3MUJA

Early b-cell factor 3 (ebf3) ipt/tig and dimerization helices
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
133
structure length
133
Chain Sequence
ATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALYGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Transcription factor COE3
publication title Structural Determination of Functional Domains in Early B-cell Factor (EBF) Family of Transcription Factors Reveals Similarities to Rel DNA-binding Proteins and a Novel Dimerization Motif.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01833 TIG IPT/TIG domain
A PF16423 COE1_HLH Transcription factor COE1 helix-loop-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mujA01
4.10.280.10 Few Secondary Structures Irregular MYOD Basic-Helix-Loop-Helix Domain, subunit B Helix-loop-helix DNA-binding domain 3mujA02
4UT6L 2ERJC 4MSWB 4RMUA 2GY7B 4M7LT 3RX8A 4NRXA 3C08H 1ZLUK 2DQFA 3TM6A 4Z8FH 3TH3T 1IQDA 3FB7B 3ARBD 4G7YL 3MBEA 5HHOD 4ETQB 1I3RA 4LPVA 5DJ0A 1I7TA 1NCWH 1OT2A 3MOAL 5BZDB 3QDJD 2YPKB 4IHOB 4ODWB 4X8JA 2J8HA 5D96B 5HY9A 2HJLB 2B5IB 2R2CA 2ZP0T 1HK6A 1S7RB 1KACB 4UU9B 5K59E 1GZPB 4HKXB 1XZ0A 2ZOKA 1JGLH 4LKCA 3LQAC 3HMXL 3MUY1 4IRSB 5F9DC 1TVHB 1UADC 3P40A 2VLJA 2F9BT 1A6UH 1EHLL 4EUPH 3HRZA 3NVQA 2F19H 3UTQA 3PV6A 3HI5L 3MRMA 4I4WB 1EXUB 3MR9B 3UZEA 1WEJH 3MA7B 2UZIH 4OBRA 1L4IA 1HILB 1NL0L 3BD4A 3LRSA 1I7UA 1MIML 4ZOAA 4P5TD 5JIHA 4MXVF 2QL1A 4LAQL 2MQ3A 3T0EA 3HMWL 4F37F 5E00B 3REVA 4B41A 5JW3L 2SEBA 3TJHC 4YDIH 3SE8H 1U3HA 3BQUB 1H5BA 5TDPB 2IEPA 2BNUB 1J0YA 2H8PB 5EA0L 5T5NG 1A1MA 3O6ML 2PKDA 1G6RA 4BQCA 2BHZA 4Z7WB 1ZLVK 4QRTB 3PWLA 5D1ZA 4JKPL 4XP9H 3TIEA 2XZAH 5HTSA 4HDIA 2HN7A 1I1AC 4O51A 3S37L 3VGGA 4EDXA 3MLUL 1DQJB 4TSAH 5F1OB 5C6TL 5FYKD 1ACZA 2NXZC 1JNHA 1MELA 5C70A 2VLRA 4OAWA 2GTZA 5GSVB 1N4XL 1EEUA 1XF3B 4PGDA 3N1PC 4UNTA 5FO7B 5JDSA 3WLBA 4HK3J 3TJEL 3VXRD 4YDKH 1DQQA 3WLWD 4OZIF 1HCVA 1KCUL 1JF1A 4PV9A 3VXMB 3FB8B 5A1AA 2WQ8A 4D0CB 4HAFA 5IBTL 3MV7B 5CLTA 1H3PL 2AXHA 3ARGC 3P0VH 3W81A 3HC0B 3QXDB 4F58H 2X4PB 1UT9A 1SQ2N 4G3YL 3MLXL 4K3HA 3VG0L 3L3HB 1N2RB 1VACA 2HKHH 4XPTL 5ESQB 1H3XA 1AXTH 4GRMB 4JZJB 5AZ2H 1OAQL 1U8LA 2ARJA 5EBGA 2DQCL 1BX2B 4YEFA 5L9DH 4HBQA 1AKJA 4X9HA 3P4OB 2VLJE 5E94B 4JZNA 3QZWB 2LVEA 3RY4A 5I1IL 3RTQD 5C0DA 2CKBL 2ADFH 5C0FB 4EKXA 1RV6X 2BC4B 4N0YH 1KLFA 3MGAA 4HS8H 2UWEA 4PJ9A 1UACL 2BNQD 3LHPH 4PREB 4JQXC 3ARFA 2YR3A 4XAKE 1UYWH 1S3KL 3KPTA 1Q94B 2ZUTA 3UYRH 4XCCH 1WFUA 5FYLH 4JZOA 3T0EE 4PRIB 5DJXB 2YXFA 4LDOB 4OIIH 4FQHB 4XVJL 3SJVD 1T1ZB 1KXTB 5JOFA 2I9TA 1BOGB 4F9LA 1MWAA 1XFPA 2CDEA 2X4TA 1KB9J 1L9NA 3W0WD 1AE6L 4ALAL 3DRTB 4WEBL 4X5LA 1OVZA 2Z8WC 1UJTA 1M4KA 3L6FB 1YN6A 5DHXB 3HZVA 1A7OH 1H0DA 1AM9A 4Y1AD 1FV1B 4X7SH 5CUSH 1TETL 1GGIH 4BUGA 1JZ4A 3P73B 4ZAKB 1CS6A 5CEXA 4GOSA 2VLRE 1VCAA 5LGHH 3CFKA 1NLWA 5IP4A 4Z5RA 5HJ3A 3AAZB 4KTYA 4JN1H 5D7KD 1VENA 4ZO6A 1BJMA 1HE7A 4H0GA 3BIKA 1MNUL 1U8HA 3PDGA 4Y2DC 4P9HC 4R7NB 1LD9A 2DQGL 1U6AL 4OZFB 5TGBB 3HC3L 1H8NA 4WW1A 1ZHBB 1LK3H 1TENA 2ORBL 3ARSA 4CN4A 1MJ8L 2YWZA 4TVPE 1UKTA 4MB5A 4PRHB 4YHMH 5HGDB 1XCQB 5L2KA 4PS4H 5DFTA 1ZLSL 2A1WH 1QFUL 3FB7A 3HE7B 4I1NB 1CVRA 4D8PB 1XGUB 4FQPA 2H2PC 1AJ7L 4KKLD 4WU7B 5IGXH 1VEOA 3CMGA 4KTDL 1XGQB 4KDVA 5BZDA 4PG2C 2YPKA 4IHOA 4CNIB 3UTSA 3TCLB 3RFZC 2HJLA 5DMKB 2VL4A 1WT5C 1S7RA 1MHCA 2BVEA 4UU9A 3THML 2RJMA 1GZPA 4HKXA 5E7FA 2X10A 1KF9B 43C9A 5DFVD 1KOAA 4LLUB 4G5ZL 4OFIA 4KJPD 1XR9A 3V0WL 1TVHA 3VJ6A 1P4LB 3IDIA 2FJHA 1ZS8B 5F6IC 4NZRL 4I4WA 3MR9A 4LLMB 5IJKA 2BSED 3MRGB 3OAZK 3MA7A 2PTTB 3TYGL 3X3GH 2XOTA 1S7VB 4TRPL 3QPXH 3VW3H 1M05B 3P9LA 4Q9BA 4AIZB 4NO2B 1FFNB 2R23B 4Y16D 5KOVC 3H3BC 3NZHL 2ZCHH 5E00A 4NQVB 1CE6B 4FQ2L 3Q6GL 4EOWH 5IW6B 3BQUA 5E8DH 5GGVH 4LVNC 2BNUA 2H8PA 3VGEA 1JRHI 4Z7WA 3CIQA 4QRTA 1FZOB 3W11C 1NGWB 5ACLA 1DFBL 1NC4B 1X5HA 3WN5B 3IDUA 4TPRL 4MNQA 1DN2A 1AQKL 1DQJA 4KQ4H 1AN2A 1CBVH 3NPSB 3VRIB 4LGPB 3SDCB 5C92A 2X40A 1IEBB 5GSVA 4Z7VF 4LSSL 3JSSA 1M71B 1XF3A 1AR1D 3WUWB 1JNNH 1UWGH 5IHUH 3IVKA 4MQTB 1JFQH 3QIWB 3DVFA 2FB4H 1XGRB 1WICA 1DDHA 3PP3K 4OQTA 3NN8B 5L2KE 2D4DA 3TFKC 1EGJA 5J6HB 2AV7B 3FB8A 4D0CA 1N7ML 3PHOB 3QPQD 1MFNA 1HXYB 3MV7A 3R8QA 4L4VD 4U6YA 2BVQB 4PLKD 5DI8B 1HQ4A 5KN5B 2P5EB 4H25B 3LPWA 3HC0A 4FHBD 3QXDA 5KANI 2AXFB 3UTSE 2X4PA 3NCJL 3MJ9A 1NCCL 3BN9D 3PDOB 3NABL 1N2RA 4OCLC 4CVZB 5ESQA 4S1QL 4LCIH 4N8CL 1HKLH 4JZJA 3HAEH 4TULL 5JHDA 2YK1L 4G8GB 5CINL 2DJ4A 1BX2A 4J3WA 3WSQH 3P4OA 3D85D 4P23B 1BQHG 2R9HD 2C1OB 5E94A 1DTUA 3JV4B 3QZWA 2ICEA 1KCRL 1I8LA 3C8HA 3KPNB 4L4TB 5LJYH 3PL6C 2GSGA 4Q7DA 1XGTA 5F3BA 4FTVB 5GS0H 5HI4C 2G75B 1G6RL 2BC4A 3FRUA 1AO7B 4AYAA 4Y19B 4YZFF 5I1GH 4GXUN 3BGAA 4CJ0A 3P77B 3Q5OA 1SJXA 1CFNA 1JGDB 4WUKL 1Q94A 4EQ2A 5E8PB 2VDRL 3QP3A 1A6WH 1EO8H 4PRIA 1KTDB 5DJXA 4FQHA 1T1ZA 3EZJB 1QBMH 1BOGA 2GY5A 3U7YH 3MGOB 1G7IB 3GHEH 1HH9B 1LMKA 3DRTA 4HH9B 5KVFH 4XVTH 2MPAL 3L6FA 1KEGL 2VB5A 1KLUA 1GOGA 5FKAB 2FEEI 1J86A 5EIIA 1AQDB 1FV1A 3O6KL 4XBEH 4F7CB 3RVXC 3HE6D 3DV6A 3NACL 3V5KB 1NCNA 3P73A 4MNQE 3NA9L 4ZAKA 3VWKC 2AXGB 2CIKB 2GTWB 1R0AL 5DJCB 3HNSL 1KYOK 4YE4L 1QA9B 1T66C 1MCDA 4CGTA 1WISA 1SBSL 2J3SA 1UB5B 3ZDZE 5CJOL 5JW5B 4PY7B 4Y0GA 4GRWH 3EO1B 3AAZA 1QFWL 4LSQH 4ZSOA 1T2QH 1J8HB 1WFOA 5AD0B 4TSCH 1FNEA 5JR1L 5HDBE 4MYWB 5DUMH 1VFBA 4MA1C 3BVNB 3FZUD 3D39E 1I85A 5K9QG 5ADOH 3GSWA 4BFGA 1RK0A 3SDAC 4OZFA 5TGBA 2XWBB 5B4MC 3MV7E 3ULSB 5ETUB 1ZHBA 2DB8A 4ZTOH 4ZMAT 1U8MA 12E8L 1YA5A 2IFGA 1AXIB 5IG7B 5HGDA 3LEVL 4JM4H 3X13B 3ULVD 1GGBH 3QUYC 2LV4A 3EYSH 4JO2H 5C07E 1DBBL 2O5YL 5FOJA 3BDXA 5JHDE 2AS5M 4KVNH 3HE7A 4M93C 3LSOB 2I5YH 4WU7A 4JY4B 2JCCA 4P99A 4CNIA 4K7PL 1OW0C 4OLVH 1FO0L 3BH8A 1Q0XL 2NY4B 4LQ1A 3MXWH 2E9WA 1UZ8A 1KG0B 5BCAA 5CJBA 3JWDL 4LLUA 2HT2C 4M5YH 1OTSD 4WTZA 1LP9A 1WVZA 1S8DB 1A7NH 1G6VK 4LLMA 2CO7B 3V4UL 2HFEB 1N5AB 4P2OB 3MRGA 5D2NC 4L29B 2PTTA 3LKSB 5HI3D 4TUJB 1S7VA 3L5WB 3GK8H 3TPKA 3RL1B 4AIZA 4NO2A 5J3HD 1FFNA 4OGZA 5D2LF 4G6KL 3MV01 3NCYS 3EYOB 4P2QD 4PJ8B 3W39B 1MVUA 4FQIL 3V79C 4C54A 2D9CA 3TWCH 5DS8B 4NQVA 4K55A 3ULUC 4Q9RL 3MRDA 1BD2E 3GI8L 5FHBL 5GJSL 5IW6A 5JA9A 2Y6SC 5TFSH 3KYAA 3PG2A 4ZSOE 4FFWD 1CICB 1GL4B 1IC5H 9CGTA 1F8TL 1NC4A 4RFOH 2WBWB 1C5BH 3H7LA 1U42A 4XPFL 3U30B 3VRIA 2FNBA 1IEBA 4ONOA 2EC9T 2DWEB 2OK0L 5H94B 3IYLW 3WUWA 2APTA 5JA8B 1JPGB 3QIWA 5FEBA 1YEGL 5I19L 1XGRA 4GO6B 2HJFA 2Q86B 4X6FB 3NN8A 1QSVA 1UZ6F 5DD0H 5J6HA 4NKMA 2AV7A 5B39G 4IOSD 1OGAD 1TCRA 1UEYA 5T33L 3VXUA 3VG9C 1W0WB 2VITB 3GI9L 5DI8A 1BLNB 2JCCE 2W0PA 5KN5A 4H25A 1XF5B 5K93A 3S97C 4Z7QE 2AXFA 2B39A 3S4SB 5TE6L 2EH7L 1U2CA 3MRBB 1F3JB 2LTQC 3PDOA 3VFNB 4CVZA 3LKRB 2H32B 3KAAA 1VFOA 4JQIL 5CZKA 3PHSA 1MF2L 5DQDH 3SQBA 2PTUA 3BP4A 1LP9E 1TNNA 2WWKO 4KTEL 4CJ1A 5D70H 3BP6A 1F6AB 4P23A 2IALB 3R0MA 2C1OA 1NGZA 3WKML 3JV4A 5J6GA 4F7PB 4MQ7B 1LEKB 3GSRB 2DN7A 2QHLA 3KPNA 4GXVH 4L4TA 5IEKB 3EOBB 1UC6A 2VDML 3MLPA 1FJ1B 2IAND 4FTVA 3SGDI 4M8VA 1QP1A 3WMSA 3A67L 5DVKA 2D31B 3TN0D 4GMTH 1AO7A 5K9KB 4Y19A 3CCHB 1DQDH 2GJ6A 4OF8A 5GHWL 3P77A 1ROWA 1P7QB 1JGDA 2BOBB 1SEQH 2NXYD 4X99A 3WV0A 3AUVA 3QUKB 5I1KH 1J1XL 4U1LB 3FQTA 4YDLC 2QSQA 4UTBH 4RFEA 4PJHF 1B9ZA 1HH9A 5C7XH 2PO6A 4OQTL 3MACH 4JFZL 2EZ0C 2KKQA 1NMCB 3BW9B 4KI5C 1AQDA 2DAVA 5C0RH 4QEGA 4F7CA 3FT2B 4JPKH 4ONGH 4OTXL 1EX0A 2E7LC 3V5KA 4LOUC 1DUZB 5DJCA 1BJ1J 1QA9A 2AJSL 4NJ9L 5SWZB 3K8KA 2DYPD 3MJ9L 1UB5A 5JW5A 4JCLA 4PY7A 4YBLB 5GSRA 4KMTL 3EO1A 2YD6A 1JPFB 1J8HA 5AD0A 2FHCA 1HHJB 1INDL 2H26B 3BVNA 5D6DC 4F7TB 2FX7L 5FGBA 3EYQC 1ETZB 5JXAH 3VXUE 4ZDHA 3ULSA 3WXWL 3TNMA 4PJ7F 2GK2A 4JDVA 1QSEE 1AC6A 3R06B 1KTLA 2R0KL 5DTFA 1MI5B 4MDIA 2NX5E 3RU8H 3VFSB 3X13A 3MUGB 1WQVT 2E9IA 2NLJB 3SHSA 3T3MF 3ROOB 4H0HB 4K3EL 1D7FA 2NY7L 3LSOA 4XNQB 4JY4A 2N1KA 2WIIA 1G7HB 5BV7C 1NC2D 4ZODA 3QNYB 3CAFA 1AGDA 2BHUA 2WBJC 2Y06L 3E2HC 4RIRB 4WENB 3WFDL 3INUL 4AEIL 5DR5H 4FTVE 1R5WB 1OD7A 3BT2H 5BXFA 1KG0A 5EZIH 4OB5H 4R2GB 1VB9A 2APVA 1AO7E 5H8DA 1K8DB 3TO2B 3DIFB 2QSTA 2GJ6E 1BEYH 3N1FC 4WWKC 3QUZB 3BH9B 3FFCD 1S8DA 5EU4B 1FIGH 1MSPA 2C7UA 5M94B 3DMMC 2ESVB 4P4RB 3A0OA 2CUIA 4JPIA 1LO0L 2ENYA 4HKJA 4P2OA 2JE8A 2XKSA 2BVOB 1CU4L 2NY1B 4TUJA 3GSQA 2R4RH 5HDOA 3TT3L 1I75A 1Q9WB 2VLLB 3JVGC 1VSCA 1DBMH 5CP7B 3MBXH 3RL1A 2PXYB 2YMXH 4Y5VB 4C55A 1KPRB 4OFKA 3UEZA 3CH1A 3EYOA 4PJ8A 4HXBH 1WFNA 3W39A 5MEOB 5EOCJ 5I1EL 4K3DL 1WJ3A 3TZVC 5DEZA 4Q2ZB 4EN3B 5DMGD 1EMTL 4JJ5A 5B39A 4L8SC 2YEZA 1J8HE 1A7RL 1AGFB 4HCRA 5F88A 2X4SB 3Q6FB 1P84J 3QEGL 2OJZH 3QIBD 3RI5K 5FB8B 4WFFE 5A2IH 3IGAB 3D3VD 5KSBF 3NFSL 5FKPB 2Q6WB 2DWEA 3S98A 5H94A 3T3PE 3A6BH 4F15B 4ZO8A 1JPGA 5A40E 1D9KC 4X6FA 3QUXB 4QF1B 3MCKB 4IRZL 2XN9B 2HJKB 4UUJB 4NOBA 1WZ1L 2MCG1 1PZUB 5AZEH 1E28B 1RJCA 3W9EB 2ZCKH 1I1YA 4FFZH 4OCSH 2W9DL 1ONQB 2DBLH 2VITA 2GK0A 4YGVB 1BLNA 1KLGB 5C0AB 3S4SA 1FZJB 1S7SB 4PTTA 1F3JA 3L5XH 4LHJB 5E56A 1U8NB 1AI1L 3T77B 3NIGE 5GGSA 4M61A 4G6FD 3ROLA 2ZUWA 3LKRA 3GSNH 3BGMB 1TVBB 3PXHA 4PP2A 4Q58C 3ZYIA 4TQEL 2AVGA 1MAML 5GRVL 4MQXD 5CZXD 4FZEL 5IVNA 3MLYL 3MYJB 2ZOLB 4MQ7A 3GSRA 5IEKA 4M7ZC 3EOBA 4KJYB 3TBWA 5KSUB 3KYKH 1FJ1A 4U6VH 1JN6A 5MP6L 1PY4A 3FN9A 4KRPB 3UJJH 2D31A 4KGLA 2E3VA 1EAJA 1MCPL 4OF0A 4YAQB 1P7QA 3H3PL 2BOBA 3B9KD 4R4NC 3T2NL 5E08H 3QUKA 1H3UA 4GSDL 4U1LA 5EU7C 1MHPH 2P45B 4RMQA 3DXAD 3R1GL 1QYGH 5BZWB 4WUUE 2CMRH 1YEHL 5IT2L 4M1DL 4PJHB 3HUJA 4QOKD 1LE5B 2FO4A 4L8BA 3MJGX 3L1OL 4UZGA 5KAQG 3J8F7 2AGJH 4FXLA 2BY0A 1V7NH 1K6QL 2HA1A 3FT3B 4UQ2A 1ZHNB 2VYRE 1QLEH 3M17B 1DUZA 4UT7H 3CPLA 2XZQL 3T4YB 1AN4A 5SWZA 2QQLL 4KZDH 4N1EA 1VA9A 1Q9LB 1MLCA 1Q0YL 1KULA 4TNVF 2WANA 1U36A 1LO3H 1GGCH 4L5FH 3QDHA 2Z31D 4PJIF 3V95A 4ORGB 1HHJA 4WI5A 5C2BL 2BK8A 2AAVA 4WHYH 4PJGF 5F6HI 1JYXA 3BN3B 4F7TA 3QJHA 1I1FB 3CDFA 3WIIH 2ARWA 5E9DB 3M07A 1ETZA 2ZUQB 5CMAA 1A7QL 1U8JB 2VLME 5F7WC 3R06A 3B5HA 4PJ7B 3LRGA 1J7VR 2B1HL 3MZTA 1FL3B 1MI5A 4KRNA 3VFSA 1TJIH 3G5VB 1IKFL 2OI9B 3MUGA 3MV8D 4WO4B 5D1XB 4JO1L 3TF7C 4XPHL 1YEDA 3BWAB 3V5HB 3QIUB 1A6AB 3V2AR 3WUZA 1CD8A 3O2WL 4JRXA 4HMDA 3HNTL 3PGFL 5E8OB 3CDCA 2IPTL 2AEIT 4R2GC 1IC7L 3ZE0E 3WHXB 1XF2B 5TQ0H 4JO4H 4LP5A 1L7IL 1R5WA 5GGQL 1JTTA 1KJ3H 3QUZC 4Y4KB 3SCMA 3T04D 1CLOL 3RHWK 1K8DA 3VFOB 3TO2A 3DIFA 1DVFB 4XVUC 4XVSL 1QLRB 4LLQB 2CO6B 3BH9A 5EU4A 2DTML 1LE9A 4RGNE 4UT9L 1EJ6A 4KKNA 1U58B 5EORH 1IM9D 1ZT4B 3RAJL 4HIEA 3OKKB 5CJ5A 2B1AL 3KPRA 3HRPA 2VERN 2J8UE 1Z3GH 2BVOA 2K7PA 3O9WD 3HUJE 5CP3A 1NDMA 4U33A 4K9EL 1Q9WA 4HIIB 2VLLA 1HHHB 4RMVA 5CP7A 3VXTB 3VWJD 2PXYA 4Y5VA 1KPRA 1X5GA 2E9BA 2GFBB 3B6SB 4UBDD 1F4XH 1T03H 1DP0A 5MEOA 1NMAH 1VFMA 2VUYA 1T89C 5ESAB 3D0VA 3HZKA 3MO1B 4Q2ZA 4EN3A 4HMCA 5SWZE 2OR7A 1OAZH 5E6YA 4R4FL 3TBTB 2JB6A 3CDGB 3ARPA 3EJZC 4M6OL 4OCXL 5B3JF 3UAJC 5T1DH 1TLKA 5DRNB 3TP4A 2XWTB 4LIQH 5EWIL 4Y4FB 3AXLA 1G84A 1FDLL 3C60B 4TSBH 3IGAA 4GUPB 4OGXH 5KSBB 1NCDL 2W9LA 2W0LA 4MS8D 2E7MA 5EU6B 3DNKA 4NWUL 4HUXA 5EPMA 3HZYB 2EXYD 3GO1H 1KGCE 1MI5E 2GUOB 3QUXA 1IVLA 3MCKA 2XN9A 1SM3H 4J3XA 4UUJA 4YDJB 3UDWA 4OI9A 3W9EA 1IQWH 2WWKT 3BSZH 2Z93B 3QO0B 5E8EB 4OV6F 1J0HA 4YGVA 3UX9B 4JRXE 4HJJH 3UYOD 3RPIA 1KLGA 3ZDXF 3F58H 3U7WH 2YD7A 2OL3A 2ZJSH 1S7SA 2GT9B 1U8NA 2DL2A 3ARDC 3T77A 3CX5K 2YZ8A 4I0PD 5T3XE 3AROA 1O5DT 2VXVH 4JKMA 3UTPE 1TTUA 3BUYA 1FPTL 1TVBA 2X4OA 1P9MC 3BGMA 3CK0L 3GSVB 3QDGB 4GRLB 1YN7B 1Z6JT 5TF1L 4DKFH 4I18C 4I77H 3HC4H 2DQUL 3X12B 3BD5A 3I9GL 1HH6B 1OQXA 2ZOLA 3MYJA 1KFAH 5GISL 2Y5EA 5EBMB 5LVEA 4IDJL 1J5OH 1QNZH 1XF4A 1MRCH 2VQ1A 3KPRE 4RGOL 3SDYL 5HHVH 2IQAB 3SO5A 1R3KB 4LSVL 4JHAH 4HCRL 3SDDB 5JUEL 2BMKB 1VKXA 3CH8A 2R69H 4I3SL 2X44D 1BQLL 4O58H 4QTHB 3BYTA 3MBED 4JQVA 1XMWA 2D0GA 2V2TB 4M43H 1FYHB 1LEGA 2CGRH 1RZJH 5H2BB 5BZWA 3RKDC 1J0ZA 4PJHA 1OSPL 3KR3H 4G9FB 1LE5A 1IT9L 5I8EB 2KH2B 3O11B 1MOEA 1KCLA 2P5WB 1Q1JL 2A0LD 1KJ2B 5GRVK 3M17A 5HVFB 4G8IA 1X9QA 3D69B 3T4YA 2F74A 1Q9LA 3BDYL 4APQD 1G9ML 3RVVC 3F7RA 1MQKH 3ULVH 1QFHA 4XCFH 1HXMB 1MJ7L 1DEEB 1IKNC 4ZD3L 4ORGA 4PJIB 2OTUB 35C8H 2V17H 2XN9E 3S36H 1F4WH 3RWEA 4PJGB 1I1FA 5EB9A 4X7FC 4XB8A 3T0ED 5ANMA 1ACYL 5I1CL 3X11B 1KPUB 4WO4C 1A14L 4PJ7A 1U3HD 1ZLUH 1D5IH 1FL3A 3S36X 2VR4A 4QRUB 1G7LB 1I9EA 1HLOA 1K2DA 1HQRB 5D1XA 5D1ZD 3I6LE 1D5ZB 3V5HA 3VXSE 3QIUA 2EE3A 1YZZA 3DETC 1RU9L 1OPGL 2VDNH 2VLRD 5E8OA 4Y4KC 5T5FH 1TFHA 1WIPA 2VR5A 2VZSA 3W5NA 1XF2A 1B4JH 3B4NA 4GG8A 2Y72A 4MHHI 4IS6B 3FMGH 3BZFB 4MJ2A 1I7ZB 4KHXH 5FCSH 3O4OC 3H3KA 3L3DA 1UJ3B 3N06B 4EDWH 6CGTA 1QLRA 4LLQA 2EICA 3MGTB 1S5IH 4XBPB 1GPOL 3CFBB 3MV11 4PBVC 3DX8B 2C26A 4U1MB 4XPAH 1A64A 1VGKA 1EEZB 5GRUH 5KVEH 1ZT4A 4FQQB 3M8OL 3OKKA 4FQCH 4GKSB 4TVPD 4GKZA 5BO1L 4KUZH 2Q8BH 4PJHE 5L7XL 3MLSH 2R1WA 2JELH 4HIIA 1FGNH 4UINL 1OM3H 1HHHA 1BECA 3VXTA 5B21A 3OKDA 2GFBA 5E0QA 4FQXB 1E27B 1ZK9A 1PY9A 4KMQA 3VRLF 4LDLB 3MO1A 5DT1H 3WFCH 2FJFB 1QKZL 2F54E 4P46C 3V4VH 4YX2H 1EHXA 2JB5L 3TBTA 3C5SA 3CDGA 2DWDB 1OF2B 3HNVH 2IGFL 1IC4H 4PJ9D 3MC0A 2RFXB 1IJ9A 2ADJB 3MLVL 4HC1H 1KIRA 4KV5E 3TA3B 5DRNA 5HYQA 1UCBL 4Y4FA 5CLWA 3MV9B 5CJQL 4KK9D 1U8PB 1AGCB 5I8OH 1I9RH 4PJBF 1BM3H 4HT1L 4GUPA 5GZOD 4AEHH 5ANME 5KSBA 4CW1A 3FCTB 3L3JA 5IB3B 5DMIH 4NDMA 4L3CA 2YXMA 3HZYA 5JQ6H 3UJIH 4PJ7E 1QBLL 1K4CB 2GUOA 1D3CA 4KKBC 1A4KB 5L88L 4LASL 5T1LA 4AG4H 1HHIB 4ZFFB 2KPNA 4NZTH 1T1YB 2FWOB 1HSBB 5IMOB 4HPOL 4X6CF 5E8EA 1QSFE 4RRPA 4OZHE 5IWLC 3B2UD 1BIIB 1X5YA 4OGYL 3H9YA 2DIBA 5EZLA 3PE9A 3E1F1 3WNKA 1CCZA 2I24N 5M7QA 1BFSA 1NLDL 2VDOH 4PYHA 3WIFB 1FFRA 3QG7L 4DAGH 5EU3A 1CYGA 4Y5XB 4JAMA 3QDGA 4QY8B 3OG4B 4DN3L 1YN7A 1CF8L 3GMQB 3LZFH 3QXAA 4MA7H 2YPLA 2R1YA 3PWJB 4U49A 2W59A 3X12A 4L9LB 2VMFA 1F3RB 3U7AA 4Z95H 1RULL 5EBMA 4MJIE 4BH8A 3ZE2E 2X9YA 3OV6A 2V7NB 5GS2D 1CVSC 4NQXA 4JB9L 3KNBA 2C4FU 1RZKL 2L7UA 2IQAA 4YPGB 5AUMB 1Y18B 3OPZL 5L2KD 2BMKA 15C8H 2G9HB 4WGWB 1T22B 2J6EA 4OGAD 4QTHA 3OKOB 3W5MA 1S9YA 2W91A 5IMKA 4DEPB 1MHEB 1SY6H 2V2TA 1BF2A 4S1DC 4FFYL 2H2SC 3ARBB 3UTSD 2NW3B 4YHKL 5HHOB 4LPCA 1A5FH 1G9NH 4XHJC 3GHBL 1BBDH 3RWGB 4G9FA 1N3NB 2QQNL 4P3CL 3AFLA 5DD3L 1AP2B 3QDJB 1IARB 4ZXBB 3VH8G 1F13A 3MXVL 1KIPB 2CQVA 2NYYC 2P5WA 3LB6D 2NY3D 3SGJC 2A38A 5CSZB 1KJ2A 2F53E 1X4ZA 1CFTB 5JMOC 3MODL 4J1UA 3DYPA 4WI4A 1JPSH 3C5ZB 5EZOH 3EDKA 2YA0A 5CGYC 4DTGL 1AY1H 4NKIL 4P3WA 1WBZB 4Q6IC 5I73C 1HXMA 2ZNWA 1DEEA 3VXPA 5I0ZA 1KJVA 4PJIA 2OTUA 5I1HH 1MPAH 2V2XB 4Y8DC 1CFVL 1HIML 1FZMA 4U6HA 4KUCD 4Y5YC 5DK2B 3RGHA 4OLZH 1V3KA 1KPUA 3WE6B 4P5TB 2ZPKH 4RMWA 3HR6A 3BQUD 1MCFA 1EBPA 5DVOA 5I1DA 2EDFA 4OKVB 5HGHB 1HQRA 4O9HH 4OFYA 1VGEH 2LU3A 1REIA 1D5ZA 2HAZA 2ZG1A 2YPLE 4MNQD 4JKKA 3QCUL 2P43B 2EDDA 4AQ1B 4F57L 4CVUA 2HMIC 2DLGA 4MD5B 3ZT7A 4EEEA 1HINH 4JFYB 4Z0XA 4BZ1H 5IB4B 4JLRB 3TO4D 4IS6A 2EEBA 3BZFA 5TE4H 2Y5TA 1I7ZA 3ARRA 4LCWA 3C87A 3BZDA 3D39D 2VQTA 1EHNA 3D0LA 3FONA 4PBWD 4XBPA 3VXRB 2HKFH 3CFBA 3PL6A 3DX8A 3RWDB 1A3QA 1EEZA 3O2VL 3OAZH 1UM6H 5E2VL 3IDNB 1XT5A 1MFBL 3JUZA 2V5TA 3DYOA 3KPQA 1T1WB 4G9FE 5C07D 2R2EB 1ZTXL 3P30L 1HEZB 1EHAA 2VABB 1ZT7B 2GHWB 3RP1A 5JHDD 5DHYB 3VI3F 5LGJB 4Y88A 1E27A 5EDXA 4MVBD 4Y89A 2UVEA 5AWNL 3MOAH 1CK0L 1OP5H 3P9WB 2FJFA 2Q3ZA 2WINA 4XXDB 1OF2A 3RTQB 1A6TA 2RFXA 1ORQA 2DMBA 3TA3A 4JM2C 5GRZA 4PJIE 5FYJU 3HMXH 1U8PA 1AGCA 1EHLH 4RAUA 1EH9A 3AGVA 4OT1L 4PJBB 3HI5H 5IEHB 3GMRB 1I4FB 5IB3A 4HGWA 5FA3A 1ZWIB 5IW1A 2XQYG 4H26B 1ZANL 3PP3H 2Q3AA 1NAMB 2BVUA 1FVEB 5SX5H 3SJVB 4S0SD 1A4KA 5LQBH 1NL0H 3SDAA 4F80A 1PGRB 4J3TA 4MD4A 4GQ9L 3ZE1F 5I9QB 1HHIA 4ZFFA 3W0WB 4IMLB 1T1YA 2FWOA 1MIMH 1HSBA 5IMOA 5EFIB 5JHLL 1A1NB 4M5ZL 3MPCA 4QNPF 1CZ8L 4M48L 1TPXC 4LAQH 2B0SL 3HMWH 4X6CB 1FBIL 5FGCB 1BIIA 4PLNC 4M7KL 4Y1AB 4HUVA 1BD2D 5JW3H 1KT2A 3OKMB 1KIQB 4BQ8A 3WIFA 4P4KC 5B8CC 1Z2KA 5EA0H 1G0YR 3O6MH 4OCMC 5KG9A 1I8MB 3QQ3B 3EJYD 4Y5XA 4LCWE 3GMQA 1K5NB 1CGTA 4JKPH 1WTGT 2CDGA 2P48B 5I16B 3BHBB 2VXTH 3S37H 3T1WA 3ZKSD 3UBXI 3MLUH 3BKML 2LE9A 5C6TH 4L9LA 4KKAC 3VXNA 1FNGA 3DTXB 1XF1A 3OF6D 4YFLI 5DHVA 1N4XH 3RKPA 2EIDA 3VH8A 1JGVL 3JZ7A 5MI0B 1ZAGA 4TTDD 25C8L 3WO4C 4ACPA 4YPGA 2EDBA 3TJEH 1M7IB 5J13B 2ATKA 1KCUH 2E5EA 4KKCD 2VISB 3QJFB 1A6VL 1MRFL 3HE7D 3GDBA 3MJ8A 5TDNB 4ODBD 4OLWL 1CGXA 5E4IA 5IBTH 3LDBB 6FABL 1MHEA 4NP4L 3RVWD 1H3PH 2XQBL 3OGOE 3OXSA 2CKNA 3ARBA 4A6YA 1TJGL 4G3YH 4R3SB 3MLXH 1IGJB 3VG0H 1A9BB 4HWBL 1N3NA 3BYYA 2OR8A 4XPTH 1CFSB 1CE1L 1AP2A 4P5KB 5IMMB 4ZXBA 2DJUA 3GJFB 4K8RD 5DRWB 3K7UA 4PLOB 1OAQH 5JIIA 2DQCH 2V9TA 5CSZA 4PY8I 1L7TL 4XNMA 3W9DB 4U6TA 1S7QA 5ITBL 1CFTA 4HFWB 1AFVL 1J10A 3C5ZA 5I1IH 5D93B 3B2VL 4HUWB 2CKBH 1RJYB 1KENL 4JHBA 4OD1H 4NZUL 1TTFA 2V2XA 5GS1B 1YEIL 1S3KH 4X6DF 4NN6B 1CGSH 4E5XA 1JCKA 1MFEL 4IIQC 1NMBL 1KPVB 4ODSL 5HYJA 4XVJH 2WUBL 3WE6A 4Y16B 2EIZB 4P5TA 4NWTL 1MH5A 3MJ7B 4O5LH 5JXEC 4PGBB 4ALAH 1AE6H 4WEBH 5BW7A 4PJXA 1KN4L 4DVRL 3K0WA 2DMCA 1BF8A 4OKVA 2J6EL 3N1GC 5HGHA 5KVMC 1NFDF 4ODVH 5E2WL 5EUOF 1LGVA 4OD2B 4MWFA 5D7JC 1TETH 3KPPA 3LEXA 4OJFL 1JP5A 1JUFA 4M6ML 4HK3N 3SKUD 2CLZB 4WFEE 3CSYB 4MD5A 4MNGB 4JFYA 5IB4A 5ID1B 2DF3A 4JLRA 5HSFA 4M62H 5EZJA 4NC1C 4AQOA 3ZKQD 1MNUH 4XNYL 3NFPB 1KJ2L 4PY8J 4LSRL 5E2JA 4L8DB 4ODUB 3K46A 1WBYA 2DQGH 3MNVB 2VZTA 3FRPG 3VXUD 3RWDA 3HC3H 4N90E 3I3DA 1MCBA 5D2NE 2Q7NA 5CBEB 2ORBH 1QSED 3UC0L 3TVMD 3ZKMD 5JORB 1ES0A 4QHUB 4PLJC 1MJ8H 3FN3A 5J11B 2NX5D 1T1WA 3F12B 3PWUA 1NPUA 1HEZA 1ZT7A 5J12C 3WKNA 5DHYA 1QFUH 4R8WL 4LL9A 2AABL 3FO1A 2J5LC 5H37H 1AJ7H 4KTDH 3EOAB 5FECB 5LBSL 2ADGA 3MLZL 3EYUL 3VU2A 3BPNB 1KTKE 1G1CA 4FTVD 3OAUL 2Z4QB 4G6AD 3D85B 1P2CB 4NM4H 1AO7D 1JHTA 1ZA3B 2UUDH 3RTQA 3U0PB 4G5ZH 3AY4C 4PJDB 5FO8A 2GJ6D 4DW2L 1U8QA 1NJ9B 5KW9L 1AIFB 2ICCA 4NRZA 4RMRA 4NFCA 1A7BA 4NZRH 4W4NA 1I4FA 4YHYB 4ONHB 5F7NC 5C1MB 5HYJE 1ZWIA 5CEZL 1NCBH 2J1KA 1NGPL 2XFXA 2PO6D 3TYGH 1GHFL 1PEZA 3SJVA 4PJXE 3DVNB 4TRPH 3BPLB 5FO9A 4KHTL 3W0WA 1TCMA 2ICES 4IMLA 1K3IA 2MJWA 4TNWK 1QFWM 5I66B 5EFIA 1A1NA 3NZHH 5HHNA 5IF0B 3OR6B 1A9EB 1RSFA 4Y1AA 3RIFK 4FQ2H 1AD9B 3HE6B 1F90L 3OKMA 2VZUA 1C1EH 4XP1L 3QEHA 1BHGA 3LRHA 4LVOB 2LU7A 3QQ3A 2XACC 4YK4B 2P8LB 4JVPA 3F5WB 2X9XA 1FFOA 1K5NA 1FQ9C 2MSPA 2OMBA 3RZCA 5I16A 1UA6L 1RZFH 3RWIB 3CFCL 3KXFB 5IHZB 4WFFD 4TPRH 1T7XA 1AQKH 1QTYT 2WBJA 1DJSA 1FRGL 4NNYB 3NIDE 4PB9L 3FO2B 3DTXA 3P11L 1WWAX 4LSSH 5J9PB 3G6JF 3K81A 5IBLD 3HHRB 3OQ3B 1CFQB 4K3JL 3SY0B 3SBWA 3I02B 4DOHE 5GXBB 5L0QC 2DI8A 1CD0A 3WFEL 3KLAB 4XC1L 3ZTJH 4WWKA 4BFBD 5F7UA 4F2MB 3RWFB 5ITFB 2VISA 3VE0B 4C59B 3DMMA 2AJVL 4ERSH 1DN0B 3ZSTA 3VFRB 5F7HA 1N7MH 5C08A 4M7JL 5FIEA 1BAFL 2Y23A 5EO9A 2I26N 1L0YA 1DANU 3OXRB 4PP1D 4R3SA 3NCJH 4U31A 5JDJA 1NCCH 5CIPB 1KELL 2NY4D 2XZZA 1IGJA 3NABH 4KI5E 1A9BA 5F1KC 4S1QH 4P5KA 5IMMA 4N8CH 3GJFA 2Y1VA 3KDMA 2M8XA 3GMOA 4JREB 4WFGE 4C4KO 4TULH 5IJVB 2YK1H 5DRWA 1JNJA 2OZ4A 3TZVA 1R3IL 4YHPB 5I18L 5CINH 3QQ4B 3W9DA 1DLHB 4J3OC 4MA3B 4YXHH 1GVIA 3LAFA 1QEWB 1W2KT 4CMMB 3TBVB 1PKQE 1J1OH 3B9EA 1KCRH 3FOMB 4BSVB 4HUWA 5C71A 1PBYA 1FYTE 2DICA 5HYSB 2BY2A 1IM3B 1RJYA 4MMXC 5GRXG 1G6RH 4QHKI 5E2UL 2Q7YA 5DJZA 2NY0C 4M4RA 1UFUA 2X4UA 3FB6B 1QACA 1WCBB 4Y2OA 4WUKH 2WW8A 1IZJA 4X4XB 5LXGL 1AHWB 2VDRH 1QVOA 1KPVA 3C09B 3U9PL 4KROD 4DGYL 4P2QB 4Y16A 2EIZA 4WUUD 5FYJE 3KPOA 3MJ7A 4H88L 4PGBA 2EDJA 1MHHA 1UB6B 2MPAH 1KEGH 2I07B 1ADQA 4OLEA 3S3SA 4H1LH 1NFDB 3JBG7 3O6KH 4OD2A 5IMLA 1YYML 1A4JA 3LD8B 5EUOB 3NACH 5DJYB 2OBGA 4B5EA 2NTSP 2ZCLL 3T4AB 4GKNB 1R0AH 4A6YL 2X4QB 3HG1E 3HNSH 2AQ3A 3CSYA 4YE4H 4BJLA 1DE4B 5F9WB 4DFHA 5FDWA 1SBSH 3ZKXC 1AR1C 5CJOH 2A74B 2WP3O 5A3IC 5ID1A 4K7FA 4CUCA 1CLZL 5HGAB 1QFWH 3UBXB 4EQ3A 5JR1H 3DSFL 4KMLB 1KV3A 3CD4A 1I3GL 4JGUA 4L8DA 4MLSA 3FOLB 3MNVA 4NN7C 2J7LA 5EIQA 5C08E 5DJ6B 5J11C 4PLKC 4LEXL 2VLMD 5CBEA 5AEAA 12E8H 1OGAB 1S7TB 1T7YA 5JORA 4DGVL 2DL9A 3MOBL 4M9OA 3LEVH 4N68A 3WFBH 1H15B 3VGHA 1DBBH 2O5YH 3GNML 4PJEB 1RUPL 5SX4H 3VA6A 4GAGL 1E6OL 3QCVL 2P42B 1KB5B 3O6FB 2R9HC 3EOAA 5FECA 1IC1A 4K7PH 3S3JA 5BOZG 3QXWA 2FH8A 4D2NA 1FO0H 5FF6B 1Q0XH 2Z4QA 3ECBA 5IROC 3D85A 5ALCH 1A0QL 2MTPA 5E24E 4NQDA 1DBJL 5CBAA 3MUHL 1ZA3A 5DRZB 5AAMA 1OARL 3U0PA 3S88H 4PJDA 1YYLL 2IANB 4YHNA 4GG6A 1P7QD 1IZKA 1RY7B 4K7PX 3TN0B 4CKVX 2EYSA 4RGND 1NJ9A 5GGTA 2D7MA 1AIFA 2GCYB 2A77L 5AAWA 1CDYA 2O26U 1XGPA 3LKQB 3ZSSA 4ONHA 4R97C 1NGYB 2NXYB 5FYKL 2E6PA 3V4UH 1PKOA 2JJVA 4WY7L 4X6EB 1KXQE 1UM5L 5E6IC 2ZSWB 2FH6A 1LK2A 2ED8A 3AS1A 1TZIB 2NY5L 4G6KH 4EUPA 4ZFOA 1NCAL 1FVDA 4FQIH 5IF0A 3TYFB 3DGGB 5I74C 5E5MB 5EBWB 1TIUA 1UENA 2YPVL 3RY6C 4Q9RH 4XP5L 1AD9A 3HE6A 4I5BB 1RZJC 5FHBH 1JPTL 4Y4HA 5GJSH 5DXWA 4LEOB 1N0LA 1X6NA 2UZXB 4K71B 3ARWA 2P8LA 1PAMA 4AM0A 2DYPB 2EXWD 3SDXA 4XI5C 4MXQD 5BVJB 1F8TH 3FZUC 5JPNB 1IL1A 3RWIA 3KXFA 5IHZA 3RGVC 3O3UN 2O61B 1HOCB 3FO2A 2V5MA 3KS0J 3QHFL 3GFUA 2AXJA 1RZGB 5J9PA 1ED3B 3CXHJ 2DQEH 1CFQA 3G6JB 1KGCD 5F1NA 2I9LA 3I02A 4M9PA 1MI5D 1YEGH 4X7TA 5E70A 2BY3A 4RWYL 1DQTA 4F2MA 5ITFA 3ULVC 4ENEC 1WWBX 3DO7B 2EE2A 1DN0A 1OD9A 2WIMA 5EU7E 3VFRA 5IFJB 5IVZA 3GZKA 3SPVA 5T33H 2WUCL 4HWEL 3GKWL 4R0LB 3CU1A 4PRPA 4JRXD 2DLFL 3EAKA 3GI9H 3QNZB 5HHPB 4WHCA 4Q0XL 4N0UE 1QRKA 2EH7H 4NFDA 4V1DB 1MEXL 4Z7UF 4KFZC 1NAML 4WI8A 2AJZB 2IBBA 5CIPA 5T3XD 1W0YT 3UTPD 4NQDE 3SCMD 2IAMD 2OJEB 4CVWA 5DA0B 4JQIH 5F9AC 1MF2H 4PJDE 3QQ4A 4QXUL 2B2XL 1A47A 3I75B 4GG6E 1DLHA 2FIRT 4MA3A 2BOCB 3CLEL 4YC2C 5F7EL 1VADB 5DO2D 1QEWA 3QDMA 5FYJL 3WKMH 3DUSB 2WZPD 4BSVA 4MCZA 4HJ0D 4R7DB 5ECJE 2VDMH 5HYSA 3KPRD 3L5IA 4F33B 2G60L 2EYTB 3FFCB 3ME0A 4HQQL 5HI3C 3AMLA 3N85L 1WGOA 1JMXA 4JFDE 3TEUA 3OJDA 1S9VB 4YO0B 2FHBA 3FB6A 2R2HB 4PTUB 4U1GC 2O5XL 4X4XA 1AHWA 1J1XH 2A6JB 5ICYB 2D7QA 2QQKL 5FV2A 4XMPL 4EN3D 1IAKA 1CG9B 5GRYA 4YDVB 3LIZL 2X89A 1GGYA 5E7BA 4HULB 4TTGA 4LQFH 4JFZH 2XTJD 1U8KB 1EPFA 4FFWC 2I07A 1LO2L 3PWPB 3S34L 3MRKA 3SDXE 1NFDA 5K59F 5EUOA 3HAEG 3KXFE 5DJYA 1NSNL 2BNRA 3L3IB 3T4AA 1KCSL 4WV1C 5C0ND 3BAEL 1MCNA 2OYPA 1XGYL 1DE4A 2AJSH 4NJ9H 3MJ9H 1ZXQA 3QIBB 1TITA 1P9MA 5I76B 3IU3B 1JWUB 3D3VB 4KMTH 3UBXA 1H3TA 2BERA 4F8TA 1TZGH 3QUXD 1T6WA 1OTTD 5I1AB 3CUPB 1INDH 2XN9D 4GLRH 4TUKL 3Q5YA 5INDA 4LHUG 1FH5L 4AYFA 4YQXL 2FX7H 1T2JA 1T5WB 5SWQB 4JY5L 5DJ6A 3RA7L 1QO3B 2K3TA 4DN4L 4PRPE 3WXWH 4MAYC 1WV7T 3F7YB 2YD9A 1OGAA 4XRCB 3IDXH 4KK6D 4JFQB 1OTUC 3B5TA 4PBXA 1H15A 2BDNL 4RSVA 3I6LD 4QT5B 3WFZA 4LLVB 3I2CL 4KDWA 4RBPH 4PJEA 3VXSD 2VTFA 4K3EH 4NO5B 4XMKL 4XCEB 4G6FB 1QUNA 1AGEB 2NY7H 4N0CC 2DKUA 3JV0A 1KB5A 3O6FA 3IJHB 2P49B 3QDME 5KVGL 2PW2B 4QRRA 1RD6A 5EYOA 5JLZB 2Y06H 3WFDH 1A7PL 3INUH 2YUVA 5CJ8A 3NOIA 3IKCB 4P5MA 1J9CT 4MDJB 5E1HB 5DYOB 5ERWA 1ADQL 1MCLA 5DRZA 4JN2A 3TH4T 3NGBC 3TNNB 3TN0A 4QHNB 3QWQB 2GCYA 3HZMA 4LCCC 5ESVA 2W0FB 1LO0H 4N9GB 4OSUL 5MEND 4KY1L 1IAIL 1LO4L 4X6EA 2R8SL 1CU4H 5DZOA 5EG6C 2ZSWA 1A6PA 3TT3H 2ICWB 5KSAB 2CD0A 3DXAB 4PR5B 4XH2B 4F3LB 5I8CB 3L9RB 3RY5A 4U05A 1NFDE 4QOKB 4OZFH 2C9AA 3TJHD 5EUOE 5FYLE 3QHTC 3J7HA 5I1EH 1T0NA 3MLRL 2QR0A 4K3DH 2BNRE 3MA9L 4BUHA 2F54D 5IM7B 3CFEB 4I5BA 1RIHL 4MAUL 1EMTH 4LLWA 4R6UA 5JW4M 1G9NC 2P46B 1I1AD 3FQXB 1E0OB 3U0WL 1A3LL 1A7RH 1CR9L 2E9JA 2XWJB 1FL6B 5BVJA 5JPNA 1MLBB 4MGXA 3Q5TA 5ALBL 2Z31B 4LCUB 1GCFA 2Z8SA 2O61A 3IETB 1EFXA 1J18A 3NFSH 5I0DA 4Y8AA 4ZS6C 4U1IB 2RQ8A 1T83C 1TQCB 5DLML 4NIKB 2R4SL 4C4KT 5D1XD 4IRZH 1JMZA 4NUJB 3DO7A 1WZ1H 3ARGD 4PJEE 1VFAB 5GGTL 3WS6C 2R2BB 5ACZA 1QSFD 3T0BA 3MV8B 1RZ8B 2W9DH 2FX9L 1OB1B 5HHPA 1G7MB 1LDSA 2V2WB 4QRRE 5ILTL 4V1DA 3DVIA 4RGMC 4G8EB 2AJZA 3QFDB 2CIIB 1WSST 1AI1H 1U3YA 3ILPB 3U36A 5GGRY 5IB2B 5DA4A 4FNLL 4AZ8A 3IB4A 4TQEH 3I75A 1MAMH 4NC2B 5DK0A 2BOCA 2X4RB 1VADA 3D25A 4FZEH 2NZIA 3MLYH 3ESVF 4MJID 5DWUL 1ZHKB 3LKNB 2NY6C 3CGTA 5HVHB 3SE4C 4R7DA 4GS7B 4F33A 3T09A 3CLFL 2EYTA 5MP6H 3CNKA 2D7NA 1ZLWH 2FBJL 2V7HB 1IM9B 1MCPH 3I85A 3C2AH 1B2WL 1PDKA 1T04B 1X4YA 1C7TA 5DGQA 1S9VA 4WI6A 4CVXB 3ES6B 2R2HA 5HGGS 3O9WB 3QNXB 4QRSB 5EU5B 4X5WB 3T2NH 1UGNA 3PABB 4G7VL 1ZOXA 4GSDH 5ICYA 3JWOC 4GW4A 3VWJB 3CFDA 3GEWB 4OQ1A 4TN9A 3VGAB 3R1GH 3GSOB 1CG9A 4JHZA 1R05A 1YEHH 5IT2H 4M1DH 3HR5A 4XP9L 5ADPH 1U8KA 4FOMA 3L1OH 4NBZB 4ETYA 2AW2A 3PWPA 4KAQL 1FC1A 4Y4FD 4PJAF 4BKLB 1K6QH 1IGYA 2F53D 1CT8B 3L3IA 4HG4K 3E3QE 5BQ7B 3WDIA 2XZQH 3S5LB 3SQOL 4NSKA 1N59B 3QIBA 5I76A 1Q0YH 1FNLA 3IU3A 3RIAF 4AMKH 5BJTB 4WI2A 4ZFZB 2V6HA 5LAXB 3ILQC 1EO7A 3F65A 5T3ZE 1TQBB 5T1LD 5I1AA 5C2BH 3BE1L 2BX5A 4JVUA 3ARTA 3PGDA 2ITCB 3RI5F 1ULVA 1A7QH 3GMPB 4JFQA 4V1DE 2FZ3A 2G5BB 2B1HH 2YUWA 3GIVA 4DK6A 1IKFH 2H2PD 4QT5A 1RJLB 3OR7A 3U83A 2FL5B 1JZ6A 4JO1H 2YPLD 4XPHH 2EKJA 4NO5A 4I0PB 3LOWA 3DJ9A 1ITCA 5DJDA 1AGEA 3D2UD 5CZXC 1ITBB 3O2WH 3MRRB 3HNTH 3IAGC 3BKCL 3PGFH 4J3UA 2HVKB 2IPTH 3ELAT 3WBDA 5JLZA 1IC7H 1PFCA 1UG9A 3IKCA 4MDJA 1L7IH 5DYOA 1UYWL 5GGQH 3U46B 3STZA 2C1PA 1CLOH 4J3SA 5D9SB 3NFNA 3GJFK 3T0WA 2HWZL 3G5XB 4XVSH 3TNNA 1MCKA 5C0BA 5HDQH 4XXCC 3B9KC 4QHNA 2DTMH 2C3WA 4M03A 2VKWA 4Z76A 4DUXA 4UT9H 4N8VB 4L3EA 1U8OA 3RAJH 4Q6IA 3BGFB 4N9GA 4BQ9A 4JGJA 3MBEB 4KK5C 5I30L 2KZWA 4GBXA 3SKJL 4NJAL 1I3RB 2HTKD 5DJ0B 4HLJA 1I7TB 5A16A 3T0XA 4GW5B 2ICWA 4K9EH 5KSAA 3IJYB 4F3LA 1NBZB 5I8CA 4ZOEA 5HY9B 4X5XB 3L9RA 3AREC 3PWPE 4NKDB 1M6OB 2APBA 4QOKA 2AK4A 3TIDB 4YNYB 3CVHB 1XZ0B 2ZOKB 5IHLB 1HHGA 5IM7A 1NGXB 3OBAA 5KZCB 2FX8L 2I60L 4HW6A 3X3FL 4R4FH 5T5NF 3ARUA 5C09E 4JEGB 4M6OH 5DEFB 4OCXH 3W11D 3CMOL 3FQXA 3KJ6L 3PV6B 2F5AL 4NN5B 3MRMB 4LRNL 3GSUB 3O8XC 4APQB 3FN0L 5EWIH 5IB5B 2CSPA 1KB5L 1FDLH 1MAJA 4XZUB 1NCDH 4YHML 4JG1L 4YBHA 4KUCF 1FE8L 4U2ZA 2N7BA 4GRWE 1P69B 1V3JA 4J6RL 3T0EB 3BMVA 3WJJA 3TFKD 3JWNC 2D2OA 1SVCP 1H3GA 5CZVL 1URLA 1MY7A 5EC1B 1H5BB 5EUKB 1VFAA 2W1NA 1A1MB 1BGXH 2R2BA 2YC1B 3LCYA 3PWLB 2E8YA 4BZ2L 1YJDL 2VZ3A 4N8PA 5DRXA 1G7MA 2HN7B 3UPRA 1Z9OA 1YEKL 4P59L 1A02N 4CU8A 4G8EA 4YXLL 4OLXL 2BJML 3ZYZA 1JNHB 1S7UB 2VLRB 4P57A 4O4YH 4OAWB 3ILPA 2A83B 2GTZB 3ZDZF 4LCWD 1P6FA 1FPTH 4JHWL 1WC7B 3CK0H 2FLBT 1ZVHA 5JMRA 2FO1A 5TF1H 5DJ2A 5HDBF 3H9SB 5C0BE 2DQUH 1DQQB 3PL6D 2Y4SA 2X4RA 1CXKA 2MCPH 3I9GH 5HI4D 1ZHKA 3LKNA 2A6DA 5GISH 2ZKHL 3LY6A 2JJSA 2AEPL 4L3EE 3X3GL 4YBQD 3QPXL 4RGOH 4JM2A 3SDYH 4CN6A 1FSKB 3BPOC 3UPAA 3O9WC 3V7AG 2V7HA 4LSVH 4MJ5B 1IM9A 4LNRA 1J8KA 2PYEE 5I75B 4EIZC 4JRWA 5JUEH 1T04A 4I3SH 3S35X 1BQLH 4ZFGL 5EU5A 4D0DB 4X5WA 2AK4E 4PRAB 3RHWF 3VWJA 4KC3B 2EDYA 3U4AA 4FA8A 5T3ZL 1XIWA 3MROA 4E42A 4JZNB 1IT9H 3RVXD 1NUDA 5C0DB 2BVPA 3VWKD 2KUTA 5J1AA 4P9ML 3ARVA 4YJZL 1Q1JH 4BKLA 1T66D 2XICA 4PJAB 1UQSB 3RNQA 3B83A 2NY2C 3T0VA 3T2QA 1ZV5A 1JNNL 5CSGA 3SE3A 5KBNC 5B8CA 1P4BL 3BDYH 5BJTA 1OL0A 4ISVA 5A2LH 2H32H 3H6JA 3V52L 2YD2A 5JOFB 1MJ7H 3QB7C 4ZD3H 4IRJB 2JJWA 1MWAB 3SDAD 2CDEB 2X4TB 2YS4A 5B4MD 1CTNA 1I1RA 2D4FA 5D8JH 1T1XB 2VNCA 2OCFD 1V8HA 1B0GB 3TLRA 1YN6B 3HZVB 1H0DB 4HS6B 3W82A 5I1CH 2YKLH 3JTTB 2JLLA 3IFNL 1A14H 3JV6B 3QUYD 3DX6B 4ZNCD 1IGIL 4EI5C 3BEVA 1LEIA 1RJLA 2FL5A 5AYUH 4AT6A 1A3RL 1BFVL 1J05A 1X7QB 4Z7OE 1RU9H 1OPGH 3MRRA 2EDNA 4WFED 5GS0L 3BIKB 2HVKA 5JOPE 4XPBL 1QBBA 1FNSL 2HT2D 3BXNB 3CFJA 4WW1B 5LWYL 1RZ7L 4O00A 3EOYG 4QXWA 1N6QL 3G5XA 1KJMA 1BQUA 5FOBA 3GB7B 3EIFA 1K3ZA 5DC0A 5ISZA 1QBML 1GPOH 4J8RB 2MKLC 4N90D 4NFBA 1H9VA 2BSRB 4WHYG 5C9JB 5L2KB 1P7HL 4N8VA 1NEZG 1T0MA 3EO9H 2OXHA 3M8OH 2JJTA 4XVTL 5FUOL 2JCCF 5BO1H 4Z7QF 5L7XH 2B4CH 4GW5A 4X4YB 1E4XL 3VGBA 3IJYA 4ZXBD 3UTSB 4UINH 1NBZA 3S8WA 4IIQA 4X5XA 2VE6B 4NKDA 1VEMA 3D6GA 1M6OA 3L7FB 4QRPA 1MHCB 3TIDA 4YNYA 2A0LC 1H8SA 3CVHA 1OGTA 2OP4L 1O0VA 43C9B 1F11B 1SJVA 3DI2B 3DBXA 5BS0E 1NGXA 1LP9F 1XR9B 1PG7L 3C5ZD 1QKZH 2NY3B 3U1SL 4OIBA 3VJ6B 4HPYH 3IDIB 2CK2A 4HKZA 2FJHB 5DEFA 2IGFH 4F8QA 2YPAA 4CAGA 5E8NB 2FSEA 3MLVH 3GSUA 1INQB 4Q9CA 5DDHB 3U4BL 4APQA 5K9JL 1UCBH 5IB5A 4ODHL 4R96B 5CJQH 1J0IA 5F3HB 1JK8A 4HT1H 3P9LB 5BOPA 5DC9B 4FMKA 5HYJD 4XZUA 1FNFA 3H0TB 4OLUL 2DM2A 2DLHA 5K9QI 1Q9OA 1V05A 4JO2L 1EERB 1U3HC 3LPFA 4DCQB 1QBLH 3QG6B 3AS2A 4U1NA 1A1OB 5KTEL 4LASH 5I2IB 3OZ9L 5L88H 5D1ZC 5EC1A 4I13B 5EUKA 1YPZA 3UTTE 4XNZC 4IJ3C 5L8JB 4HPOH 2YC1A 5IUSA 3WDJA 1GRWA 4OGYH 3MRFA 4O2EB 4HX1A 4MNQB 2AJUL 1HYRC 1NLDH 1PLGL 1S7UA 3UPCA 4BYHA 2A83A 3QG7H 1WC7A 4DN3H 2X7LB 3RDTC 3GGWB 1CF8H 3IVKB 1DL7L 1A7NL 2UYLB 2H6PA 4XP4L 3PIQB 3TO4B 3H9SA 3LKPA 1R3HB 5ISZE 1HN1A 3GM0A 4ZOBA 1DDHB 3RL2A 1MRDL 1RULH 7FABH 3D39B 1X5ZA 1EA9C 2FR4A 1OP3H 4JB9H 2G5RA 1RZKH 5FAAA 5T1MA 4U6YB 4MJ5A 1HQ4B 3OPZH 2IH1B 4K2UL 4B7IA 4QRPE 2ZG2A 2NW2B 4D0DA 4PRAA 1D5XB 5C07B 2DIAA 4U0RB 3FKUS 5D72L 5IFHL 5JHDB 1QR1B 5IK3A 3GM8A 3I3BA 1FG2B 5IV2B 2EZ0D 3MFFB 1EVUA 1X4XA 4YHKH 4HGMA 4IOIA 4KI5D 1CD1A 4UQ3B 3C8KB 3GHBH 1O7VA 5F8RC 2QQNH 4P3CH 3B8YA 5I1JL 2B7DT 5DD3H 2ICEB 4PJ9C 4WFGD 3HN3A 3MXVH 4HLZH 3D1MC 2GSGB 1BQSA 3KPLA 5F3BB 1XGTB 3ARFC 4I2XE 4LOUD 2NTFA 1CL7L 3QR2A 3MUJA 3FRUB 4NNPL 4PJAA 3L3OA 1UQSA 2HLFC 3MODH 4GAJL 3TV3L 2A9MH 4P2RD 5GZOC 4NZDA 1JHLL 1FYTD 1CFNB 4F9LC 4DTGH 4NKIH 1BP3B 4JPWL 1OHQA 3QFJE 4IRJA 3EYQD 3KLDA 1CFVH 3JWDC 3KJ4C 4TYUA 1HIMH 5L6YL 1T1XA 1YPZE 4W6XB 4AY0A 1B0GA 2IQ9H 3K1DA 3B3IB 3QWRA 3RJDA 1C5CL 1KLUB 2E8ZA 5KJRL 4HS6A 5EIIB 4IOFC 1ZHLB 1YMMA 1KTRL 3JTTA 5FYJD 4GMSL 3DV6B 3JV6A 1OOAA 1C12B 3AU1B 3DX6A 4PV8B 5KS9B 1WBXB 1WLHA 1VFUA 2CXKA 4RA0C 1BD2B 4FABH 4ZG1A 1JNLL 3RZCD 2X5PA 3K74B 3QRFM 3ARQA 4ZSOB 1BREA 3BEWB 1X7QA 3QCUH 2WBJD 2J12B 3H9SE 1IGML 3Q1SH 3UTZA 3ZTNL 1FNEB 3HG1D 2AV1B 3RUGF 3EYVB 3I50L 3U79A 1VFBB 3GSWB 4S2SB 2VKXA 1RK0B 5EBLB 1L9MA 2QJDA 4JFPB 2YN3A 3BXNA 3T3PF 1SEQL 4WWKD 1U8MB 1FG9C 4OCRL 3DMMD 3RVUC 4OGAC 3AS3A 3GB7A 5TDOB 4P0DA 5C08D 4JO3L 4J8RA 3WCYA 1KCVL 2BSRA 5C9JA 2IFFL 1YC8A 3O2VH 3S7GA 5C7XL 3QXUA 3GBML 5D96C 2R1XA 4X4ZA 3HI6L 5E2VH 4UV7L 2B5IC 4NQCB 1CDBA 4XPGL 2JCCB 4JFHE 4WHTB 1IEAB 4X4YA 3P30H 1FLRL 5F96L 2VE6A 3MRHB 3BH8B 3NIGF 3TZVD 3L7FA 3KLHD 4DVBB 4IRSC 1T20A 2HT3C 2WBKA 1UZ8B 2VIRA 4PJAE 1F11A 5SWSA 1MCJA 3QQ9C 1AR2A 5AWNH 3T0AA 3IDGB 4YUEL 1LO5A 1ZA6A 1LP9B 5IJKC 4XCYB 1MJJA 1CDIA 4HD9A 5E8NA 4QKXB 4BQBA 5ID0B 4YLQT 1INQA 5DDHA 1BFOB 3SKMB 3BP5A 4R96A 1ZT1B 1UH2A 2CLVB 2OSLA 5F3HA 2GYSA 1X5AA 4D3CL 4OT1H 3KPSA 4NCC2 3MQIA 3H0TA 4Q9QL 1YMME 4NPYA 1G0DA 1YUHB 1MVUB 2IC2A 3BQUC 1ZANH 4DCQA 3QG6A 5AG8A 1JWMB 1A1OA 1IILE 3MRDB 5I2IA 5DEGA 3OMZA 5D7IA 4GQ9H 2QBWA 3SGDH 3ISWA 4NCC1 1JVKA 5JHLH 4M5ZH 4HXAL 1CZ8H 4M48H 2CRIA 5FCUL 2B0SH 1CGWA 1FBIH 4M7KH 2ICWJ 4O2EA 4F9PA 5EZIL 3ZYJA 2XTLA 4U6XA 4OM0L 4PGJA 2X7LA 3MRQA 2CPCA 1JI1A 5J06A 3GGWA 1P1ZA 1FIGL 2VXQL 2UYLA 2CR6A 3CVHL 3PIQA 3TO4A 4EVNB 1R3HA 2HJFB 4RZCB 5JZ7C 3BKMH 5IBUG 1BQHB 3QEUA 5IROA 3OKEB 2YD4A 3D39A 4NKMB 3WYRA 4ZOCA 2R4RL 1WF5A 1JGVH 4KWUA 1TCRB 3FB5A 1FLTX 2WAHA 3VXUB 1X3DA 3MBXL 4WHDA 4XB7A 2IH1A 4R4ND 3HI1B 1QSEB 4JZJC 4OUUB 3TVMB 2VAJA 5DUPL 3L3GB 1A6VH 3OTTA 3FQRA 1MRFH 4E41A 2BHYA 2NX5B 2NW2A 4OLWH 1D5XA 5C07A 3IDYB 4MVBC 3I3EA 4NP4H 3C6LA 1QR1A 5SWSE 2EDKA 2XQBH 1KYOJ 5E6IA 1FG2A 5IV2A 1M7DA 3BP4B 3MFFA 4IMKA 1QLFA 5FXCH 1TJGH 4UQ3A 3C8KA 1NAKL 3BP6B 5J6GB 4HWBH 1NGZB 1RUQL 3ZE0F 4NQDD 1CE1H 2LABA 4POZD 4NQTA 2EC8A 5ACMA 2PR4L 5HPMB 1BVKB 1VPOL 5TF0A 3EFFB 3RY6A 4NRYA 1AFVH 2VSCA 2HP4A 4DQOL 2DTSA 2GJ6B 1U93B 3B2VH 5EH1A 3KPSE 4X99B 3E8UL 1KENH 3EW3B 3FQTB 4JFDD 4NZUH 2J8UF 5AZEL 3RGVA 1F2XK 4FFZL 4LIQE 4RFEB 3HUJF 4PJFA 5D7IE 3OAYH 1YEIH 1UH3A 3HLAB 1EVTC 2PO6B 4YR6B 4MXWL 4Z77A 3B3IA 1MFEH 2X6MA 4ZAKC 1CI5A 1NMBH 4EI6B 4ODSH 1ZHLA 4FZ8L 2CUHA 1JYWA 2EDOA 2WUBH 2Y9RT 1C12A 4LAJH 3AU1A 4NWTH 2P7TA 4PV8A 1WBXA 4Y4HD 4D9RD 5KS9A 1AC0A 3T65A 4LBEB 4ZQKB 1NQBA 1KN4H 4DVRH 4TVPL 1BD2A 3SEPA 3EJYC 3O2DH 2RCSL 4G9DB 5E2WH 5CEYA 1N5YL 3KXFD 5GSRB 1I85C 3BEWA 1MREH 4OJFH 3V6ZA 5GGUA 4M6MH 2AV1A 4OF7A 3IFPA 1F6LL 3EYVA 1F2QA 3RUGB 5GGRB 1CGYA 4S2SA 3DX7A 5EBLA 2WSKA 1NKRA 4JFPA 5FV1L 5GJTL 5C8JB 2XV6B 4XVUD 4ZDHB 3MZGB 4NO3A 3TNMB 3OF6A 3NTCL 1UXWA 3P4LA 1FAIL 5E08L 4KKCC 4XNYH 4JDVB 1KJ2H 1KTLB 3V4PL 2F58H 5DTFB 3HE7C 4LDEB 5TDOA 4E41E 4MDIB 4DWHA 4PRPD 4PUBL 3CXHK 3LMJL 5F7MC 4J4PC 3F7QA 3UC0H 1AH1A 4M00A 1J12A 3RVTC 4NQCA 1TMCB 2WIIB 1MWAL 4WHTA 1IEAA 4IEFB 1OAYH 3TPUA 3MJ6A 3OX8B 4AIXA 1AGDB 2HFGL 3MRHA 4R8WH 2AABH 4WI3A 4DVBA 1EUUA 5BXFB 5LGKA 43CAA 3AM8C 4P2YA 3QDMD 1RPQA 3IDGA 3EJZD 5LBSH 1JE6A 3MLZH 3QEQB 3EYUH 3UAJD 3GMLB 5HHXL 4XCYA 1RI8A 3OAUH 2C7UB 5E4EB 3NIFE 3WIHH 4JPIB 3DROA 4OM1L 1C7SA 1G7QA 4YHOH 5ID0A 4HKJB 2HFTA 1BFOA 3SKMA 4PJFE 1ZT1A 2D3VA 4DK3A 2CLVA 3GSQB 3OGCB 4ZTPL 1JZ7A 1NDGB 5KW9H 4YH6A 2HG5B 4Q74A 3LQZA 3PNWA 1T80A 1FN4B 4CMHB 2X1WL 3CH1B 5CEZH 1YUHA 2X89D 1MFDL 5C0EB 1NGPH 1U92B 5KS9E 1GHFH 1JWMA 4JGMA 3LEYL 5I15H 4KROB 1D6VL 4WUUB 4JJ5B 4UIKL 1E4JA 5B39B 3QA3A 4NUGL 1K4DB 1WZLA 5FYLD 3WN5C 1O7SA 4LKXA 1PJ9A 2BNRD 2YEZB 3VFVA 3ARDD 3NPSC 5F88B 5TQ0L 3SDCC 2NNAA 1YNLL 5F72S 4NGHL 3MTRA 2P1YA 2Z92B 4XP1H 1EFQA 1B6DA 3BKYL 3QIWC 2WNGA 1JL8A 3RNKB 3U0TA 2DLIA 4GAYA 4YFEA 1PYWB 2QSCL 5F9OL 1PZ5B 1UA6H 2BSTA 3CFCH 4EVNA 4RZCA 1ORSA 4UOW1 1FRGH 2W0KA 4RMSA 4PB9H 1BQHA 3QI9B 3EO0A 3OKEA 2HFFB 3LS5L 3P11H 1DBKL 1YC7A 3AC0A 4M6AA 3KS0H 4K3JH 1I1YB 1MFAL 2IADB 4NQCE 2GK0B 3FFDB 3WFEH 4XC1H 3HI1A 1QSEA 2BVTA 4OUUA 3IAPA 4PTTB 3TVMA 1N0XL 2PNDA 2AJVH 3L3GA 1QFWI 2NX5A 4MD0B 5GGSB 4M61B 2O5ZL 3ROLB 4OFVA 1BAFH 4P23C 4PP2B 3O6FD 4QRRD 4UAOB 5IQ9B 5C6WH 3RBSA 4PRDA 3BDBA 4U1JB 5D7LB 2H45A 3HA0A 5I17A 1KELH 1Z9LA 5I71B 4HIJA 4EIGB 3TBWB 4BSJA 5KAQF 5HPMA 1R3IH 3G08B 1JN6B 1H8OA 3F6IA 5I18H 4OGXL 1BVKA 3O4LA 3ZKNC 3EFFA 1GAFL 4R4BB 3MRNA 3C5JA 1VDGA 1ZSDB 5SX4I 2E27H 3RVVD 3NCFB 4NQUA 1U93A 3MNZA 3BO8B 3DGCR 4A2MA 3AB0B 4RGNB 1GZQA 2CDFB 3NH7L 5E2UH 4ZPVB 3TC9A 3B9VA 1IQWL 2L4OA 2J8UB 5E5RB 1IGFL 4KRLB 3HUJB 3HLAA 4YR6A 1E6JL 4HIXL 5DD1L 2FO4B 4L8BB 3VGDA 5LXGH 1EGJL 3VFMB 4EI6A 4LVHB 4FFVC 3GRWA 3U9PH 2COQA 4DGYH 4UQ2B 4K94H 2IMMA 3SO3B 3X14A 4LBEA 1UVQB 4ZQKA 5HD8C 1W8NA 3CPLB 1MLCB 4G9DA 5FHAL 4K9EC 2EKSB 1YYMH 5AG9A 1IBGL 5FGBC 4KV5F 2Y07H 4L9DA 4QTIL 1KBGL 1EFXD 2ZCLH 4TNWF 3RUGA 5GGRA 3STLA 4DZBB 2IF7A 4CL7A 3PV7A 4CBPA 2DLTA 1YMHB 3QJHB 4WGVB 1FGVL 4PGCB 4R90H 5C8JA 3RIFF 4WW2B 1CLZH 2JTDA 5CMAB 4JDZA 5T3ZD 1YEEL 5LCVL 4FP8L 1WZKA 1NANH 3DSFH 2GAZB 4HWNA 1I3GH 1RZJL 2PCPB 1T6VN 1I9IL 5FM5O 4LEXH 4NYLB 1YEDB 4V1DD 4OZHF 4Z18A 4PP1C 2QSVA 4DGVH 5F1SA 2NY4C 4JRXB 1XCTA 3MOBH 3H42L 3CSBA 5F1IA 3ZZ1A 3OX8A 3UJTL 4UV4L 4J7RA 4HJGB 3GNMH 1RUPH 5IVXB 3KWWA 1DQML 4P46D 3O4LE 1E6OH 3SKNA 3QCVH 3QAZB 3SCMB 2IAMB 3WXVH 7CGTA 3OJVC 4X0KA 4I0CC 4JDTL 3QEQA 4XCFL 3GMLA 4FMFA 4P2OC 5B38G 1LE9B 1A0QH 3ZE2F 3DRQA 5J4MA 2VRAA 3EDFA 1DBJH 1XH3B 4HIEB 1OARH 3NCBB 3KPRB 3WHE0 3MSPA 4PJ8C 3OGCA 1NDMB 2LVCA 1NDGA 3DPBA 2GI7A 3ZHDA 2HG5A 4RDQG 1J0KA 2A77H 4ZUTB 1FN4A 5GS0D 1FFPA 3OKNA 1V7ML 3IT8D 4KKBD 5FYKH 5EOQL 5C0EA 3K2MC 1U92A 4WY7H 4JKLA 4LHUD 3RIAK 1WITA 3D0VB 1Z9MA 3HZKB 2EDTA 1CICC 4Z6AT 3PWPD 4WUUA 1U9KA 2QEJA 4RFNB 2NCMA 2JB6B 2NY5H 1K4DA 3KHQA 5DZNA 2KZ1B 2XTJB 1NCAH 1UM4L 5H37G 5T1KD 3U30C 1C5DB 2J8OA 2HH0L 5C6PB 2YPVH 3AXLB 4XP5H 3RUGE 5DURD 4PJ5A 3ZHKA 1DBAL 1W72B 5C09D 1JPTH 2DDQL 2Z92A 5E2TL 5FUCC 2EDQA 3SGKA 3RNKA 4GJTB 1S5IL 2J88L 5F7DB 1OCWL 5JNYA 4HUNB 1PYWA 4PRNB 2Q8AL 2Y7QA 4HUXB 5EPMB 4XPAL 1PZ5A 1E4KA 2H1PH 4ORZC 3Q48A 4ZO9A 2OTWB 4K8RL 4LLAA 3MYZA 3QI9A 1FFQA 3UP1A 2HFFA 3QHFH 4ATHA 3QDAA 4KXZI 4PD4K 3P4MB 4HMEA 1OM3L 1NBVL 3BUTA 4NM8L 2IADA 4QGYA 4F3FB 2ERJB 1G9MC 3FFDA 4RWYH 3RPIB 4D9LL 2OL3B 3H7BB 3GJEB 2VH5L 3NAAL 4S1DD 1LDPL 2H2SD 4MD0A 2JIXB 3NPZB 3DWTA 4LGSB 3V4VL 2WUCH 4GLRI 3BUYB 4HWEH 2X4OB 3GKWH 1GC1L 2DLFH 1F45A 2OQJA 5DJAA 5LKNA 1B0WA 2FD6L 5IQ9A 4JFXB 3VXSB 3QEQE 1GSMA 5K9OB 4U1JA 5D7LA 4W4OC 1MEXH 4LCYA 1NAMH 2NYYD 2V5YA 1XF4B 4MZ2A 1IAIM 2VQ1B 3G08A 5I50A 4QXUH 2B2XH 5C0BD 4R4BA 2EECA 3CLEH 2DQIH 5CGYD 1ZSDA 2IG2L 3RBGA 1VKXB 1T0PB 2V5RA 4L3ED 1QFPA 3VD7A 3O3AA 5HI5D 3BO8A 5GQBA 3VI4E 2G60H 4GBXD 4MB4A 1K9TA 3O8XA 2CDFA 4HQQH 3N85H 1LEGB 4ZPVA 2PYED 5KSAD 3T1FB 1NMCC 3RPKA 3AVEA 2J8UA 2Q20A 5MENB 4LVHC 3ZTJG 2AK4D 4UTAL 2O5XH 5D1QA 2Z8RA 3VFMA 1P53A 3STBA 5E99L 2CKBA 2GQHA 4XMPH 1MFCL 2HVJB 3LIZH 4PJ5E 1UVQA 4YBLC 1S7WA 1FC2D 4G8IB 5FUZL 1IFHL 2F54B 2F74B 2B4CC 1LO2H 3V5DB 2MH3A 3S34H 4QXTB 1IMHC 4MXQC 2EKSA 4JRYA 2ILLA 4WVRA 4R26L 2CH8A 5JW4Q 3N0PB 1I1AB 4GT7A 1NSNH 1NCUA 4FS0A 2A6IA 1KCSH 3BAEH 1CN4A 2NXZB 2R0ZL 1XGYH 1DQLL 4DZBA 3RWEB 5GIRA 1YMHA 3KYMA 4PGCA 4WW2A 4BFEA 5ANMB 1UCTA 3GJFH 3EHBC 1XAUA 3HFML 4BSWB 1YNKL 4NQED 1S9WB 4TUKH 2GAZA 1FORH 5TE7H 5TJWK 4AL8L 4YHLL 1FH5H 4NBYB 4YQXH 5B38A 1F58H 4JY5H 2PCPA 1K2DB 4DZ8A 4DN4H 5IESL 1LVEA 4NYLA 1JHKL 4HKBB 4LSUL 3ARGB 4ZYKB 5D7LE 1QSFB 4OZHB 4JG0L 3MRJB 4OV5A 3CVIL 2BDNH 2H9GB 3GBNH 4HJGA 4MA8L 3I2CH 3RWJA 5IVXA 4GG8B 4MJ6B 4XMKH 4C83B 3TGXA 2B8OT 1FNAA 1X5KA 2MFNA 4H1LG 1U3ZA 2IAMA 3GRWL 5DO2C 1C16B 1X5FA 5JOPD 5FFLA 5KVGH 3L3DB 2DBJA 3K80A 4OZGA 1A7PH 4JM2D 2NY1C 4BFIB 4MJIB 1VGKB 3PHQB 1ADQH 3N50A 2RR3A 1XH3A 1LWRA 4JY6B 4GKZB 2PXYC 4Y5VC 2AERT 3HKFA 1UXSB 4LFHD 4GFTB 1EAPA 3EGSB 4O02H 2R1WB 5CGMA 1K85A 4OUOA 1PEWA 4ZUTA 2UY7A 1MIEL 1MUJB 3G04A 3OKDB 4EN3C 4NQSA 4OSUH 1NLBL 3WL9A 3ZL4L 4KY1H 1IAIH 4RFNC 1LO4H 2R8SH 3CX5J 1XIWD 2AJ3A 1RZKC 1P4IH 4XCNA 4XNUL 3TT1H 4BH7A 4NHCL 8FABA 3C5SB 3C9NB 1OAUL 3BZEA 1XR8B 4FXGB 4JRYE 1R5VB 2BFVH 4DUWA 4I9WE 2VJXA 3MLRH 5BS0D 3MA9H 1MCRA 1KIRB 1C5DA 5E95B 5HYQB 4YHIB 3PQYE 2F8OA 2WWMC 2F53B 1W72A 3G6DL 4XGZB 4F15C 1RIHH 4MAUH 4YXKL 4CW1B 3L3JB 3QUXC 3U0WH 1CR9H 5F7DA 3VD9A 5CJXC 4NDMB 3ZO0A 5D5ME 4PRNA 4L3CB 2YPBA 5FGRA 4Y2DB 5ALBH 1S78C 2OTWA 2YUZA 5T1LB 4UNVA 5HGBA 2C3XA 2DRUA 5DD6B 2P44B 3P4MA 4RMTA 3TCXA 1UWXH 4KK6C 1GIGL 5DLMH 1RZIB 4F3FA 2R4SH 3IFLL 1CLYL 4O2FA 5EZLB 3H7BA 3GJEA 1YY9C 3UTTD 2Z9TA 3L3KA 3ALXA 5IVXE 3O3EB 5GGTH 2JIXA 3FQWB 2OTPA 2A73A 5HYIA 1SJEA 3ABZA 5EU3B 1RUKL 4JAMB 2FX9H 3QXAB 3VXSA 2YPLB 2R1YB 4JFXA 5FM4A 5K9OA 5ILTH 1ZE3C 4OZGE 3D2UB 4KZEL 4N0FA 2VZOA 1TNMA 3HTLX 3S35L 4KRPC 4QRQB 4L3AA 4BH8B 2YD1A 1WIUA 1R3LB 2WV3A 2ED7A 4FNLH 2AEQL 4NQXB 3KNBB 4K23L 5TQ2L 4M8QA 5ISZD 1J87A 4HF5L 1DUYB 2EH8L 1EDQA 4JQVC 5DMYA 1SYVA 5DWUH 1QR4A 1E4WL 5F6IB 5JIPA 2F5BH 2C4FT 5LQBL 1S9YB 3CLFH 5IMKB 5GZND 2FBJH 2RIKA 1SBBA 3VFPA 3T1FA 4H8WL 1B2WH 5F89A 5GRJL 1H3WM 5C0CB 3U5VA 5MENA 3M1BA 2GEEA 4F7EA 4B53A 5DF0A 4QRPD 5C0GB 2D7TL 1JI2A 4QYOB 2XTJE 4ZPTA 5A2KH 4G7VH 5JXED 4LSPL 5KZCD 4Z78B 2IH3B 2VAAB 3ULUF 4HIHA 2YD3A 2HVJA 2XZCL 4DKDC 3LKOA 4J1UB 4LVNB 1HYSC 2F54A 3F8UB 5J1SC 2VXTL 3K4ZA 5HHME 5D7JD 1BWWA 3V5DA 4ZUWB 4KAQH 1OLZA 4QXTA 3P3YA 4XC3L 3O3DB 3O81A 4PJCF 1I1AA 2ZWLT 2VL5A 3VXPB 1I9JL 1KJVB 2ZUQC 4YEEA 2YRLA 1FZMB 3SQOH 5CIPH 4KRMB 5HHQA 4U6HB 2OS7A 3RDTA 4GKOA 3DVGA 2D0HA 3G9AB 2DQTL 2GKIA 1JGEB 3QFJD 1N6UA 4UILL 4G8FB 2EDRA 4H1LA 2OI9C 4BSWA 5HBBA 3MRCA 2UV3A 3BE1H 1S9WA 5D1XC 2BY1A 2VOTA 4PJXF 5DQJB 3BI9X 3QIUC 5I1DB 3FO0L 2J4WL 4PLJD 1Q9KB 2QHRL 3FTGB 1HWHB 1CXFA 4HKBA 3ARGA 5L2JA 4M3KB 4ZYKA 3OB0K 1QSFA 4OZHA 2FHFA 3W2DL 2VC2L 3MRJA 4UB0L 4I0KA 4BK5A 1NFKA 2AJXH 2H9GA 4HFUH 2DI7A 2LQRA 1DVFC 5DZLA 4U1KB 4Z0XB 4MJ6A 3CXDL 3H9SD 2Y5TB 4C83A 4LCWB 3V0VB 5GGVY 1C16A 3BKCH 3D0LB 4OD1L 3NIDF 3FONB 2N7AA 4J2XA 1JBJA 1JRHL 1BPVA 3PL6B 3DYMA 1RIVH 4BFIA 4MJIA 3PHQA 1N6VA 1CGSL 2XRAH 4C56D 4JY6A 3CC5B 2HWZH 5MENE 1UXSA 4JQXA 4DGIL 1QBAA 3KPQB 1EBAA 2ITDB 3EGSA 2NR6D 4CDHA 2Y36L 1RIUL 1RVFL 4O5LL 4Z7NE 1PD6A 4HK0A 1MUJA 1FO0A 3QZWG 1ZVYA 5J7CC 5I30H 3SKJH 4NJAH 5DSCA 4JFHD 4ODVL 2MOVA 2VLKB 3IRZA 3BRFA 2WINB 4KI5F 1S9KC 1Z0NA 4Y4FC 1ZLVH 3C9NA 1XR8A 4FXGA 1R5VA 5FK9A 3C60C 1A6TB 1ORQB 3VWKB 4YHIA 2FX8H 2I60H 4M62L 1NGQL 3H9ZA 3X3FH 2F53A 5BRZA 4XGZA 4HWZB 4ELMB 5HVGB 4RAUB 2MQCA 3CMOH 4MX7B 3KJ6H 5FDYA 2F5AH 4IRJD 4HGWB 5FA3B 3VD5A 4LRNH 5IW1B 3H9HA 5T3XL 5D4QA 2FLRT 1MAKA 4FQLL 1NBYA 2GITB 3FN0H 3PJSB 4Y2DA 1D6EB 4MA1B 1NEUA 5JO5B 1KB5H 3QWRD 4DJMA 3SDAB 3VFTB 4MD4B 4MSWA 1OQOA 1YMMD 5DD6A 4JG1H 1FE8H 3IRPX 4J6RH 1KB9K 1RZIA 5CZVH 4EBQL 4K07A 4HUVB 1QSZA 4ETQA 1KT2B 4GRLC 3ZYOA 3QCTL 2I25N 3QUYB 4I3GA 3O3EA 1L0XA 1QRNB 3FQWA 4ODWA 2AEWA 5KG9B 4M93B 3HPLB 4JJHA 5CCKL 2VDPL 2X41A 4OZFG 4LVEA 4BZ2H 1YJDH 2CDGB 4WDIB 4NM4L 4PG2A 5DD5L 4PRBB 3QXTA 1YEKH 4P59H 2UWEE 4YXLH 3D2UA 2M1KA 4OLXH 2BJMH 2NQCA 2DI9A 4OFPA 4QRQA 1FNGB 2FEEL 3VXNB 1RURL 1WT5A 4IRSA 3VFGL 1JGUH 3SDDC 3A6OA 4JHWH 4LARL 5DHVB 3VH8B 1R3LA 4POUB 5IR1B 1NBQA 1U95B 3BOVA 1DUYA 1EXUA 1F4AA 1NCBL 2ATKB 3WJLC 2ZKHH 1W72L 1HILA 2AEPH 3ETBF 3MJ8B 1YQVL 1G9EA 2NY0D 2HTKC 4FG6D 5D2NB 3OXSB 4AEEA 5C0CA 4A6YB 3IS0X 4A2LA 4I3RL 2HT4D 4OCWH 1XEDA 5C0GA 4ZFGH 3BWUC 4WTZG 4QYOA 1OP5K 2XA8L 4Z0BL 5SWSD 2CJUL 1RMFL 3A6CL 1C1EL 5TDPA 1DLFL 4Z78A 2IH3A 2VAAA 4G6ML 1EJOL 3I6GB 4QHMB 5TPWL 4XNMB 1S7QB 5BRZE 5T3ZH 4G6JL 3KVQA 4UMGA 2HRLA 2OL3L 1RZFL 3FAWA 4ZUWA 1ZGLB 1Y6MR 4P9MH 3O3DA 1ODAA 2IWGA 4PJCB 3WNNA 3U6RB 2R29L 5A3ID 2HLAB 5FO7A 3GUTB 3KPSD 1P4BH 4E5XB 3C8DA 1CDCA 3BESR 4OZIB 5SX5K 1UKSA 3V52H 3VXMA 4LSTL 4ERSL 1JGEA 1V5JA 5HYJB 4HSQA 4G8FA 1QZ1A 4LGRB 3S9DB 3LQAL 1MH5B 5DQJA 3WNMA 2K1MA 1T4KB 4PJXB 4LNVA 2V5SA 1V3MA 1SEBB 2OR9H 1Q9KA 3FTGA 3L3HA 5IIEB 4HEPG 3VG9B 3D87B 3IFNH 4MWFB 2LFHA 2BRQA 4GRMA 3KPPB 3LEXB 3WUWG 2LTQB 1JUFB 5CILH 4OCNC 4JVWA 2X70B 1BWMA 1IGIH 3V9FA 4OF5A 4Z9KB 4YXHL 5HXMA 2HTLC 5BVPL 1UWEL 4KQ3L 3PXJA 1UJ3C 4U1KA 1A3RH 1J1OL 1BFVH 1VESA 5EZJB 3V0VA 5C0FA 4KJQC 3ZDYE 4XPBH 4YBQC 4JFFD 4XTRC 5CS7A 3JWOH 1FNSH 1WBYB 4PREA 5IVOA 2MMXA