The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
30
|
sequence length |
133
|
structure length |
133
|
Chain Sequence |
ATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALYGM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural Determination of Functional Domains in Early B-cell Factor (EBF) Family of Transcription Factors Reveals Similarities to Rel DNA-binding Proteins and a Novel Dimerization Motif.
pubmed doi rcsb |
molecule tags |
Dna binding protein
|
source organism |
Homo sapiens
|
molecule keywords |
Transcription factor COE3
|
total genus |
30
|
structure length |
133
|
sequence length |
133
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2010-05-03 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01833 | TIG | IPT/TIG domain |
A | PF16423 | COE1_HLH | Transcription factor COE1 helix-loop-helix domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins | ||
Few Secondary Structures | Irregular | MYOD Basic-Helix-Loop-Helix Domain, subunit B | Helix-loop-helix DNA-binding domain |