YXWD 3RP2A 1C5SA 4RKOB 1BRAA 1GPZA 1JXPA 1NBMD 2V6NA 4LK4A 2ZPRA 1GBJA 3SI3H 1OWEA 1G2LA 3ATIA 1OYTH 1O33A 4FUBA 4X8SH 2XBYA 1SQTA 2QF0A 2KAIA 4B1TA 4F55A 2B9LA 1ZJKA 2OLGA 2WPMS 4AN7A 5IK2D 1A61H 2BXUH 2Z3EA 5C1XA 2ZKSA 3T29A 4BXSA 1H1BA 1C5PA 1SGFA 1BA8B 4NZQA 2BMGB 1O3OA 1F0TA 2PFEA 2TGDA 4K1TA 1MZAA 3OSYA 2PR3A 2WPHS 1DT2A 5SGAE 1LVOA 4WXVA 5DP7A 1C5TA 2PW8H 5TCCA 2G5NA 2G51A 4NFFA 1RRKA 1V2OT 2ZG0H 3A89A 4IC6A 2A31A 1VR1H 1N6XA 2ZPSA 4JZ1A 5GDSH 1SL3A 1C1OA 2P8OB 4MPWA 5EQSA 2ZFQH 3ZZAA 1ZOMA 1AU8A 1FLEE 1NRSH 2P59A 1P9SA 1N6YA 3VEQB 1K22H 3UNSA 3RXIA 1T32A 3ZZ8A 3SU3A 1ARBA 3A7WA 4NIXA 3TJOA 3M7UA 1YPHC 3RUOA 4ABBA 1ZHPA 1KXBA 4YOJA 2QE7D 4YLQH 1VCWA 2UWOA 3WWBA 1A2CH 4YM9A 3VG8A 1AI8H 1O3GA 2H5CA 1A46H 1HAVA 1CGHA 3E1XB 1FONA 4O03A 1B5GH 4Y8YA 2UUJB 1EB2A 1OKXA 1HNEE 1SC8U 5IYTA 3SV7A 3LOXA 3M3VA 1UTOA 1HAPH 3U8OH 3T2NA 3GYLB 1GDUA 5L2YH 1O2RA 1VZQH 1P06A 1PPBH 3GY4A 1SLVB 4R8TB 4MPUA 2XW9A 1A0LA 1BIOA 2O8MA 3RXAA 1W0YH 1C5NH 3MQKC 3A81A 1TRNA 5ABWA 1SFQB 3TIUA 5C20A 1IOEA 3MH6A 1RTKA 4MTBA 5BRRE 2VH6A 4YTAA 1AVWA 1SOTA 2AGEX 1Y5BT 3GDVA 2BOKA 1JOUB 1W11U 1NFWA 2VWNA 1NT1A 2A5AA 4MNWA 3FZDA 1RS0A 1SQRA 2W5EA 1O2QA 3A88A 1SGTA 1KDQB 2CF9H 4JYUH 4WXIA 2PHBA 1V2ST 3ZYDA 1CA0B 3EQ0H 1KMHB 4ISOA 3SQHE 1LKBA 4MPVA 2WYGA 2PGQB 3ZVFA 4X2WA 2QCYA 2ZIQH 5GJ4B 2K8IA 4UE7H 1K28D 5EW2H 3VB4A 3U8RH 1T8MA 2VWOA 1MTWA 2A4GA 5FAHA 1T8OA 4ZHAA 3MU8A 5KECA 4NWLA 2BD9A 2O8UA 1KLTA 1FJSA 3SBKA 1MTVA 5TCAA 1CA8B 4ABGA 2WPKS 3NK8A 2ZFFH 1V2QT 2ILNA 1UTPA 2W7UA 3CS0A 1CBWB 1D6WA 3EDXB 1EJMA 1AWHB 4X6MA 2C8WB 1O3FA 3F6UH 5JBBS 3PYHA 5GNDA 3MI4A 2ZDAH 1KTTB 5EQRA 2G81E 1TONA 3SNBA 3UIRA 3JZ1B 4YZUA 1AKSA 2FZZA 3ODFA 1PFXC 2FOAA 4UDWH 1WQSA 9ESTA 1UVPA 1SOZA 3M7QA 5T1VA 1S81A 3SJ9A 1SBWA 1F7ZA 1W10U 3EGKH 1E38B 2GDEH 2OUAA 5AF9H 4IN2A 3UOPA 1H4WA 4CHAC 3SU2A 3U1JB 1UJ1A 5DN6D 3RLYH 2VVVA 1BBRE 1O5CB 2ZGBH 2GZ8A 1MABB 3S0NA 4XBDA 1EPTC 1JIRA 4AFQA 5EW1H 1QJ7B 3RXRA 1D3DB 2ZF0H 1O2HA 2FEQH 1SQAA 3PWCA 5C5NA 3FOAA 5ESTE 4NFEA 1A3EH 1O2VA 1BTUA 1MTUA 2P93A 4AFSA 4BOHA 1K1OA 1P2NA 1TX8A 1DICA 2BYAX 1Q2WA 1S5SA 2BVRH 4MNYA 1WOFA 1EZQA 3EE7A 5HGGA 4DJZB 1DWDH 5KEDA 1YBWA 2PP6A 1GMDG 3ZYEA 1BB0B 3SI4H 1HDTH 3A82A 5CDFE 1Y3WA 5HM2A 3KQEA 2Q6GA 3PTBA 4VGCC 2YNAA 4Y76A 4FUDA 3PMAB 1S0QA 2H9HA 4OGXA 3PV4A 1J16A 3GY7A 1AIXH 1F0UA 5LPRA 3M5MA 5EJZA 3TGJE 2VIOA 1CT2E 4NIWA 1P04A 3KQCA 3NRLA 2SNVA 4X6OA 1YPMH 1SG8B 1NC6A 1ETSH 2Y7XA 1A4WH 2SGFE 3F1SB 7LPRA 3PRDA 1YCPK 3BSQA 4GCHG 4ZAEA 3NZIA 2PKAA 4DURA 4YT7H 2PTNA 3NXPA 1S84A 3OFND 3SNDA 3UFAA 3N7EA 2WINI 2EA3A 3W1EA 3GS9A 1W3CA 1O5EH 1GGDB 2J97A 3LC5A 5E0JA 4MDSA 3LGIA 3UREA 4FUGA 3U1IB 1XVOA 2OC1A 1ABJH 1ARCA 2TBSA 2XYAA 1MTNC 3NKKA 2R0LA 5C94A 3D62A 1O3PB 2GP9B 2ZI2H 1T4VH 4CRBA 2M5TA 2D26C 5JDUB 1QRXA 4ZKNU 1MQ6A 4AC9A 4GHQA 3MNSA 5EPNA 5DSFA 2FOGA 2PSYA 3OYPA 5C0UA 3BG4C 2AMDA 3RLWH 4BAOB 1HJAB 1V6DA 3L33A 2A7JA 4P02A 4X2XA 1BMMH 4HI3A 4XE4A 5EQQA 3C27B 1YLCA 2IJD1 5EJ1A 1AD8H 1YPLH 4ESTE 2P94A 5PTPA 1ZTLA 2Z9LA 2EEKA 1AE8H 4FU9A 1O31A 2BY7X 2ZDMA 1NPMA 5L6NH 5DJ7A 1MU8B 2UUKB 1V2KT 3BTKE 1L4ZA 3QUMP 2JDID 3LGWA 3BTHE 3LIWA 1ZGIA 3MH7A 2VB0A 1H8IH 2HOBA 4U30A 4ZKRU 4FVBA 1DE7H 2FLBH 1KXDA 3A8CA 4TPIZ 1DS2E 1NO9H 1RTFB 1CU1A 1QB1A 1QL7A 1GMHF 2P95A 3OX7U 4I8KA 1TGSZ 2QXIA 4OS2A 3SW2B 2PWXA 3AASA 3F9HA 5GCHG 2IPQX 1QY6A 2K0QA 3KQDA 2WPDD 1LHFH 3DSGA 3MO6A 1AWFH 4AGKA 2V7QD 3VB5A 2HNTE 4A92A 2ANMH 1D6RA 3LGUA 3RXOA 1LDTT 1LPZB 3M36A 1K2I1 1TYNA 2HPQH 2J9NA 3BG8A 3OEED 3UNQA 1MU6B 1O2LA 1MCVA 2HNTF 2RDLA 1C5WB 1YP9A 3A8DA 4DCDA 1JIMA 1NFYA 1HAGE 4YOGA 3S69A 8GCHF 4X1RU 2TGTA 1BHXF 1PQ7A 2Z9GA 1C5OH 2TGAA 2HRVA 1LQEA 3QDZB 5FCKA 5A09A 4FOUC 2NU0E 1OSSA 1G2MA 4WWYA 2LP6A 3TH3H 2P8OC 2HALA 3V3MA 2CJIA 4D8NA 2ULLA 1OX1A 1WDIA 2ANKH 1AVGH 1GBMA 2JH5D 1ELGA 1BTHH 4LOYH 4SGAE 3DSOA 1L1JA 1OXGA 1CQQA 3M3TA 1ORFA 2ZHQH 3M61U 5LPEA 1AZ8A 1MAXA 1AFEH 4M7GA 1HXFH 1K1NA 1EPTA 3F0OA 4JZIA 2SGAA 3GDUA 4Q7ZA 1IQIA 1H9LB 5LPFA 1HGTH 3RDZA 1OWJA 1DWEH 1L4DA 1TGCA 3FKSD 2A32A 1LPGB 2ZHWH 4ZH8A 5F6MA 1J14A 1F0SA 1GI2A 1O2JA 2FO9A 4UFEH 5EXNA 4BAQB 2NU1E 4MNXA 3RXJA 3KQ5A 4D9QA 3H7OA 5HIZA 1GI8B 4XDEA 3A84A 1UVOA 1D3TB 2DE8A 1YYY1 5JBCS 4Y71A 4ABHA 5JYIA 3A7XA 3D65E 3V7TA 3TNSA 1GI3A 1LHGH 1UTMA 1GHVH 1UVSH 2EY4C 1Z7KA 4H4FA 1O3LA 1SGRE 1TNKA 4Y10E 4B76A 4IGDA 4B6EA 1W0ZU 3SJKA 4UD9H 1P0SH 2IPHA 1CGJE 1FDPA 2NWNA 1O3HA 3ATLA 4AB8A 1XKAC 1GBFA 1T4UH 4O3TA 1WU1A 2ZFSA 3UOUA 4DT7B 1TNHA 1TA6A 2A1DB 1O2ZA 1DSUA 2TPIZ 5EG4A 3RXUA 2EI7A 2AIPA 1UTQA 1TOCB 1XXFA 3ZZ9A 2JH0D 3P8OA 2CK3D 1QZ8A 1CA0C 4JYVH 1K0HA 2V0BA 4K8BA 3L6PA 1W7GH 2UUFB 2FS9A 5A0CA 4Z1MD 2XNDD 1O5GH 1C2JA 1E35B 1QURH 3VXEH 4DY7B 2VINA 2F9UA 4ZXXH 2ZU4A 2J5UA 3EA9A 3S7HB 1O34A 1ZTJA 3RMMH 2KCOA 2A0QB 2G52A 3E0PB 2M2AA 3JZ2B 3M5NA 1QBVH 1H8DH 1T31A 2ZP0H 2XRCA 1HJ8A 3OTJE 1C5LH 1IQNA 1LQDB 2Y82A 4X1NU 3RXVA 1YPJH 1GG6B 4FUHA 1CBWC 3SJ8A 1GJCB 1MAYA 2L74A 1B0FA 1ZPCA 3ZIAD 1DM4B 4AX9H 1SKYE 3ITIA 5E0HA 1Y3VA 2F9BH 3UAIC 3QGJA 5EXMA 5E8EH 1OOKB 1VITH 3SUGA 1O0DH 2R2WU 3L3TA 3TITA 4RT1A 3GOVB 1LO6A 3ZVCA 2FESH 4I31A 1MKXH 1O3BA 2XC5A 4NA7A 1C1RA 1O37A 5I25A 1BCUH 2C90B 2H9EH 1O3MA 1GDNA 1KLJH 1SB1H 1MBMA 1CO7E 5EOKA 5AVDA 4CH8B 1KIGH 3SU0A 1K1JA 2SGQE 4WH8A 4IS5A 3NCLA 4TWWA 5C67A 1PPEE 1E1RD 1DLEA 2YMSD 3M3SA 1O36A 1W0KD 3BTME 3FANA 1SGIB 4K8YA 1TRYA 5FBEA 2NU2E 4INLA 4ISLA 1JRSA 3SNAA 2G00A 4O3UA 1THSH 3KGPA 1TPOA 2ANWA 4Y8ZA 1UO6A 1VKYA 3VFEA 1ZTKA 2XWBI 3ZZCA 3HGNA 5JBAS 1CHOG 1O38A 1DUAA 4Y0ZE 2DE9A 1PQ8A 1MMJN 1O3DA 2THFB 2OK5A 4ZROA 2WUCA 1GBCA 3ATMA 1ZSJA 1P3CA 1QCPA 5L2ZH 3IWMA 5CMXH 2PV9B 2OQUA 1BHXB 3QWCH 1NESE 1TNIA 4MPXA 1HAYB 1BZXE 2EI6A 2ZO3H 2LPRA 1T8LA 2JJ1D 1RJXB 2Z3DA 3E6PH 2BDIA 3FP8E 4Q80A 4U32A 1EATA 1HXEH 1P05A 4ACBA 2Z3CA 2V3HH 2GV6A 3P8GA 9LPRA 1O2IA 1PQAA 1Z8GA 3SUEA 1GJ5H 2O8TA 2H6MA 1BTYA 1O2OA 2OC0A 3RXTA 1GBHA 5EPYA 4CBOA 1MQ5A 1RIWB 1CHOF 1KXAA 3FO8D 3N7DA 1UHBB 7KMEH 1BDAA 3PLKA 1E36B 1GGDC 1GBAA 1CGIE 1GMCG 2F43B 3ATKA 3EA7A 5DP4A 2ZU2A 2J34A 3EE0B 1C4Y2 5BPEA 2VIWA 3A7VA 5GPIB 2AS9A 2ZA5A 3F2GA 1GBEA 4UFDH 5DK1A 2W3IA 1G3EA 5HKKD 1K1PA 1O2PA 1S82A 3DT0H 4JK5A 1LKAA 1BT7A 5DP9A 1HJAC 2BDGA 1WUNH 2BVXH 4I33A 2OC8A 1QBNA 3T26A 3S9CA 2BDYA 2A2QH 4ZCNA 8KME2
chains in the Genus database with same CATH topology
2ZHEH 1QTFA 4A7IB 4X1QU 1QRWA 2Z94A 1KDQA 1GMCF 1HAIH 3O8CA 4XSKU 3MO3A 4PROA 2EI8A 2D2DA 1XKBC 4F49A 1QQ4A 4HZHA 1DANH 2GT7A 1ETTH 4Y6DA 3SUDA 2YNBA 4MG3A 4BTIB 2Y81A 3SOSA 3K9XB 1A5HA 3EA8A 1MKWK 1G3CA 2VWLA 5G4BA 1Z8JB 3K6YA 2Z6BD 3E0NB 5A2MH 3U69H 2BD2A 4JMYA 2BD4A 1P2OA 1RXPA 4HGCA 1BRCE 4GUXA 1ZYOA 1GHZA 1FV9A 1UK4A 1ZGVA 4B71A 4X2VA 2Y80A 2R0KA 5TJXA 4BANB 5J4QA 1PPFE 2VVUA 2FTMA 1PPGE 3S9AA 3RXGA 1D3QB 1NFXA 4FUIA 3MTYA 2CXVA 1ETRH 2GX4A 2FWWA 4CRDA 3HK6B 8LPRA 4UFGH 3TVJB 2GCHG 3BEIB 2G4UA 1GJAB 3Q00A 3ZZ3A 4AG2A 1O2TA 1L2EA 4A6LA 3STIA 4CR9A 2ZGJA 3BTDE 3ZZ5A 1HCGA 1EZSC 4R0IA 1UCYE 2QC2A 1HJ9A 3HPTB 1BMAA 3E91A 1GBIA 2GZ9A 1QJ6B 1P03A 1C5VA 1AUJA 1MUEB 1BTXA 3GY6A 4BAHB 3EAJA 4ISHH 2AMPA 2G55A 1NN6A 4Y0YE 3A87A 2ZZUH 2Q6DA 2IN2A 4IBLH 1SMFE 4NCYA 4ZHMU 2IJOB 2GCHF 1BITA 3A86A 3MYWA 2Q6FA 4DGJA 2VIDA 3C1KA 4I7YH 1FZZA 1D3PB 3ELAH 3SHCH 3SO3A 3GCNA 4XBBA 4X6PA 4UONA 2Q1JA 1IQGA 3ZV8A 1C4U2 3DA9B 4K1EA 1Y8TA 3UUZA 1GI4A 1AQ7A 2UUYA 2ALPA 5F8TA 2W3KA 4FUEA 5F8XA 4TY6A 5F03A 1MZDA 2O9QA 1JBUH 2Y7ZA 1O2XA 2F9PA 3PO1B 1TIOA 2ZGHA 4Q2KA 3ZVGA 1GHAF 2FTLE 1LMWB 4WMFA 1UCYK 1FMGA 4K3JA 3DD2H 1FPCH 3E16B 4F4OC 1SGNE 2PKSB 2GVFA 3SJOA 1Z8IB 1EJNA 3A7TA 3BTGE 2OCVB 5C1YA 1ELVA 2ZTYA 2C93B 1P2IA 3KF2A 1KY9A 1PPCE 4FU7A 3GY3A 2FOFA 1FPHH 1ELFA 3PTNA 1D4PB 2BX3A 3RC6A 3RXKA 4A5TS 1V2LT 1C1NA 1C5XB 3PMBB 4INKA 1T8NA 3VGCB 2WYJA 3BTQE 1SVPA 1C5RA 3ZZ4A 5A8YA 3DHKH 3RU4T 2VGCB 1EP5A 4NSVA 1W7XH 1QL9A 1EOJA 3RXBA 1TX6A 2NU3E 5AFYH 3SV9A 1OWHA 2OQ5A 3ATWA 3QLPH 1EQ9A 1ZHMA 1O3IA 4GHTA 1P01A 1BBRK 3TH2H 2ZCHP 4ZMAH 1TGTA 3QTVH 4BTTB 1F5KU 3MU4A 1QB9A 2ZNKH 1O2KA 1TNJA 3ZZDA 2QN5T 1UVTH 2BDCA 1CT0E 1XUFA 1QA7A 4AORA 3TNTA 2PLXA 4KTSA 1XX9A 3TPIZ 3V13A 4OS6A 2ZQ1A 1P10A 6GCHG 1GHXH 1AO5A 1GMHG 1C1WH 3ZVAA 1BTPA 4B75A 2FDAA 2JETB 3O8RA 3LDXH 4X2YA 1A0JA 1QJ1B 3H5CB 1O2SA 3E90B 1EZUC 1C1VH 3Q76A 3I77A 2JKHA 1ANCA 3HK3B 1UMAH 1SGPE 2ASUB 3SGAE 1OP2A 2A45B 4AG1A 2HNTC 5FX5A 1ACBE 1V2UT 2FXRA 2Y5HA 1CE5A 3ENSB 3URCA 1UVUH 4NZLA 1XUJA 5LGOA 1ZSLA 4TY7A 3LH3A 5C1UA 3PB1E 3QTOH 4X8VH 3MU0A 3PROA 1GI1A 4AFZA 2GKVE 3N7OA 3LH1A 8GCHG 2R2MB 1PJPA 1AZZA 2FLRH 1K1IA 3FP7E 5EGMA 6GCHF 5GXPA 1TMTH 8ESTE 2A2XH 2ZFPH 3UWIA 4ZKSU 4BAMB 1LVBA 1C1MA 5DP8A 1ZZZA 1QGFA 1ELDE 2ZTZA 3MH5A 4B73A 1OP8A 1RIWC 3GY5A 4A1XA 3KN2A 5DP5A 1SI5H 3DFLA 1YCPM 1IQMA 3BEFB 3T5FH 2XXLA 1GJ6A 2VWMA 1EB1H 2G4TA 1FN8A 2H5DA 1CHGA 3RMOH 4ISNA 1QIXB 2XNIA 1TBZH 2GD4B 2V3OH 1O2YA 2FI4E 3D23A 5EXLA 3UPEA 1V2PT 1O2NA 1LHDH 2FX4A 2GZ7A 1P9UA 1QRZA 1ANDA 2F83A 2QXGA 4B74A 1AB9B 3TJNA 3K6ZA 1GJ4H 1O3JA 1MBQA 4CREA 3IITA 2VIPA 3P8FA 3SU5A 1XXDA 1P3EA 3GY8A 4RN6A 2UWLA 3RXSA 2XC4A 2OP9A 1Y3XA 3A80A 1P8VC 1TGBA 1XM1A 3BTFE 1SHYA 1E37B 3UTUH 2BX4A 1NRRH 2A5IA 5GIBA 1YKTA 1QA0A 1AN1E 3Q3KA 1SSXA 5B6OA 1C2DA 2BLQA 3MU1A 3T27A 1U6QA 2J4IA 3A83A 4WMEA 1O2GH 5FCRA 1HAXB 3QZRA 2YOLA 2XCFA 3RXEA 5GWZA 3ODDA 1C2GA 2C4FH 4B2AA 4ABDA 1F2SE 5E0GA 2J95A 2SNWA 4AOQA 1XVMA 1BRBE 4A1TA 3HATH 3RXFA 4I8HA 2VNTA 4Y8XA 1VCQA 1F0RA 3RXDA 3R3GB 4X6NA 1E34B 3STJA 3SV6A 1BQYA 1SGFG 1V2RT 3DFJA 2Y5FA 4X8TH 1GBDA 5E2OA 4GAWA 3ZVEA 1AE5A 3RM2H 1PPZA 1TFXA 3SNCA 3TK6A 2FP7B 1IQJA 1BMNH 1JWTA 2FYRA 3SNEA 1UK2A 2OBQA 5DKMA 5H4IB 1ZHRA 1GBTA 2HWLB 4O97A 1UK3A 3M5LA 4Q7YA 3SN8A 2P3TB 3SQEE 3AVZA 1C1PA 4X8UH 7GCHG 1FY5A 1GBKA 1C5MD 2WPLS 1EZXC 3VXFH 4ZHLU 3MFJA 1DXWA 3LGVA 1PYTD 3GCOA 1FAXA 2ODPA 1SHHB 1TGNA 1C5QA 1EX3A 2J94A 2FPZA 3KCGH 3B8JA 1Q3XA 2OINA 1FIZA 4QT8C 1GVZA 3U9AH 1ESAA 3QK1A 3RC4A 3BIVH 3FVFB 3SU6A 2C8XB 1YGCH 1WYKA 4Y79A 1TQ0B 1FNIA 3P8NA 4B2BA 1TB6H 1GBLA 2J92A 2VH0A 3G01A 1G3BA 4IN1A 4DG4A 4RKJB 1Z1JA 7GCHF 5K7RA 1LVYA 2EC9H 2Y6TA 3TJVA 1SGCA 1HLTH 1OS8A 1FUJA 3U98H 1C2EA 1NS3A 2XWAA 4VGCB 1NTPA 2CF8H 3V12A 3RXMA 3RXQA 1P11E 5JPMH 1GI7B 1ELCA 1HYLA 3PO1C 3M5OA 1W13U 4DOQA 1FIWA 1YPEH 1C5ZB 1DFPA 4GSOA 2W26A 1V2NT 1UHBA 2AH4X 2BD5A 1BTZA 6CHAB 2R9PA 3BV9B 1HBTH 1SFIA 1SLWB 3GICB 4ISIH 4CH2B 1L1NA 1EAXA 4MNVA 1A5GH 1P2JA 5FX6A 2BOHB 1IQLA 2PKSC 2ZC9H 4TYDA 1GCDA 4KELA 3W94A 1G36A 3P17H 4SGBE 1HFDA 3SGQE 5C3NA 3MWIU 2TGPZ 3P6ZB 1A5IA 1L0ZA 4XOJA 1GJBB 2AERH 1Y5AT 4BXWA 1YCPH 1EXFA 2AGGX 2BD7A 2V35A 3LKWA 3O8DA 4I32A 2ZQ2A 2D8WA 3VGCC 2NU4E 3LGTA 2OBOA 2VGCC 3TGIE 1QFKH 3VB7A 1G32B 4H6SB 3PM3A 1QB6A 1LPKB 1UTKA 1N1LA 3F9GA 2B8OH 1GHWH 3K65B 3OU0A 5DP6A 3T25A 5HYOA 4DVAU 2VIVA 5HMAA 1FAKH 1SLXB 2GCTB 3BTEE 2ZDNA 1EUFA 1TPAE 1O3EA 1GL1A 1TE0A 2STAE 2ZTXA 1KSNA 1O39A 1Z1IA 1LHEH 1NZQH 2GDDA 1S85A 2C8ZB 1F92A 4DW2U 4GLYA 1GJ9B 2FOBA 2Z9IA 1G3DA 2Z7FE 1TWXB 2BLVA 3ZVBA 3UY9A 4KP0A 5FPTA 2F3CE 3OY5U 2JETC 1OWIA 1IQHA 1GWAA 1P2KA 1S6HA 1HUTH 1BOQA 1TNLA 1C2MA 1V2JT 1HIAB 5J4SA 1ZPBA 2J2UA 3D49H 4MLFB 1C9PA 1XMNB 1XUIA 1DY9A 1GJ7B 1THRH 1V3XA 2DUCA 4D7FA 4IMZA 1RD3B 2RA0A 1PPHE 3RMLH 2FOCA 1WV7H 2Y5GA 4CBNA 1TALA 1OYQA 2PTCE 2XBVA 4Z6AH 1YM0A 1C2FA 2ZDVH 4O9VA 2I6QA 3LGYA 5A8ZA 4I8GA 1NROH 3RXPA 1T7CA 3O8BA 3CP7A 1UTLM 3MNCA 2BLWA 1ZMLA 1IQEA 4NGAH 4ZKOU 4K60A 3S9BA 1NM6A 4ZXYH 1TA2A 3UQVA 3KL6A 3PLPA 2ZDKA 3GYMA 3E8LA 1DLKB 1C1TA 1VGCB 1DPOA 3KEEA 1O32A 3SGBE 3QGNB 4K1SA 1G30B 4WY3A 2R3UA 1WBGB 2ZGXH 4ABEA 2W7SA 1KXCA 1GJDB 1KXFA 2KAIB 2ZU1A 4AB9A 4XBCA 3A85A 2F9NA 1C9TA 1FN6A 1NFUA 2CMYA 2A5KA 3UWJH 1N8OB 5T6GA 1AB9C 1H9IE 4D9RA 1GJ8B 3OY6U 3GCHB 2VJ1A 1YPHE 3SU4A 1C4V2 2HLCA 5L30H 1Y3UA 3UQOA 4NG9H 4YESB 1ESBA 4TWYA 4JK6A 5C2ZA 1O5AB 3ZV9A 3RM0H 2JH6D 3SV2H 1O2UA 4LZ4B 3BTTE 1QR3E 1XUKA 1ELEE 1FXYA 1VITG 2PSXA 3R0FA 1O30A 1SGEE 1GL0E 4AZ2B 4XFQA 4INHA 4WF8A 4KGAA 1LCYA 4E7NA 1HPGA 4AFUA 3LC3A 1V2WT 2BTCE 2XC0A 4NIVA 1P2MA 4AYVB 2PGBB 2BM2A 4OS7A 3A8AA 2BXTH 1DWCH 3F68H 1UTJA 1V2MT 1GHAG 2FI5E 4BTUB 2HGTH 1HAVB 4X1SU 1TMBH 2GV7A 2GGVB 1ANEA 1K21H 3LONA 4HFPB 3T62A 1GI0A 1F5LA 2R3YA 1VITF 3FZZA 4D76A 1TMUH 1X7AC 1QQUA 2J38A 2C3SA 1RTLA 3TGKE 3VPKA 2CHAB 1YLDA 1MCTA 4A1VA 2QAAA 1QBOA 2FI3E 1A0HB 3B9FH 1FQ3A 1BRUP 1GCTB 3SUFA 3UR6A 3QO6A 1IQFA 3M7TA 1S0RA 3S7KB 1Z6EA 1EKBB 2OD3B 1P12E 2P3FH 1M9UA 1A1RA 1TPPA 2XCNA 3EYDA 1THPB 1EJAA 3RXLA 1FY1A 1AFQB 1O35A 4Y7AA 2BQ6B 3TU7H 1V2VT 4JZEH 5E2PA 4I8JA 1ANBA 3KQBA 2BLOA 1P57B 2A4QA 2FMJA 3E3TA 3MU5A 5FPYA 2BDBA 2LNCA 3VB6A 1AGJA 2A4RA 2XBXA 3NWUA 1L1GA 2WV4A 4CRGA 1Y59T 2ZCLP 3B23B 4YLUA 4GVUA 4LXBH 5JB9S 1V2TT 2ZHFH 5I46H 4IMQA 1B7XB 2F9OA 1W12U 4YO9A 2BHGA 1GG6C 4UFFH 3CENA 3P70B 5JB8S 3Q3XA 2GMTB 2FX6A 4CRAA 1HRTH 3KIDU 2XTTB 4ABJA 1MKXK 1SGYE 5T6FA 2BVSH 3QZQA 1OWKA 1CVWH 4OS5A 3GISB 3TK5A 2O8LA 3LJJA 3SHAH 2CGAA 1J9CH 4THNH 1A3BH 1Y3YA 5F8ZA 2QGRA 5CHAB 5JBTA 4H6TA 3QX5H 2AFQB 3BEUA 3Q3YA 1DY8A 1WAYB 1O3CA 3H7TA 4KTUA 1O5BB 4HTCH 4Z0KA 3MO9A 1BUIA 1AUTC 2FOHA 5DGJA 4U2WA 1WTHD 1K1LA 5A0AE 1S83A 1AKSB 4ABIA 1FY3A 2FOMB 5HXFA 2BQ7B 3RXCA 1ID5H 1PYTC 2FYQA 3U8TH 6CHAC 4KTCA 1ZJDA 1G9IE 1FY8E 1FI8A 4E7RG 2ZECA 1VCPA 4ABFA 1HV7A 3SU1A 1LHCH 3PMHB 1G37A 1GMDF 3PLBA 3M35A 3MNXA 2H9TH 2CV3A 3MHWU 4J2YB 1GI6A 2H2ZA 1INCA 4Q7XA 1OPHB 4Y7BA 2G5VA 3AAVA 1NRPH 3BN9A 3RU4E 1VJ9U 3M37A 5FPSA 5LH8A 3MH4A 1GI5A 2ODYB 2BDHA 3F9EA 2ANYA 1WTGH 4OS4A 2ZFRH 1WSSH 5FHTA 1B0EA 4NWKA 2AEIH 1ZR0A 2B5TB 2VVCA 2BY9X 1AMHA 1O3KA 2WUBA 4WVPE 1AHTH 2BD8A 4GCHF 1C2LA 4OGYA 1TLDA 2H1UA 1O2WA 1SGQE 1IAUA 4K69A 1J15A 1HAZB 3TLOA 2GCTC 3AW1A 2QXJA 2WPJS 1Z8RA 3FFGA 4X1PU 1UTNA 2ODQA 1HB0B 3V0XA 1W2KH 1CT4E 4YOIA 1TQ7B 1XUGA 1ZRKA 1P09A 2RG3A 1EASA 2GTBA 3A7YA 4D7GA 1NU7B 1P02A 2VIQA 4MVNA 3K2UA 3FAOA 4OS1A 2ZGCA 5T3HA 1GVKB 1D9IA 2QF3A 4E06H 2PKAB 4ASHA 2ZDLA 3I29A 3W95A 5K0HA 1AY6H 1EP6A 3MNBA 2F9VA 4X0WU 1MH0A 3T28A 1JRTA 1LVMA 1YPKH 3TJUA 5DP3A 2BY8X 5A8XA 1DXPA 3A7ZA 1C1QA 3I78A 3UR9A 1C5YB 2F91A 4YT6H 1YC0A 4GPGA 1F5RA 1MKWH 1Z6JH 2A4OA 4WMDA 7ESTE 2TRMA 1GHYH 4CRCA 1EAUA 1YPGH 3BTWE 1SLUB 4WH6A 5ESBA 5IDKA 1ESTA 1P2QA 1O5DH 5DO4H 3F9FA 1GDQA 3FP6E 1IHTH 5DG6A 1ZRBA 4J1YA 5AFZH 2ZFTA 1NY22 5GCHF 4DIHH 1DOJA 3RMNH 1C1UH 3SJIA 2PUXB