3MV7A

Crystal structure of the tk3 tcr in complex with hla-b*3501/hpvg
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
publication title Allelic polymorphism in the T cell receptor and its impact on immune responses
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 68
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mv7A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mv7A01
3UTZB 3QQ3B 2FGWL 1QKZL 1NFKA 1EEZB 2X4RA 3D3VE 4WUKL 3OKEA 4LVNC 4HGMA 4PRIA 3SGJA 2ZPKH 4POYA 4BH8B 2DD8H 3T4AA 5DUML 4MA7H 2QBWA 2Q76B 4P59L 2WBJD 3C2SA 3KPTA 3OJ2C 4NO5A 3T1FA 5EUOF 3PNWB 4OZGA 5DJ0A 2X05A 5D2LF 4M48L 1JGDA 3LDBB 3PWJA 4EI5B 2PW2B 1KENH 2W1NA 3MXWH 2XKSA 4ODVL 1IGFH 4IEFB 4JFXB 3HZKB 4MD5B 3G5ZB 2NY0C 3GM8A 4YFEA 1I1CA 2AV7B 4NZUH 4OF8A 4C57C 3DXAA 1CLZL 2BJMH 3K2UH 2MCPL 3U36A 3ZKSD 2X4NA 4MQXD 3O0RL 3V2AR 1SYVB 4JFZL 2IAMD 1B88A 1RU9L 1MHCB 4MQ7A 3AMKA 4KTDL 3B2VH 4DKEL 4UV7H 1M7IA 4JFPB 4P2OB 3RHWK 5ISZD 4PJIF 3IFOB 3P4MA 3QDGE 3EOBA 3GJFB 2X1QA 4X6BA 1Z3GL 1EHLL 2IH1A 3WFCH 5J12C 3T0EB 1XR9B 4PY8I 2R2BA 2KPNA 2HT4C 4NM4L 2P5WE 4X83A 2PYEB 1MLCB 5IMLA 1HXYB 1SBSH 2A9ML 4B41A 4OGAC 4HDIB 3RZCB 4R4BA 3BIBX 3WXVL 2HMIC 1KG0A 3ARXA 2VLJA 3OKOB 1AC0A 2VISB 3BKJL 5C0CE 5IKCB 2EC8A 3LRHA 3OWEA 4WI9A 3MRLA 2CKBB 2HT3C 3BH8A 43C9B 4QRRD 2H45A 2W9LA 3UTQB 2XXMB 1L7TH 2J4WL 3QUKA 4NC0B 5IB5A 1SM3H 2FLRT 2L7UA 4X0KB 4AL8L 5GHWH 4M6OH 4LVOB 2XG4A 2AKRA 2WIIA 3FCTA 3LKPB 4PJAB 4RZCA 1WT5C 3FOLB 5DK0A 4G5ZL 1QLFA 5GISL 3EYUH 3UZVB 4ZDHA 1XGPA 2I9TB 3J8F7 4JN1L 2WBJB 3L7EB 5DJ6A 5D5MF 5EZLA 4DGVH 5I18L 1YUHA 4LNVA 3EDFA 3HI1A 3BKCL 1TXKA 1SMOA 1OM3H 4YHIA 4GG6F 4G42A 5L7XL 4QHLB 5IMKA 4N9GA 4OD3L 1NUFA 4UT6H 5LAXA 1N5YL 4LARH 1P2CB 1U0QA 4OLWL 2IAMB 1MPAH 2DJ4A 3QDGD 1FC2D 4BZ1L 2IQ9H 3FONA 4O2CA 5BMFH 5DRZB 4KJWC 3GO1L 3OZ9H 4J7RA 1ZKAA 3GRWA 3QXUA 5KOVC 5ISZB 1Z0NA 2P5WD 4MNHA 3SDCA 4YWGH 3VG9B 4LEXH 1FL3A 5FUCE 4YFLI 2JJVA 8CGTA 1A6TA 3IF1B 2YS4A 2YD5A 3W0WE 2HFEA 1YA5A 4G43A 5LGHL 4DEPC 4LFHD 3U79A 4QRTA 3IDIB 3TCLA 2YD1A 3P11H 1C7TA 4GRWF 1D6VL 4FQXC 2LVEA 4ZO9A 2B1AH 4Z6AT 3MV9A 4U1IA 3WLBA 3HRZB 2CXGA 3MRFA 3UYRH 3BDXA 4PV9B 3S37X 1A02N 3I50L 1LD9B 4OZIF 2ZUWA 4Y0GA 3BPCB 1M1SA 3AS0A 4QRRB 2MHAB 4GAFB 3ZYIA 1ZEAL 3DSNA 1J0HA 3NCJL 4ODHH 3D3VB 3D39E 4XPGL 1KUMA 1RUAH 2LU7A 1RZGB 4KVCH 1KCSH 3ZDXF 3TJEH 3L5HA 2F74A 4TOYH 5IQ9B 4Z0BL 2NXYD 2V2XB 4ELMF 2QQQA 4D0DB 3UTZA 3QQ3A 4XP4L 2E27H 3IRZA 2ZNWA 3LS5L 4Z7WF 5E1AB 1T2XA 4HPYH 3TWCH 4P23C 3BMVA 2YEZB 4Y8DC 3OHXA 3RRQA 4DKFL 1RULL 2EKSB 2FO1A 1VEMA 4OKDA 5B22A 4RSVA 2PW2A 4JR9H 4M6MH 5JDJA 4KJYA 4HGKC 2NY6D 4JFXA 1HXMB 3HZKA 1J0IA 4MD5A 5MEPB 5F1NB 4NHCH 5ID0B 4PG9B 1V05A 1CGUA 2MNUA 4W6XB 3QDGB 1I8LC 4LSPL 3ZHLA 4PRHE 5H2BB 4OZGF 1MHCA 4OLYH 1LDPH 4N5ED 1CDHA 2P5WB 3QO0A 5I8OH 3RBGA 1WBXB 4P2OA 4P9ML 3MLXH 4PJ9A 2J6EH 1XCQB 3KHQA 4J3SA 3G5XB 2WLZA 3ZTNH 4R0LB 1Z9OA 5JA8B 3ZMRA 1ZV5A 3G6AA 1XGTB 5HPMB 2E8ZA 2VZOA 3T0EA 1IFHH 5C9JB 2J2ZA 1TFHA 2VYRE 2UZIH 2VDOH 1MLCA 1HXYA 3HG1E 4W4OA 3O6KH 4JEGB 3VXQB 4WCYL 3QUYC 1WBZB 1YJDH 3UAJC 2N7AA 4HDIA 1MREL 3HS0B 2DQDH 4HKZB 3D39D 1J9CT 1KGCE 1II4E 3CVIL 2VISA 1I1YA 5IKCA 3BP6B 5BOPA 4FOMA 2A83B 4R2GC 2G9HA 3UTQA 1CE6A 5HHVH 3AU1B 3UC0L 1S3KH 1YNKH 2KH2B 1NEZB 2VXVL 5EH1A 4UNUA 4G59A 2NXYB 4JANB 5IT2H 3L5JA 3JVGC 3RWDB 4PJAA 4M5ZL 3RVTD 4NRYB 2OX5A 4MA8L 1KPUB 2AJXL 2DBJA 3ESUF 2YA1A 3I84A 3KLHC 2I9TA 4Y89A 4EVNB 4YGVA 3L7EA 1EEQA 2NMSA 1C08A 1S9XB 3JWNC 4K23L 1MQ8A 3VI4E 2DQFA 1E4WH 1ZT7B 2FEDC 2J8OA 1FORL 4OTXL 5JW4Q 4JM2F 3AY4C 1KIPB 3MYJB 1P6FA 4JRXE 3HAEG 5C0DB 2NY6B 4OM0L 4PRHD 1CQKA 1VFBB 4FABH 4ORGA 5E6ZA 2DLHA 4FG6D 1P2CA 3CFDB 4P5TA 2P4AB 4J8RB 2DLFH 1A1NA 1FZJB 1RURL 1T66C 2PTUA 3AB0C 4IMKC 1JGVL 3X13B 5DRZA 2G2RA 3E6HB 4N0FB 1ZGLM 4GMSL 2VXQL 3WS3B 3OL2A 1UCTA 4LLYB 4PLKC 1W8OA 5ISZA 2L0DA 5JXEA 1N4XH 1CD9B 3QUXC 2YHGA 3CNKA 1T5WB 4GG8B 3P30H 4G9FD 2VDKL 2ZUTA 3OGCB 1FL6B 3FT2A 2A77L 5JOFB 1Z9LA 4HBQA 1BZ7B 3V6FB 5ESQA 3AS1A 3GRWL 1BWMA 4YHNB 3T8XA 1OP9A 1QEWB 4YXHH 2Z35A 1DQDH 3KNBA 4PV9A 5EZJA 4WI4A 3D39B 5IEHA 5SX4H 4AYFA 1IKFL 1FE8H 4PRNA 1BQHG 3LRGA 4NKDB 1LD9A 4UDUB 4JO1L 2D7TH 4XVTH 5C0BA 3GFUA 2HFGH 1OAXH 4KUZH 4S1RH 5KVGH 2EO9A 1PG7L 2XFXA 4KVNL 5E8NB 3SE9H 4NRXA 1I4FB 1RJZB 4JN2A 4MVBC 3D3VA 5BW7A 3EO9H 4PLJD 3QEUB 4TN9A 1ZSDA 4NGHH 2W59A 2YD3A 1EDQA 1U8KB 4IRSD 5IQ9A 1Y6MR 2DIBA 4TSBH 2Y6SC 1T22A 3QSKB 4WI6A 5T3ZH 2Y7QA 5E1AA 5HGDB 3LEYL 1MFAL 2R56L 4XT1C 5AD0B 5I6XC 5CP7B 3NAAH 1NCUA 1IGCL 3V8OA 2V17H 1FC1A 4LPWA 3H3PH 1E6OL 4PRHB 4P48A 1R3KB 1G6RH 5KW9H 4M7LL 4IIQC 4F9PC 1ZA6B 5T3ZD 3NABL 35C8L 4PG9A 2GITB 4RGND 1S9YA 5DQDH 5AG9A 3HNSL 3S97C 2ZOKB 3ARBD 4LIQE 1DN0B 4OLXH 1XR8B 3LIZL 5MENE 1P1ZB 4UIKH 3DX6A 3DBXA 1IJ9A 1U8PB 3BGFB 2F8VA 4G9FB 1KCUH 3G5XA 1FO0H 3G9AB 4R0LA 1U93B 4OF5A 3PL6D 3K2MC 2ICWB 3P9MA 1XGTA 5I8CB 2EZ0C 2XRAH 1LNUB 2GEEA 4XNQB 4TRPL 4DGIL 5C0CA 5C9JA 4HQQL 2CJUL 1JGEA 3E3QC 1FZMB 5DLMH 3DVNB 4X8JB 5BVJB 4M3KB 3BXNA 4ZFZB 1WBZA 1Z0MA 4UUJA 5GJTL 1VPOH 4HKZA 1Y0LB 4QRPE 3MRCB 3VWKD 3IAGC 1VA9A 4I3RH 3CU1A 4Z77B 5ADPL 2E6PA 1XF1A 3RX7A 5CGMA 2UY6A 4CVZB 3GSVA 2EYRB 3BWAA 4ZODA 1M7XA 5CLTA 3B9DA 1N2RA 5DA0B 1U8OA 3QHZH 4IRSB 4NJAH 4JANA 3BUTA 4XVUD 1EH9A 3FT4A 2BNRE 2HG5B 2VDLL 3RWDA 4LIQH 4WHYG 1Q1JL 4TUOA 2A73A 1KPUA 1LO3L 3O3BA 1HZHL 1FNSL 1OL0A 4JFFE 3S4SG 3BVNA 1LQVA 5FYKD 3KPPB 2X1XR 3S36X 5E6IC 4R26H 5F3HB 2ZZUT 1NGWB 3QPXH 5FHBL 3BAEL 1Q9KA 1GGIL 5ACMA 1HEZA 1ORQB 2UZXB 1T0PB 1DVFC 4MWFB 3ZTJH 1ZT7A 2IPUK 3JWOL 3QG6B 1RAMA 5C7XL 4OLVL 1KIPA 3MYJA 3DX7B 5GS1B 3NACL 4YIQB 1NBQA 2AJVH 2R29L 4DK3A 2FWOA 4RGNB 4OIIL 5K9JL 3HNTL 4O51B 4H8WC 4MD4A 3CFDA 4LMQI 4PV8A 1JIBA 1GZQB 1XIWA 4J8RA 3ARBB 4UNTA 1UM6L 3WKMH 3W0WA 5GZOC 5DRNA 4EN3C 1ZS8B 2AEPH 2QSQA 5D72H 3GBLA 3FN9A 3GIZH 4LLYA 5DC4B 3RI5K 1FAIH 2BVYA 2R2CA 2ZPKL 2DD8L 2NW2A 4J1UB 1T5WA 5EFIB 1A1OB 3PL6B 4GG8A 3MLYH 1N64H 1L9MA 1IAOB 3QA3A 1FL6A 3KXFE 2VXTH 1BZ7A 3SDAA 4QCIB 5A2LH 3GMNB 4PJ7E 4YDKH 4LKXA 3V6FA 1TTUA 3IGAB 4DVBB 3C2AH 3MXWL 1QEWA 2YC1B 2VQ1A 1A3LH 1N5AA 3O4LD 1BIHA 1DFBH 1EK3A 3D39A 5HYSG 2J6EA 3RWIA 2PETA 1U42A 5ICZA 3IXTB 3VWKB 4NZUL 4KJQC 3UXFA 2YD2A 2BJML 5DD1H 3K2UL 1I7RA 4NKDA 5EUOB 3VRJA 2J3SA 4YEFA 5CBEA 3ETBF 3MPCA 5I1GH 1T20A 2BNRD 3DIFB 3T04D 3B2VL 1OAYH 4UV7L 2FECI 4S10A 4N0CC 4TQEH 1P6AB 4Z7QE 4AM0A 2B0SH 1JWMB 5D1XC 4GRWH 2D7NA 1HNFA 1U3ZA 4B5EA 3TH2T 1SBSL 2C1PA 5D2NE 4J6RH 3JTTB 4PJIB 1WQVT 5AD0A 5DZLA 5CP7A 4ENEC 2BZDA 2YPLE 4E42A 2YSSB 1VFAB 4FS0A 1ZT4A 3ZT5A 4PRHA 1IC5H 2Q8AH 4ZFFB 4YDLB 2EIDA 3DMMC 4LGSB 5DK2B 3IDXH 5IWLA 3FQUB 3AMLA 3U4EB 2JB6A 4MS8C 2GITA 1SM3L 4U1JA 2IBZX 1RHHB 1MCOH 1F97A 2D0HA 5GHWL 1AO7E 1MSPA 1QO3B 4L9DA 1DN0A 4X4ZA 4DFHA 3KXFD 4V1DD 2ADJB 4OZHF 3HG1A 2C3HA 3EYUL 1XGUB 1JPST 4JQXA 3ECBB 2FD6H 1XFPA 3WNOA 2YN5A 3QQ4A 1A2YA 1I3GH 1U93A 4XH2A 1H8OA 5KSAC 4IRZH 4DGVL 3Q2CA 4H88L 4XNQA 3WJLC 1OM3L 3BJ91 3DVNA 1KYOJ 3T4YA 5BVJA 2YD7A 3O4LB 4ZFZA 3O6FA 3Q5YA 1BECA 4JG1H 1VHPA 4KXZH 1IAKA 4UT6L 3P40A 3WS6A 2ED9A 4LARL 5KANG 5FAAA 3AC0A 3S8WA 3CX5K 1F4WH 2X42A 4LLUA 3S4SB 1MPAL 4ZS6D 4I9WD 2IQ9L 3LKNB 3BI9X 2AJ3A 4Z77A 2BNRB 1CFNB 1NJ9A 1QP1A 4FQHA 3VXPB 3OZ9L 4GG6B 2X4QA 3RIAK 3HR5B 2QR0B 2AP2A 4YWGL 4LEXL 3OAUH 1P4LB 3HAEA 3NPZB 1WFOA 2XPGA 1JUFB 1S7TB 2VLMD 1QHOA 3QPQC 4KK8D 5FO8B 2HG5A 3GI9H 3SEPA 1M71B 3P11L 4RBPK 2YPLD 3SCMB 2V7HA 4EUPH 5DTFB 5E94B 4JRXA 4IMLA 4U6YA 1LEIA 4O58H 4K8RH 2J8HA 2R0ZL 4JJ5A 2H1PL 1OWRM 1ERNA 1S9VB 5F3HA 3U7AA 2P44B 3NIGF 4PJGF 4MWFA 3QG6A 4CL7A 4V3DB 5GS1A 4GRWB 4YIQA 3CIQA 4WHTB 5GSRA 5KSUB 1JP5A 4UTAL 4ODHL 3T3PE 1A6UL 4HSQA 1RUAL 4O51A 1GVIA 4KVCL 3FFCE 4K8RD 1KCSL 3TJEL 5SWQA 4TOYL 4KQ3H 3MFGB 1FYTE 3KXFB 4V1DB 1K4DA 5HYSB 3U82B 1TZGH 3EO1A 3H0TB 1TCRB 4A6YA 4XXDA 2E27L 1G6RA 5D71H 4W81A 4HPYL 3L3IB 3TWCL 2XQBH 4HS3B 3CMGA 4KKLD 1XH3B 5GRVL 5GRWA 3TA3A 1WC7B 2CRIA 1F3JB 4JR9L 4DVBA 2RAMA 3IAQA 2C9AA 1GIGH 1YEHH 2DN7A 4M6ML 3DV6B 5I1CH 2HP4A 3L3HB 4PJHB 3VXOA 4RFEB 4ONGH 2HTKD 2IADB 1FO0A 4KC3B 3ES6B 2W65A 1JRHH 5C6TH 4AEIH 1KELL 2DIAA 1WV7T 4OLYL 1LDPL 1GC1H 3P2TA 3VD7A 1UZ6F 4LNRB 3OKNB 4Y16D 1RZ7L 5I8OL 4X7EC 3ILPA 3GSNB 3MLXL 4Y1AA 2J6EL 5DR5L 1ZLSH 4KTEL 1UWXH 2WBKA 1P9MA 2NY1D 4GW4A 3ZTNL 4G8IA 1JZ5A 2FX9L 3QDAA 2YPLB 4RMRA 4OIAA 4ONFH 1CT8B 4BQ8A 1IFHL 5BS0E 4Z0XB 4Y5XB 1BREA 4IOIB 4WHDA 1PG7W 5CJOH 2UZIL 1B90A 5T3XD 3O6KL 4DN3H 1BOGB 3IJYA 4H25B 4FFWD 1YJDL 3DYOA 3ARTA 4C55A 1R3HA 2DQDL 2VSDA 3MA7B 3OB0H 5H8DA 5IV2B 1ORSB 1Q38A 3BSZH 2CDFB 1MCNA 4MHHI 4XCCH 3NOIA 5AYUH 1A1MB 3GMMB 4GJTB 3P73A 4WWKB 5F1OB 5F6IC 5C1MB 2NY3D 4EUPB 5GRUH 4ZFFA 5LGJB 4OCSH 1FG9C 5MENA 1I3VA 2JJUA 3RVXD 1ZGLP 5JXAH 4Z7UE 5HHVL 2NCMA 1J0KA 1S3KL 3MJ7B 1BIIB 4JAMB 1MAMH 1YNKL 4D9RD 1Q72H 5GRXG 5I0DA 1RHHA 5IMMB 5IT2L 1FNLA 5FEBA 2Q20A 2D3VA 2ADJA 3QISA 1AIFB 1HHKB 2UUDH 1ZANH 3ULUE 1AQDA 1NCAL 4MB3A 4P4KD 12E8H 3HZMB 1XGQB 1J8KA 4CN6A 4XCNB 4QOKA 4OLEA 4GAYB 5L2KD 5ICXB 4MXQC 4QRPA 5B8CC 4Y5YC 2O5XH 5AZEH 4JCLA 4ALAL 1V3LA 4GKNA 3QHFH 1K85A 5L0QB 3C9NA 4FTVE 3QIUC 3KLAA 4KAQH 1MFDH 4KRNA 5SV3A 5ESVA 3QT2A 4X9FA 2DMBA 3GMRB 2DLFL 4NQXA 3S4SA 3LKNA 5JQ6H 1AXSB 2BNRA 3LKRA 1CFNA 2EXWC 4Y16B 5FGSA 3EYQC 2QR0A 4ETYA 3V4UL 4L3EE 5BS0D 3WKNA 2XNAB 1N4XL 4JFFA 4NQDE 2NY1B 5SWZD 4U6TA 5DJZB 2HTLD 2JKXA 2J5LB 1XF5B 4R9HA 5FO8A 4PRAB 3BP5B 1U58B 1MRDH 2ESVD 3B6SB 4K9EC 3SCMA 5DTFA 5E94A 5I8KH 2FHCA 2VLKE 3I2CH 1JPFB 5LXGH 1JZ4A 4F2MB 2FZ3B 2JJWA 1DQDL 4RAVB 1S9VA 1MCLA 1Q9WA 4JY5H 1FE8L 4ODSH 2ICWJ 4JDZB 4XCYB 2D7TL 2NY3B 3LHPH 1OAXL 1KXTB 5KVGL 1ZT1B 4XPHL 3SE9L 1C16B 4U31A 1B9ZA 3EO9L 3K46A 4R4NC 4QF1A 1RUPH 1MEXL 3IDJA 4YR6B 4HPOH 4POUB 5EO0A 4ZS7H 3HE6D 3KXFA 1LO4H 1BGXH 5HYSA 1RPQA 1MCBA 4PJ7A 1RZJC 2O5ZH 2R1WB 3IJSB 1TCRA 4DCQA 5T3ZL 4U0RC 5F7HA 1TMCB 3BP7B 1MRCH 3BYTA 1IGTB 4Z8FH 3L3IA 5DD3L 4FTVD 3TJHC 5L2KB 3K80A 2ATPA 2ZSWB 1A8JH 4HS3A 3NAAL 1UZ8A 2OZ4H 1CLYH 2NTFB 4YZFF 2H26B 3QWQB 2EXYC 2V17L 1KTKE 2XTLA 3NFNA 3H3PL 3T08A 4A6YL 1G6RL 5I8EA 5KW9L 4BELD 4U05A 4WU7B 2QSCH 4E41D 3DUSB 2NY0D 4XPAH 4AIOA 4RFEA 4L3ED 2IADA 4FQJL 3MJ6A 3QRGH 5DQDL 5I15H 4NQDD 3ES6A 2ENYA 2FL5A 4HIIB 3BISA 2HRLA 1YECH 4OLXL 5BS0B 4YE4H 4Z5RB 2I9LB 4LNRA 4UIKL 3E8UH 2OS7A 2HH0H 1B4JH 5SWZB 3EHBC 1WWAX 4RX4D 2E9BA 2VLKD 3TFKA 1KCUL 5JO5A 5D2NA 1FO0L 1NBYA 1I7UB 4UB0H 1NC2B 2ESVB 4ODXB 2YPLA 4PTTA 2HKHH 2XRAL 1BM3L 4Z0XA 4UIMB 2GY7B 2H6PB 2HT4D 4JGJA 4MZ2A 3LH2H 3CK0L 3QNZB 5DLML 3DYMA 5CJXA 4H25A 2X1OA 4HEPG 4RFNB 4OGAD 3MA7A 3X11B 2RQ8A 1ORSA 1VPOL 3WXWH 3U9UB 1A1MA 5TF0A 3GMMA 4HF5H 5C08E 4JHWH 5H37G 5MERB 5C2BL 1INQB 4PRBB 5A1AA 1AO7A 4WWKA 4WWID 1MY7A 5D7JA 1OVZA 2D31B 4NO2A 3X14B 1QFHA 1T21B 2HT3D 5LGJA 3E2HB 5DQ9B 3VXSE 1NCNA 5FB8B 5MEOA 1IAIM 1B4RA 2R1XB 2CLRA 4PRDA 3MJ7A 4JAMA 1MY5A 4OF3A 3QHZL 4X6FB 1E27B 4LF3B 1OSPH 5IMMA 4NJAL 3HE6B 3D85D 4M62L 3TYFA 3UO1H 5C0FA 5J6GB 4M43H 2X9WA 4LIQL 4D94A 5IB3A 4XNMB 1AIFA 1JWSB 4LVNB 3BGAA 2FDBP 4HLJA 5IQ7L 1F4XH 3BE1H 3O9WD 4FTVB 4NBYB 3HZMA 1XGQA 1T7YA 1U91B 4ZO7A 4HHAB 3PP4H 4R26L 3SPVA 1YEFH 5ICXA 2ED7A 2DI7A 3CH1B 2YRLA 3SOBH 1QBBA 3FB7A 2CIIA 2XICA 5ESAA 2AJVL 3DNKA 3NN8B 1YEEL 5H37H 2BVEA 2YWZA 5GGRB 2NY0B 4E41B 4L3EB 4NWTH 4MJ5B 4L4JA 4NQDB 1RZIB 3REWB 5ALCL 3IS1X 3RTQC 4I18C 3CVHA 3GMRA 1X5JA 5C0EB 2P43B 5DC0A 3QRFM 3WKML 2OYPA 1UT9A 3MJ9A 3V0AC 2AEPL 3IDMB 4GS7C 1AXTH 1WSST 4J4PA 5C0RH 1CGYA 5D72L 4B50A 3BESR 3M1BB 1NDGB 3O4OB 5L8JB 4HAGA 2VLKB 1FAIL 1GOFA 5FOBB 1UH2A 1KPVB 1RK1A 1O5DT 5D6CB 5B4MD 3MLYL 1N64L 3VH8B 5J12B 4PRAA 3BP5A 1SY6H 3MRMB 1CIUA 2VXTL 1U58A 4YDKL 3SKUD 4KKAC 4ZFOB 1YMHB 3FO9A 4LCYA 5C08D 4MMXC 4OV5B 3C2AL 1RQ5A 2VH5H 1G7LA 1R3IH 1UB5B 1RJYB 2BRRH 5FA3B 2L4OA 5TPWH 3FFCA 4L1HA 1SJEA 4JDZA 3A6OA 4URTB 1WTGT 3MRNB 2Y06L 1FYTA 5JW4M 3SQOH 4L29B 4WFHE 3MUY1 2MPAH 3CFIC 5I0ZA 1T83A 3I6GB 1G7HB 4OFKA 3D85B 3ISWA 4JREB 3ARGC 1YQVH 4TQEL 25C8H 4PBVC 2B0SL 3HC0A 3G04B 1PKQE 2Y1VA 2X89D 4GRLD 5L2JB 3ARFC 3O9WB 5GGVH 1TMCA 1X4YA 3G6JA 1C5DA 5E5MB 4LPUA 4XBEL 2G5BB 3JTSB 4JJHA 5KVFL 1SVCP 1A6PA 1E28A 4DW2H 3P4OA 2UWEE 2BXZA 4HKXB 1IC5L 2J8UF 2ADIB 1XCTB 5K9OB 2EIZB 3UYPA 4CJ1A 5IUSA 3IDXL 1HQRB 3L3GB 2FHBA 4U6XB 4QTIH 4MJIE 1NCDH 1ZHLB 3GJEA 1S5IH 3HCVA 4U6HA 4LCCC 4LBEA 4X8XA 1OGAE 4XTRC 1MCOL 4HIIA 3CSYA 2B1HH 3BZFB 5J56B 3VDAA 5BS0A 3G5VB 2I9LA 4Z5RA 5KOMC 3JXAA 1UJ3C 2PR4H 1FLRH 1W8NA 5CWSB 3MBED 1M05A 4F37K 4IOFC 4QXUH 4S1DC 5DRWB 1I3GL 4M4PA 1I7UA 4DEPB 2V9TA 1NC2A 4IRZL 4PGDA 2AXJA 5C08B 2W0KA 4UIMA 2CO7B 2WINB 2H6PA 5IHZA 1YN6A 3QNZA 6FABH 4DGYL 1HNGA 1U8LB 1IGMH 3QUYD 4JG1L 4WFHD 4Z7UA 3UAJD 3X11A 3GHBL 4JFOB 4ORZC 3U9UA 3SJVD 1S7SB 3LN5A 1F4WL 2DI9A 3VRIB 5MERA 3KYMB 4RIRA 4PRBA 1S7XB 4LGPB 5GGUB 3OKDB 4RISH 1SYSA 2APVA 1MCEA 3X14A 3MGOB 2JIXA 4TUJB 4Y4FC 3RGHA 1A3RH 2I5YH 1JNJA 2R1XA 4Y7MA 2XN9E 3BGMB 3Q1SL 1FFNB 2GW5A 2Q1EA 4GXVH 1QFWI 1LHZA 3OAUL 1FFOA 3PWPA 1E27A 4X6FA 5E0QA 5H94B 4GAGH 4NQSA 2EKJA 4GRLB 5J6GA 5F9OH 2LTQC 3GI9L 2JJSC 4AY0A 1M6OA 5HYJD 4M8VA 5E95B 5FYJH 3VXTA 4BK5A 4FTVA 5E4EB 4O58L 4K8RL 3PDOB 1YPZF 4MD0A 4HHAA 5FIEA 5E8OB 4MJID 4LMQE 2BY3A 5K59E 3KGRA 2FEDD 5KSBE 1OGAD 4H26A 4L9LB 5DJYB 5DYOB 2AJSH 2R0LH 3GSOA 5F44A 4LVHC 4M8QA 4FNLH 3C5JB 4ZUVB 2W0PA 4L3EA 5FYJD 5J6HA 4IRJC 4MJ5A 4NQDA 4L8BA 3TESA 3TC9A 3REWA 1CQYA 5CILH 4PJGB 2OZ4A 1GGCL 3FMGL 1T66D 2AERT 5HI4D 4KQ3L 3I6LD 2Q87A 1NGPH 1BD2E 4FXGB 4FFYL 1CL7L 3M1BA 4RX4A 3FQTB 3OF6D 2VLKA 5D71L 5DURD 5FV1L 2FH6A 3QUXD 1KPVA 2XQBL 4G6KH 5D6CA 1HI6B 4ZUWA 2VDMH 4PJFE 3MRMA 4D2NA 3MLZH 2BDNH 3TIEB 4MAUH 4AK1A 4PGBB 3CFBA 4K71C 4LLMB 4OV5A 4XPFH 3SGEI 3BPNC 3QUYB 1GIGL 3C8KB 1DLFH 4XWGH 2P45B 1QPXA 2GT9B 4PFEA 1OSZA 1L6ZA 4UT9H 5FA3A 3SJVB 4X9GA 4QY8B 3RHWF 4BZYA 2EYTB 2V9RA 4ONGL 3SDXE 5EO9B 5JW4R 4Z18A 2XN9D 3FB5B 4GKSA 1ZGLB 1H3UA 1JRHL 3E3QE 5C6TL 1LEKB 1PKQB 4AEIL 1KT2B 1PZ5B 2ZG3A 4L29A 4NC2B 3TPUE 1GC1L 1J1OH 1NCBH 5F9DC 5T1KA 3MGAA 4MVBD 5FM5O 5DJ2B 1ZLSL 2UVFA 1VSCA 4IDJL 1BP3B 3G04A 5F3BB 1IGJA 3DARA 1TIUA 1WT5A 4ONFL 5HYJB 2GJZA 4NO0A 3HC3H 4LVEA 2Y6SD 3QNYB 5CJOL 4C56D 4FA8A 1G7IA 1BHGA 4NN6C 3NGBC 5E5MA 4XBGB 4HMDA 4AH2B 3JTSA 4MJIB 3BSZL 4P57A 1R5WB 2E7MA 4XCCL 4R4FH 1K8IB 1OGAB 1S7QA 3JV5A 1WGOA 4HKXA 5DJXB 2DM7A 2ADIA 4OD2A 5EA0H 3SBWC 2PTTB 4JPIB 4OCSL 2LU3A 1S8DB 4WFGD 2ZCLH 1HQRA 4GUPB 3L3GA 5CUSH 1OHQA 4AIZA 5CEZE 3G6JF 2JJTA 5BXFB 1MAML 5IHLB 1Q72L 4HXAH 4UTBL 4ZNCD 2B5IC 1FVCB 3DO3A 3AB0B 5KS9E 3QUZC 3BEVA 1XAUA 1RSFA 4ACPA 4QXTB 2X70B 2KDGA 1J0ZA 2NQCA 3G5VA 2YD6A 5DURB 5F1SA 5D70H 3QUXB 1ZANL 1NGZB 2GK0B 5CWSA 12E8L 4JPKH 1MI5E 2AJUH 2LU4A 4GW1B 5DRWA 4F58H 2UY7A 4IJ3C 1OAUH 4JFHE 5E2JA 5C08A 4FQXA 1G0DA 2EZ0D 3D5OF 2O5XL 2VLLB 3JWDC 3QHFL 1HKLL 5KAQG 2P8PA 3P77B 4TVPH 5B39G 3CFCH 3VXSA 5GS0C 5I17A 4KAQL 4GLRI 2D7OA 2XN9B 2QQNL 1MFDL 1DL7H 2J88H 2E6QA 2JB5L 3VRIA 3KYMA 3TT3H 3NIDF 1SY6A 1S7XA 5JQ6L 2HN7A 3MGOA 1L6XA 2N56A 4PY8J 5JTWA 3QO1A 5KVDH 2ZG1A 5IGXL 3QJFB 4KKNA 1FFNA 3NIFF 3N06B 4TVPD 3VXUD 5CEZH 1TLKA 5H94A 4NZRH 3N9GH 2EIEA 4YDVB 3OMZA 1UVQB 3MFFA 3MMEB 1MRDL 4C56B 5F7UA 2DWEA 1JCKA 3ABZA 1CBVH 3I2CL 4H1LB 1R5IA 4P23A 3ULUL 2BSTA 1BFTA 3PDOA 3ULUF 5EPMB 4OF6A 5E6ID 1MJJB 2VN4A 4JY5L 3VFRB 2X5PA 4PGEB 1JF1A 3QEQE 2PO6D 4PLNC 1DVFD 1I9JH 1IGIH 2XWTB 1WIPA 1JPSL 2NZIA 3X12B 3PQYA 4XMKL 4IIQB 4U1GB 5ANME 4ZUUA 2PNDA 5A40E 3KPLA 5JNYA 3QNXB 3BIKB 1KBGL 1I8LA 3FZUD 2ADGB 4KK6C 1RUPL 1ZHKA 3OR6B 2E7BA 1F2QA 1MI5D 5A3ID 3C60C 4ZS7L 4P49A 4PJFB 1MRFH 5GZOD 2LQRA 4YFLF 1LO4L 5GGQH 4DQOH 1BGXL 2CLVB 4FXGA 2O5ZL 4JFHD 1X44A 2RR3A 1BJ1H 5I30H 1W0WB 4D9LH 4KHTH 1MRCL 1HWHB 4Z8FL 1XGYH 3TM6A 3VFTA 5HD8C 3T0XA 4BM7A 1HI6A 4LDLB 1IEAB 2Q6WB 3SDXB 2OZ4L 3EJJX 1CLYL 2B2XH 4G7VL 5GGRY 4X6DE 5DFVD 3WEXA 3C8KA 4D0BA 3T3MF 4HK0A 2QSCL 3MUHL 4XPAL 4QY8A 1FFPB 1AHWB 2EYTA 4IHOA 3QRGL 4XAKE 3D48R 3FB5A 3DTXB 1ZGLA 3WUZA 4N5UA 1LEKA 5IW1A 1UKQA 1YECL 1ZHBA 1MIMH 4YE4L 4F7PA 3E8UL 2FBOJ 3VXUB 2W9DH 1B4JL 5DRXB 2GK2A 3L95A 3RZCC 1JZ8A 2OK0H 2BHZA 4DTGH 1RUMH 2NX5E 5DHYA 1FV1B 2YKLH 1EEYB 4UB0L 2QQLH 2HKHL 5GGSA 5D1XD 1MFNA 2UWEA 3UJIH 3QNYA 1NL0H 3LH2L 1SJVA 3O45A 1OW0C 4WTXA 1H5BC 2OTUA 5ILTH 1F4YH 5IMOB 4HJGA 1YEDB 5E6IB 4MHHG 4AH2A 1ITCA 4MJIA 1HQ4B 4QHMB 2PO6B 3RWJB 3WXWL 1DVFB 3TT1H 4PBWD 4HF5L 3AY4A 5KS9B 5E08H 5LJYH 4NP4H 4HCRH 2FIKB 1YMME 2AJZA 4PJ5A 1S8DA 2EDTA 3QDJE 1H8SA 1UKSA 2WBJC 3TPKA 4WY7H 2C3VB 5BXFA 1NEUA 3GSRB 4Z7OE 4MS8D 1F02I 1MI5B 5LWYL 1L0XA 1OSPL 4OCWH 4WO4D 4L8DA 1N6UA 5H35B 4IMKA 5C92A 4Y2OA 1U6AH 3VA6A 5GRJH 4QXTA 3UO1L 2MMXA 2PN5A 5FO7A 4UDTB 1UXSA 3WLWC 1OARH 3QUXA 1F4XL 1NGZA 1HH6B 2GK0A 3BE1L 4IS6B 4WW2F 4DAGH 3TO4C 5FF6B 2DJSA 3FB6A 4MQXC 2IAMC 4LSTH 3PP4L 1YEFL 4Z76A 1WK0A 4XGZB 3SOBL 2DQUL 3EO0B 5C0NC 5J3HC 5KJRL 3DVGB 3QXAB 4V3EB 2V7NB 2VR4A 1WWBX 2V2TB 2P7TA 4NWTL 4KY1H 1A4KB 5D1ZC 2RFXB 1BOYA 1UADC 2XN9A 3C6SA 1Z5LA 4CW1B 3SKOA 5D9SB 2KZ1B 3R0NA 3RVUD 1W72A 3UPRA 2NX5D 3C5SA 4HC1H 2H2SD 4RGMC 5IEKB 1AXTL 4BK4A 3LQZA 5C0RL 4MVBA 1NFIB 4JQVC 5EC2B 3QJFA 1OP3H 4MLSA 5F21B 2C4FU 2O26U 4WI5A 3IFNH 1BBJA 1JZ2A 3VFSA 1B0RA 2F53E 5T1LD 1RZKC 2N1KA 2GAZB 2GTWB 3CFJA 1SY6L 1UVQA 5D1XB 3TBSB 5BCAA 3RWCA 1MAJA 2LABA 5KSBA 4MNQE 3GSXB 4I1NB 5DJAA 4P2QD 5IVXF 2VH5L 4X5XA 4LSDA 5ANMB 3RBSA 3S35H 1R3IL 1YMMD 3HNVH 2BRRL 5EPMA 3H9HB 2RHEA 5DD0H 1MJJA 3VFRA 4NQED 5TPWL 3FHQA 5L9DH 4NCDA 5F8RC 4RQQB 2XWTA 1P7KB 2QADC 3LKQB 3DMMB 3U7YH 4IIQA 1BD2A 4F9PA 3DYPA 3GSUA 4HBCH 3RWFB 3BH9A 1EXUB 3BIKA 1G1CA 4WO4B 3VFNB 3CCHB 1YQVL 1QBLL 3TBYB 25C8L 1VFOA 2Y07H 4PJFA 2PF6A 3FJTA 1Q94A 3GMQA 3IDNB 3WL9A 2CLVA 1T1WA 1YEGH 1CDCA 2XA8H 4ZTOH 1X6NA 3UJTH 3QXDB 5GGVL 1EPFA 3VXNB 4ZNEE 2VJXA 5A2JH 4ZUTA 4JZOB 1H0DB 1LK3H 2WLYA 1PQZB 4XCEB 1IEAA 3QEHA 1JI2A 5FCSH 3SDXA 2AK1L 2I07B 4Y2DC 5GGVY 4DW2L 3HPLB 3E3QA 4PBXA 5FDYA 2WMPA 5HHPB 3TPUA 1YNTA 3VXRE 4P46A 2BNQD 1IEHA 2VDPL 2RB8A 3RWHB 1ADQH 4QTIL 3U2SB 1NCDL 1S5IL 5HHXH 3BEWA 5AWNH 1CD1B 2NX5B 3DTXA 4NWUH 4S2SB 4KDTC 4OGZA 2DTMH 2B1HL 1VGKB 5DI8B 2F53D 5CEYA 1TITA 2J8UB 3EJZC 3NZ8A 1CICC 5GRYA 2HJKA 4NQCD 3BPLC 1A9BA 1NGXB 4MNQD 1FLRL 3NA9L 4HEME 4LGRB 5T1LB 5C71A 2MOVA 1JNNL 2P47B 4QXUL 1EEYA 2EYSB 3N50A 4F3FB 2VR5A 1E4KC 4K3JH 3IU4H 4WTZG 4AQOA 3KPSD 4LSRL 1OB1A 1MJ7H 2BNUA 4P2QB 3GHEH 2ICES 3MLSH 1YMMB 4PJEF 4Q74A 4K3GA 5IMOA 4CVXB 1ROWA 1IGML 1KCRH 1CIDA 1IM9D 2NXYC 3MRDB 4NQEB 1QQDA 3MCG1 1EUTA 2JK5B 1KXVC 5KS9A 1NQBA 3H9ZA 2BOCB 2Y23A 2CLZB 4RISL 2G5RA 5CJQH 2FIKA 2ID5A 4ZO6A 2X6MA 1FIGH 3PWNA 1A3RL 3O3EA 2H9GB 4FMKA 5C0JA 4GXVL 1Q0YL 4A2MA 1MI5A 4WUUD 3V7AE 4CMMA 4OGXH 4GAGL 5KSVA 5B39A 4FFZH 4X4YB 3PV6B 5FCUL 2Z93B 4X80H 4G8EB 4EN3A 5F9OL 1PJ9A 3HZVA 5ACLA 2NY6C 2BVQA 1MH5B 4KMQA 1WAAE 2NZ9C 2UYLB 3JV0A 1XF4B 4IS6A 2MQ3A 5EWIL 1DQJB 2WQ8A 3QH3B 3VXRD 1YYMH 4DN4H 3F12A 4HULB 3PHQA 3ERYA 4CUCA 1WFNA 3DSFH 3MO1B 5K93A 1DDHA 3EO0A 4PD4J 1TPXC 3DV4B 3SE4C 3QXAA 4OFIA 5ITFB 3CAFA 1G9NC 2V7NA 3ESVF 4KZEH 2AJSL 2R0LL 2VABB 3QIUD 4FNLL 3RI5F 1QLRA 5DXWA 4ETQB 3GKZA 2RFXA 3S7GA 3LQAC 1I1AD 3ZDZE 1AP2B 4PJCE 4F57L 5CILL 2F53B 4K9EH 1HH9B 1AY1H 5IEKA 2H8PA 1NGPL 3IDGA 4KMTH 3EYQD 3KPRE 3O6MH 4MNQB 1DR9A 1NBVH 3OG6B 5EC2A 4C58B 2R0WH 4N0CA 5E7FA 3DROB 1J88A 1A14H 1Z6JT 4G6KL 2YUZA 2VDML 2GTWA 4QTHA 1BJ8A 3RDTC 5D1XA 3TBSA 1DBBH 2IG2H 1W72L 3MLZL 2BDNL 3PGFH 3QEQA 5DC9B 3UTTE 3W9DA 4MDIB 3H6JA 3GBML 2DQIH 5C3TA 4XPFL 3GSXA 3O41B 1NGQH 1T89A 4XWGL 5ANMA 1IM9B 5IIEB 4GBXC 2BVUA 1VFUA 4CU8A 1OAZH 4XC3H 1HHGB 2HJLB 3NH7H 3RVTC 3ZLQC 1RZJH 4RQQA 5F6IB 1P7KA 4U7KA 5K33A 4D8PA 1KYOK 1SJXA 1I9RH 4AMKH 4J12A 3DMMA 1UWGH 1ZLWH 4WGWB 5KSBF 2HFFB 3RWFA 1J1OL 1NCBL 4MS8A 4WUUB 3WIHH 4HFWB 5ALBH 3VFNA 3F8UB 4R4ND 5DZNA 4LLWB 3IVKB 1FVDB 4BQCA 3EFDH 1DN2A 3B3IB 3HC3L 4X6DA 4LHUG 1FPTH 4XNXL 1IAIH 4FG6C 5TDNB 3IT8D 5HBBA 3QXDA 4BQ6A 3VXNA 4JKMA 3VXRB 4PREB 1OD7A 1ONQA 4WJ5A 3INUH 1MCFA 2E9IA 3TJHD 4XCEA 1PQZA 5KSAA 5IP4A 3GKWL 4ZPVA 4Q9CA 4R4FL 3WJLA 3TEUA 1G7JB 4Y5YB 5ABDE 2I07A 4OCYH 3T0VA 1XT5A 3F58H 3GSWB 5HHPA 3QIUB 5EA0L 2A1WL 4EI6B 3U6RB 4L3CB 3PGDB 4Q2ZA 2ZCLL 3SGKC 3C5ZD 1O0VA 3EFFB 2FGZA 5IF0B 3LV3B 1X5XA 2ICEB 7CGTA 4HXAL 1XZ0A 3GIVB 2NX5A 3TO2B 3VI3E 2FECL 2Z91B 1QTYT 2CMRL 2VDQH 4ONHA 3UTTD 3C87A 5D70L 2Y5EA 1QACA 4FFVC 5JQHC 1EGJH 1NGXA 1FRGH 3EHBD 4JPKL 5T1LA 3H9YA 3BKYH 1KC5H 2AJUL 1T1XA 5CMAB 4FZ8H 4NUJB 4RMQA 4EBQH 4F58L 3MXVH 4HIHB 7FABL 4F3FA 3CFEA 2IBGA 1PYWB 5IK3A 2VITB 1UH4A 3RIAF 4P99A 3CFCL 5DMGC 1F3RB 3QDJA 1WIUA 4IRSC 1O7VA 1X6LA 4LP4A 3I75B 1TVHB 1DL7L 2J88L 4GO6B 4MJ2A 4NKQB 3TBTB 3TT3L 4PJXE 5HDOA 4U7MA 1JYWA 2HVJA 4Z7NF 5I75B 2IPKB 1LMKA 2BOCA 1MELA 5DJ8B 5KVDL 3MZTA 1ES0A 2W9EH 3FQNA 4OQTH 1NFDF 5CEZL 3G6DH 3QIWC 1KF9B 3N9GL 3UTPD 4X4YA 3L5WB 1JN6B 2Z93A 4G8EA 4JKKA 3MR9B 3MNVA 2EH8H 2W60B 4U0RB 2VE6B 1MH5A 2BK8A 1N6QH 3PIQA 5DVNA 3ULVC 3H8NA 1CBVL 1FG2A 1H3VA 3VFGH 4DJMA 1DQJA 3QH3A 4H8WL 2OJEB 3D2UD 4QNPE 1RIUL 4V2CB 5GRVK 1RFDH 4CMHC 4CGTA 4MXVF 5JLZB 1U8NB 1I9JL 1IGIL 5L8KB 4Y4KC 4PUBH 4W70A 4YHKL 4YHZH 2VABA 5DVMA 3MNWA 4PJ8D 4GRMB 3PL6C 2VIRA 5ENWA 4PR5A 2EC9U 5DUPH 3OXSB 3RTQD 2F54D 1MRFL 3VMOA 5GGQL 4DQOL 3UTTB 5I1EH 4MNQA 1EJ6A 2V9QA 2HRPH 1HSBB 4KHTL 1Q9LA 4UNVA 2ADFH 1XGYL 2XWJB 3EOAB 3TH4T 1TZHA 3ZKNC 4MSWB 1A6AB 32C2B 2B2XL 5IOPB 3MRRA 1L0YA 1KIUA 3UBXB 4MDIA 3U0TB 4G9DA 1U95A 4KKAD 3TNNB 4LSVH 2BMKA 2PXYC 3EJYD 2ICWI 4N1CA 1S7UB 1IM9A 5IIEA 4B7IA 5EU5B 1EAPA 2Q8BH 4L4VE 4LLDB 4P3WA 2HJLA 3RNKB 4OZFG 3SKJL 3VWJC 3HMWH 4UQ3B 3EYSL 1EEUA 2GSIB 1AR2A 2WQRA 3CZFB 5AYQA 1MIML 4G6FD 1BJ1J 4YQXH 2W9DL 1IQDB 4I3GA 4ZNEA 1DBMH 4K3HA 2CKNA 1ED3A 2DJUA 4HV8B 2OK0L 1RUML 3ARGD 3BX7C 2YKLL 3QCUH 1DEDA 4NKOB 5I16B 1MIEH 1SHMA 4PDCE 2QQLL 3DUUA 5F70A 4JDTH 3ARFD 5CEXA 5SX4I 1FFRA 1NL0L 4JPVH 4EIGB 1BX2A 4NZTH 3D2UB 4PREA 3VXRA 1B6UA 4F33B 3LPFA 5ILTL 3A6BH 1ZVSA 1BZ9A 3EOYG 4MXQA 5B8CA 2YR3A 2COQA 3TT1L 1G7JA 4X7FC 4Y5YA 5A2IH 1IZJA 1TJGH 4YLQT 2SEBB 5E08L 1B0WA 4PJ8B 3Q48A 4NP4L 4OZFH 3U6RA 2P49B 1JGUL 3QCTH 4WTZA 4YNYA 3LV3A 1EFQA 5TFSH 4WY7L 1YY9C 2OXGA 3RTQB 4ZXBD 4I18B 3VFVB 4EKXA 2F54B 4JFQA 4OCWL 1KTDA 4XTRD 1K5NA 2Z91A 5J1SC 1H3PH 4OBSA 5D7IE 3GMOB 1OARL 3STLA 2BSRB 3V6ZB 4DAGL 1WCBB 2PTVA 1QSFE 4JFED 4CKVX 5CMAA 4LSTL 1CK0H 4IOFD 4NJ9H 4HIHA 3HE7D 1AI1H 1FCCA 4L4VD 4Y19E 1B0GB 1PYWA 5K9KB 1AD0B 1KLUB 3IETB 1BF2A 3B9EA 1FZOB 1S7VB 1DE4B 5ACZB 3O8XD 4WW2B 1L7IH 5HDBF 3DOSA 3S9DB 4KY1L 5BZWB 4P2RE 1TVHA 2HKFH 4Y5VB 5T5NF 1FNEA 4OAWA 2XY2A 3RZWA 3MV7A 2HT2D 4G6FB 4DZ8B 5DEGA 3RP1A 2FLBT 4GXUM 2C5DC 1WAAA 1SEBB 1T4KB 4JO2H 5JPNA 3TVMC 3D87B 3ARGB 1KJ3H 4M9OA 3IFNL 3T0AA 3L5WA 1BLNB 3QXTA 3Q6FA 1EUUA 3ARFB 3EIFA 1WFUA 5FA4B 1A21A 1HIMH 2H3NB 3PE9A 1QSZA 4HFUH 1T5XA 1JFQH 2YD8A 2PW1B 5FYKU 4WNQA 3TJHA 5I1KL 1XF3B 2VAAB 3CSBA 3R8QA 1BZQK 3HNVL 3WIHA 3KWWA 5E00B 2AXFB 4NQTA 1OP5H 2OP4H 4O00A 4PJCA 4YPJA 5L9DL 4XAWH 4L5FL 3RUGF 1U8NA 3DWTA 5JZ7C 4ISVB 1U3HC 4L3AA 4HZLA 1N7MH 3U7YL 4D3CL 3NFSH 4HBCL 2YXFA 3GGWA 3KPRA 2VTFA 4GRMA 4AEEA 4RFOH 4ZXBB 3RU8H 2ZJSH 3ARDA 4CNIB 1YY8A 2YA0A 4YBLC 4G3YH 1JPTH 4M1GH 1QSFD 5HHOE 2Y07L 5DJDA 4JDVB 3RVWD 3S35X 3UTTA 1YEGL 2EDBA 4M7JL 2RBLA 3UJTL 4ZTOL 4Y19D 1R24A 3ZE0E 3O3AB 4OZFB 4MNGB 5BRZE 3I02B 4JFEB 3ZYZA 1F4AA 3D18B 1GGUA 3IDYB 3CXDL 4LQFH 1LK3L 3OKMB 4DVRH 4OZ4B 4L4VB 3N1PC 1UWEH 2ZOLB 4X9BA 5IOPA 1EHXA 3MRIB 4X9IA 3D6GA 3UBXA 1TVBB 1LP9F 3B8YA 3QFDA 4HS8H 3QAZC 1R0AH 1S7UA 1EGJA 4QXGH 2R2HB 1ADQL 4KK8C 4LHUA 1NKOA 5T33H 2LVCA 5HHXL 5DT1H 5AWNL 1F8TH 4NWUL 1MFEH 3K74B 4UQ3A 3B2UC 2DTML 1RD6A 5HXMA 1SMAA 2X4TA 4OI8A 4G6JH 2G60H 3CZFA 2AGJH 2EE9A 4EDWH 3D69B 4HJJL 5EZIH 5C09E 3WHXB 1EX0A 4WW1A 3UZEA 2OTPA 3MV01 1FDLH 3KS0H 2BC4B 1F6LL 4XHJC 5I16A 2K9UA 4Q6IA 4BH7A 3IU4L 2VZUA 1ZLUK 2GFBB 2VDNH 5CSZB 3IU3B 1MJ7L 4MCZA 5TE4H 3GHEL 3ARWA 5BVPH 2EDHA 3MLSL 4K07A 4F33A 4U1KB 4OQTA 1AXIB 3DRQB 1KCRL 2NNAA 1MLBA 3FO0H 4I3SL 43CAA 3JV6B 3ZE2E 1U92B 3MRGB 3HPJA 3HUJB 2SEBA 1JNLH 4OJFH 4JFDE 5CJQL 4BZ2L 3Q3GA 4BFIB 1M7DB 3MV8D 3VCLB 3N0PB 3SDDA 4X6CF 1EO8H 4LCUB 2KBGA 2O61B 1T1ZA 3RTQA 3VFVA 4I18A 3BZEA 1QSFB 1TTGA 2B4CH 1ZXQA 1V7MH 4X80L 3QUZD 1N8ZA 5F89B 1FGNH 3I3BA 2QSTA 4Y19B 1UA6H 5D7KE 5GS0H 5E9DE 3GMOA 3VGAC 3V6ZA 1WCBA 2FATH 1UM5H 2F58H 3RNQA 1A64A 1YYML 1UEMA 4DN4L 5JW5B 4NRZA 1TNNA 4HUWA 2ZWLT 3P0VH 4JM2C 1B0GA 1I7TB 4O9HH 3HRPA 4Y16C 5K9KA 4K71B 4NOBA 1KLUA 2UVEA 4NZJA 1JHKL 4PJXA 1JTOA 1FZOA 1S7VA 3MRPA 1U8IA 3BPNB 4D0CB 5C8JA 4KZEL 3KVQA 1DE4A 5JORB 3L3JA 3D0VA 4U1SA 2NY1C 1T04B 5DO2D 3NCMA 1FBIH 4K2UL 5GS0D 2ZUUA 5BZWA 3QULB 4K7PX 5DD6B 4M1DH 1ZVYA 3MLWL 4K9EL 1CE1H 1AGDA 1A22B 2KQMA 4XWOD 4FFWC 1AY1L 2D4FA 1CGTA 2BVOB 2AV1B 4KU1A 3O6ML 3OJMB 1NBVL 4MB5A 2R0WL 1MHHA 2HWZH 3ARGA 3BHBA 1A14L 4UU9B 3BD4A 1DBBL 2IG2L 5FA4A 1E0OB 1KJVB 1JHLH 4KXZI 2YOCA 2ZNXA 2Q3AA 4QO1A 5TE7H 3GMPA 3I3DA 2DQIL 2D0GA 4N0YL 1IC1A 3NGBB 1I7ZB 4J3UA 3ZDYF 4JFDD 5E2WH 5LQBH 4TUKH 3SY0A 3VRLE 4XC3L 3HR6A 3NH7L 3QZWB 1HYSC 1ETZB 1RZJL 4P4KC 4AMKL 1I9RL 1UWGL 3MV8B 3MLPA 4LKCA 4WFED 5L8LB 2YA2A 5IVOA 1ZAGA 1JBJA 5BRZB 1LO5A 1AGBA 4LCCA 3WIHL 5HDQL 4FQIH 2OSLB 1EMTH 5ALBL 4CNIA 3RWEB 4CADB 3VGBA 4KK6D 4OBRA 3QUZB 2DBLH 3U0WL 4HGWB 4QRSB 5E1HB 1OGTA 4JDVA 3C60D 5HPOA 3EFDL 3EZ8A 3U0PB 5I19H 1FPTL 1IAIL 4WHCA 4OZFA 5JUEH 1UJ3A 3GJFH 1EZVY 1CZ8H 1T7WA 3D18A 3WFHB 4XP9H 2AEWA 3INUL 2VKXA 5HD8D 5KANI 1MFBH 3OKMA 4IJ3B 4L4VA 3S36H 2ZOLA 3T0BA 3MRIA 1VCAA 3PWLB 1TVBA 4OCYL 2VL5B 4JFYB 3FO1B 3F58L 2GJ6D 1OF2B 1EZVX 4JO4L 2P8LA 5HVGB 3BFOA 2WWKO 3GI8H 2HTLC 3WIIH 1HDMA 2R2HA 3OJDB 4X7TB 5DHXB 3GZKA 1J7VR 4ZMAT 4DZBB 3L6FA 4F37F 2CKBH 4TNVK 3GUTB 4GMTH 3K1DA 3IKCA 4Y4FA 4Z7VE 2VDQL 4YXKH 2HAZA 1AGFB 4NN5C 1EGJL 1FRGL 5I1HH 2ATKA 2GSGA 5EBWB 3BKYL 2BC4A 5HJ3A 4FZ8L 4EBQL 2ARJB 3MXVL 4LRNH 2JJSA 2E3VA 1LO2L 3NVQA 2Q86B 4WV1A 1EV2E 4U2ZA 4ZOEA 5CSZA 1INDH 1MCIA 3FKUS 2IH3A 4JFDB 2XZCH 2DYPA 4HH9A 1JRHI 2AW2A 2DDQL 4U1KA 5GJSH 1R3JB 4QRRE 3MRJA 1CU4H 5IVZB 1T7ZA 4X98B 4U1HA 5F7WC 2AEIT 3MRGA 4WDIB 3IB4A 1D5ZB 2DLGA 4U1NB 4P3DB 1D5XB 4BFIA 3VCLA 1NC4D 5D7IA 5E9DB 4IRJA 2W9EL 4OQTL 5IROC 5IFJB 4AT6B 3B5GA 3G6DL 2I27N 2KKQA 1QSFA 3DETC 3C60B 5IESH 1S5HB 4P9HH 3DURB 4NDMA 3LSOB 2EH8L 4Y19A 3AS3A 1FFQA 3BW9A 4XMPL 1F45A 4KKBC 1TJHH 1N6QL 2UZYB 5C6WH 5KVMC 4XRCB 3VFGL 3WLWD 3EGSB 3QG7H 4NPYB 3TV3H 3TO4D 1NFDB 1G0XA 3PGCB 3TBWB 4Q9QH 3RL1A 5F7YC 5JDSB 4P2RA 2OTWA 1GHFH 2EC9T 3IFLL 4NFCA 2A9NH 3R06A 1RFDL 2R1YA 2GJ6B 2HVKA 5FUZH 5C0ND 2IWGA 5CCKH 5J3HD 5FECA 3O4OC 2BCKA 5E24E 4PUBL 4YHZL 3IXAB 4G80B 3BWUC 4A2LA 1BPVA 1T04A 1J1PL 4M61B 4QLRA 5E8EA 1OT2A 1RZKH 1UM4L 5D1ZD 3MRBB 2X4PB 4GOSA 4L4TD 5DUPL 3QUMA 1QFWL 5L88H 1JYVA 4U33A 4I0PC 1G7PB 2F8XC 3KR3H 5HVHC 1WFTA 5HGBB 1JV5A 2BVOA 3KAAA 2AV1A 3QWRA 3OAZH 3QJHB 3OXRB 1Q9OA 1VACA 1IBGL 2APWA 4XB7A 2HRPL 1UWXK 3V5HA 2ADFL 4QRQA 3VJ6A 3WFBH 2JCCF 4UU9A 1NGYB 4UI2A 4F7EB 4WFFD 4HWNA 4LFHG 2X44D 4FMFA 1YEJH 1AFVH 2CDEA 1DANT 2D0FA 1H5BB 4LSVL 3F7RA 1KB9J 1DUZA 5JXEC 2W0FA 2E9JA 1KTRL 3OB0K 1KJ2H 4JREC 4Y4HD 2MQCA 2Q8BL 2YN3A 3WD5L 3JTCA 4O4YH 3HMWL 5TE6H 1KPRB 5HHOA 3O9WC 5FGCB 1J05B 3G5YB 1NC4B 2QADD 1XEDA 2FBJL 4WENB 4YQXL 1T0MA 2GJJA 1ZE3C 3MBXL 5BRZA 1MCPH 1CLOH 3PWUB 1MCWW 4LLVB 1J87A 1NEZG 1MIEL 3QEGH 1S7RB 1UQSB 1LEGB 3WFZA 5IB2B 4LLQB 2UUDK 4JDTL 3U0PA 1WBYB 5ERWA 3FRUB 2BSSA 4TTGA 4XP6H 3TO4B 4JPVL 2H2PC 5TH2A 5BW7C 1WEJL 2VMFA 4XCFH 3A6BL 2EE3A 4JCMA 3AFLA 3S37L 4MQSB 1EAJA 3PWLA 4PJDE 4JFYA 2X4OB 4LEOB 3UCRA 4Y2DD 4YX2H 3ARED 5E8PB 5D1QD 4UOJA 2WW8A 4Z7VB 3AXLB 5B4MC 5CBAB 5IB1B 5D1ZB 3QCTL 5C09A 3PJSB 4MDJB 4X7TA 5TFSL 4G8GA 3JSSA 4L4TB 5EOCH 1GGTA 2EE2A 1U2HA 5DS8A 4BKLA 3MOQA 3OX8B 1JNHB 2EICA 4PJBE 3GUTA 4JO3L 4RGMB 3SKMB 3VFWA 3S88H 3CC5A 1DLHB 3DX9B 3EJZD 1FVEA 1H3PL 1CICD 5FKPB 4C83A 1NSNL 5JOPD 4TNWK 3FTGB 4NQVB 3KPQA 1KJMB 5JA9A 1CDUA 2Q86A 3TIDB 1LK2B 4YDIH 1RV6X 3GB7B 3PHOB 5LG1A 5HDLA 3ZE1E 1CYGA 2AQ1A 4JFDA 1L7IL 2ZUQC 4Y4HB 1Y6NR 1X5AA 3NCBB 4J3VA 5CJ8A 3RGVC 1R3JA 3HMXH 3VGHA 1T0NB 2NR6C 4PYGA 2HKFL 1FZKB 5IVZA 4GRLC 1F90H 4EJ1C 4X98A 4P3CL 2X1PA 4WDIA 4FZEH 1DJSA 2QADB 1EEZA 4WU5B 4BH8A 5E4EC 5BO1H 5E9DA 2Q76A 2XQYG 4JO2L 5C0GB 1WZ1H 1KJ2B 3PNWA 3MRQB 3P9LB 1KJ3L 4PB9H 3WUWG 3LEXB 5CIPH 3OKKB 4NNYB 3IDUA 3C60A 4EI5A 4MA3B 1CGWA 2J1KA 3K4DA 2M1KA 1G9NH 4L9LC 3M8OH 3VMPA 1HIML 1TQBB 3G5ZA 3WBDA 4HFUL 2NZ9D 1VERA 1JFQL 2AV7A 3LQAH 3KPNB 3PGCA 4BA8A 1ZHNB 1SYVA 4MXWH 1CFVH 2QHRH 4PRPD 2CUHA 2OP4L 4Y2DB 2GCYB 3AREB 3D0LB 4N8CH 4XAWL 1F6AB 5D1QB 5JIKA 4U4BA 5HGGS 1N7ML 3MBEC 1A6ZB 4JFPA 3IXAA 3IFOA 3NFSL 3GJFA 2GTZB 4H0GA 4M61A 1KCVH 5EU6E 1JJUA 2GYSA 3RU8L 5DEFB 1I1FB 2ZJSL 2X4PA 1XR9A 1JPTL 1A7RL 2DLEA 4M1GL 1G7PA 4GW5B 2P5ED 1QBML 2PYEA 3RUGB 4M93B 4RA3A 4XMLH 1S78C 5HGBA 1CICB 4G9FE 1ZTXL 4HUMB 5I2IB 3BPLB 4JG0H 3RZCA 3OXRA 1OPGH 3OKOA 4LQFL 1DBKH 1XIWC 4DVRL 3QUML 4HUUB 1UWEL 2CKBA 2CSPA 3ROLB 3RDTD 4RMTA 43C9A 1ZMYA 4HS8L 2D9QB 3FAWA 1OW0A 2J12B 1H5BA 2FX8H 1G0YR 1PSKH 1YNLH 3GMLB 4X0KA 4QXGL 4XNYH 3BQUD 4GBXD 4GQPH 2MQ0A 2G75B 4GKZB 3LKPA 5DT1L 3FOLA 1FNGB 3STZB 1F8TL 1MFEL 1KPRA 3SDAC 2PKDA 5TQ0H 1LP9B 2CIKB 3NCCB 4P2CG 1J05A 4G6JL 2G60L 2AGJL 1FL5B 4EDWL 2HJFB 2WBJA 3GEWB 4NUGH 5EZIL 5E8DH 2IALB 4YBQD 3LN4B 1CCZA 1FDLL 4LLVA 1G9MC 3ALPA 5KN5B 1TETH 5D96C 3Q6GL 1FN4B 4HIEB 3CUPB 4QHLA 4PJDB 2VDNL 2ZKHL 3A0OA 1UYWH 2LAGB 5TE4L 5HYEA 5BVPL 5FGBC 4PY7B 3ME0A 4OUUB 2IAMA 5D93B 4KPHH 4FFEX 4PRPB 2PCPB 5HI4C 4KK9D 5DDHB 1RZFH 5EU6D 1NAMH 5CIPB 3FO0L 1TPXB 5T3ZE 4O2EB 3U1SH 4LHQB 4PJBB 3ULVE 2X4OA 4LEOA 1IKNC 4RGNE 5IG7B 4RGOH 1JNLL 1ZVHA 2IPTH 4OJFL 1DEEB 3RL2B 4Z7VA 1NLDH 5CBAA 3IF1A 4X7SH 2D7PA 3LPWA 1PD6A 3KS0J 3IDIA 1KEGH 2P5EB 1I3RB 3EOTH 3K7UA 1FSKB 1DQQB 1QZ1A 1JNHA 1V7ML 2DS4A 2YRPA 3JBG7 5FDWB 3F6LA 1MHEB 2FIRT 3HRZA 3JWDL 3SKMA 1FGNL 1UA6L 3DX9A 1HHJB 4JQVA 5GS0L 1H3WM 1QVOB 1QOKA 4FFVD 1W0YT 4X6CB 2FATL 1UM5L 2F58L 5FKAB 4ZPTB 3S34H 1QFUH 3TGXA 3BPCA 4KI5F 3HA0A 3RDTB 4NQVA 3QHTC 3RVVC 4QRRA 3O2DH 1KJMA 1A6WH 2MHAA 3OAYH 3U46B 4HUVB 1C12B 2FH8A 4O9HL 1CF8H 3WUWB 4BSVB 3WMSA 1RZGA 3BQUB 4GBXB 4NKIH 5DMGD 5EUOE 3KYKH 5D2LE 4OM1H 2DL9A 1ND0B 5D7SH 2V2XA 2Z31C 3D25B 5KG9B 4M1DL 4D0DA 5F7MC 2P1YA 1CE1L 1GPOH 4WU5A 1I8IB 3ULVH 4PP2B 3QWOB 1OTTC 5DHVH 2YEZA 2EKSA 3P9LA 3QIWD 3U83A 2HA1A 2P8MB 3OKKA 4PLOB 4MA3A 4R7DB 4UV4H 5FYKE 2YPVL 1CWVA 4YK4C 1DCLA 3F7PC 4PG2C 2FR4B 1HXMA 3M07A 5TE7L 4PJIE 4U1GC 5JW3H 5MEPA 1AH1A 2F9BT 2EEBA 5F1NA 4F9LC 5ID0A 3ULVD 5EBGA 4KV5F 3KPNA 3S5LG 3QDGA 4JY4B 2WK2A 5EU6B 5LQBL 1FAKT 5H2BA 5E2VH 1IQWH 5F9JB 1KTLB 2GCYA 4E5XB 4ZUSB 2P5WA 2FGWH 1RIVL 4Y4KD 1WBXA 1XCQA 4ZSOB 1OTSC 2GTZA 5FYJU 5DUMH 4C4KO 1TDQA 2VRAA 3MLRH 4FQ1L 3BZDA 3OKLB 4MX7B 4P59H 5HPMA 2CRYA 1H3GA 4KDTA 3I6KB 2J7LA 2VNCA 4M48H 1NAMB 4GW5A 1C8PA 3VXQA 3B5HA 3T65B 4E9LA 5B3JF 3ZTJG 3HS0A 4K3EH 5JUEL 1LE5B 1CZ8L 1D9KD 3AS2A 1AHWC 5TDPB 1CLZH 1ITBB 3O0RH 1MFBL 3P4NB 3BP6A 4L8SC 4BYHA 4HUUA 1E4KA 3S36L 3ZKND 4KRPC 3DX8B 3H7BB 4X6EB 1CR9L 2A83A 3O4LE 5FYKH 1EHAA 1JZ7A 4KTDH 3AU1A 1J0JA 5DMJB 1NEZA 4KDVA 4UILL 2PXYD 4HS6B 3GMLA 3GI8L 3UEZA 1AKJD 3WIIL 5D5ME 3FHAA 4R96B 4LSUH 4MMZC 4ODWB 3U30C 5BOZG 3N1GC 1Z3GH 2G75A 1IVLA 4PD4K 3WSQH 4GG6E 2CKBL 4NRYA 3GM0A 3VWJD 3DI2B 3WFEH 4NM4H 1ZOXA 2CIKA 3B43A 4RAUB 3TA3C 1FL5A 1MUJB 2F15A 2WNGA 3RPKA 2A9MH 1H8NA 4WIQA 5EN2B 3VFPB 4EVNA 3QIWB 5I1HL 1S9XA 1BQSA 3LN4A 2PO6C 5KN5A 5C0DA 3B9AA 2OI9B 1PEZA 4PJAF 3JV4B 1T2QH 4HIEA 5DK3A 4PJDA 2DI8A 1VFBA 4M6NH 2V5YA 2B7DT 1CFTB 4PY7A 5HHNB 3FZUC 2Z8VC 5DHVB 3VE0B 4NKMB 4OUUA 1FZJA 3O2VH 5A3IC 2PCPA 4HX1B 1JE6A 3X13A 4GRWE 1CTNA 4N5EA 1CU4L 3E6HA 4N0FA 4CMHB 4QHUB 3WS3A 1X5FA 4PJBA 4Q6YA 4Y4KB 4JKLA 5IG7A 1JYNA 5I73B 4JHBA 3PV7A 4NFDA 4XBPB 1NAKH 5DJCB 5C07D 4MA7L 3OGCA 4OZIE 5JOFA 4V1DE 1YY9D 1VGEH 2VERN 2Z9TA 1I3RA 3NZHH 3FT3B 5JIIA 5DFWH 5IESL 5DFVC 3CSGA 3BKCH 4YHNA 3LN9A 3BUYB 4NO3B 3WNMA 1J86A 1KENL 2R39A 4JY6B 4PTUB 5DZOA 1IGFL 3WNNA 1TJHL 2OQJB 4TSCH 1BFOB 5T1MB 3W5NA 5FKAA 3TV3L 4Q9QL 1G7QB 4ELME 3B9KD 2XZAH 4UDUA 5D2LB 3RDTA 4JHAH 1GHFL 1BQUA 2AQ3A 4N9OB 3U46A 4K7FB 5E8NA 3GO1H 4Z7WE 5FUZL 5LKNA 1I4FA 1N59B 1RJZA 3WUWA 2PXYB 3JUYA 3H7LA 4PJHE 4EQ3A 4ZAKD 1AKJB 3QEUA 5HY9B 4I9WE 4JRYE 1R5VB 1U8KA 4HMEA 1RZKL 1ND0A 3WFCL 1K6QH 3D25A 5KG9A 5EORH 3VWJB 5IJVB 2CO6B 5L88L 2XKNB 4ZTPH 3S5LB 2MTPA 3KR3L 4LPTA 1I8IA 2XV6B 4PP2A 2ITDB 3QWOA 2VLME 5HGDA 5DMYA 1E4XH 4HXBH 4N0RA 4S0UC 2ITCB 3A67H 3CDFA 4Z78B 3TVMD 4XVJH 3W9EB 1DZBA 2IBZY 3QCVH 2Y36H 3GBNH 3WFBL 4PGCB 3TCXA 3I3EA 3BD5A 2C3WA 3O11B 1R3KA 4TTDC 4R7DA 2FR4A 3FO2B 1IGYB 1ZA6A 2NY5C 1YEJL 1AFVL 1L7TL 1ZEAH 3IS0X 2IC2A 4BUGA 4WO4C 4JY4A 5HYIA 2DTSA 1LGVA 5EU6A 2EO1A 4M5YH 2ZOKA 3LS4H 3SHSA 5F71A 4M6OL 1XR8A 5B38B 4O4YL 1KTLA 1Y6KR 4M7KH 1A7BA 4ZUSA 1P1ZA 1IAMA 5IM7B 5TE6L 4XP4H 1U8PA 5JZ7D 1U3HD 4G9FA 4I5BB 5C07B 3IFPB 8FABB 3SGKA 1MF2H 3ARQA 3S98A 5CSGA 4EUPG 3OKYA 4DKFH 3RWGB 1MCPL 2ICWA 5I8CA 1CLOL 3WDHA 2QLVB 3F5WB 1LNUA 3I6KA 3UPCA 3PABB 3V0VB 4DFIA 1FZMA 2DM2A 2OR7A 3QEGL 4QEGA 4X8JA 1FLTX 3GSNH 5DF0A 4J3WA 5AAWA 5HGHB 4LCWD 4XP6L 1Y0LA 3HZYB 5J1TC 3MRCA 5TDPA 5D5MB 3O2WH 2YPKB 4GAJH 3RVUC 4YFDB 2H2SC 5BMFL 4JRYD 3VFMB 1JMXA 1SEQH 1KOAA 2BHYA 3C09B 4CVZA 4ZAKB 2EYRA 5GIRB 4CN4A 4YX2L 2ZCHH 3FQXB 5FM8A 4P9MH 4IRSA 1N3NB 1ACZA 2OM5A 4X9HA 3L3OB 4R96A 3DO7B 1WWCA 2ARJQ 5EOCL 3PXJA 5GXBB 5ICYB 3CLEH 5EG6C 1JHTB 3MNZB 3O2DA 1UKTA 2B1AL 3B2UD 4RAUA 3UYRL 3S88L 4L1DA 5SX5H 5TGBB 3KPPA 4DK6A 5EC1B 5EN2A 3VFPA 3TVMB 2DAVA 1NGWA 5CINH 2QL1A 4G7YH 1QG3A 4NSKB 1ORQA 1ZK9A 1J18A 5T3XE 3CVIH 2OL3H 3DX7A 4XHJD 4LRIC 4N8VB 3SE8H 3JV4A 4IOSD 4YDIL 4RRPG 3H42H 1CFTA 2BOBB 4V2BA 3PP3K 5DHVA 3VE0A 5HI5C 2VXVH 1GZQA 3ARBA 1YQ2A 3TFKC 4HX1A 4LU5H 4RA0C 2R8SH 5EOCJ 4OZIB 1KIQB 1KXQE 5IW6B 2W0LA 1F90L 1ZS8A 4QHUA 2P24B 3M17B 5GZNC 2MKLC 2F8OA 2EDRA 1RUKH 1U3HB 3NA4A 4FZEL 4M5ZH 3WCYA 4MA8H 5MP6H 4D9RE 5HSFA 2AJXH 3QDME 5C3LD 3EYVB 4XBPA 1MCRA 3OBAA 4J1UA 5CJXC 5EFIA 5BO1L 1A1OA 4F7MB 3PL6A 5FM4A 1IAOA 1OQXA 2FEEI 4YBLB 4PB9L 4QCIA 3GMNA 3C6LC 4ELMB 4F7CB 3UTSE 3IGAA 3DRTB 3KYOB 3MV11 4NO3A 1AE6H 1G9NL 2YC1A 3OTTA 3M8OL 4JY6A 4LCWB 4Z7WB 5L2KE 2ERJB 2OQJA 1SVZA 4NHCL 5IW3A 1MOEA 3IXTA 3VWKA 3WNLA 5T1MA 3LQAL 5LBSH 3SE3C 2WP3T 5EUOA 4JRYB 1G7QA 1RURH 3MLTB 4JGUA 4MXWL 4QGTA 5T3XH 1CFVL 4I48B 1JGVH 3AAZB 4JM2D 4K7FA 3T77B 3DIFA 1MJUH 4N8CL 4EOWH 3QAZB 1CGXA 2PXYA 2X4RB 3OKEB 3KJ4C 3T4AB 1KCVL 4APQC 1JWMA 5IJVA 4CJ0A 4RCAA 3T1FB 4OZGB 3D1MC 5DJ0B 1JGDB 3S5LA 1U2CA 2VDOL 3PWJB 5SWZE 2AAVA 4XMLL 3GRWH 5EO1B 5A16B 3JTTA 4PJIA 4JG0L 2ITCA 4PGZA 4XNUH 2YRZA 2YXMA 2ESVE 4Z78A 1IKFH 1OY3B 2YSSA 1H15B 2CGRH 1VFAA 2XZQH 4I4WB 4PGCA 3O81A 1DBKL 2X4NB 4HK3J 3RKDC 3U36B 4OT1H 4KJPC 5EU3B 2Q7NA 4K94C 5CFHA 2WBWB 5DK2A 3FO2A 3FQUA 2XWBB 5IHUH 1KEMH 5DEZA 3U4EA 4J4PC 2BP3A 1PSKL 1CXFA 3QDMD 1FNAA 3EOBB 4XNYL 3SDCD 2BX5A 1QO3A 2E7LC 4X6BB 1JFMA 1HYSD 2OL3B 3QBTB 2EDXA 5I1DB 4KI5D 4LL9A 5IM7A 1A5FH 2R2BB 1A3QA 5TQ0L 5IMLB 3UTSD 1XGUA 5CJBA 3IFPA 1BAFH 2CK2A 4OCLC 1WLHA 5J57B 3MV9D 3ECBA 5E6YA 4NUGL 5E8DL 1WJ3A 5CS7A 3ZKMC 2BY1A 3RWGA 4R4BB 1KG0B 4N0UE 2EDKA 3W39B 3F5WA 1E4WL 5J11C 1IGCH 1NDMB 5C2UB 5FYLE 1TETL 3V0VA 3CDGB 1E6OH 5IJKA 2FHFA 3NMEA 3IKKA 3O4LA 1UJTA 4FABL 4HG4J 3NPSC 5HGHA 3VGAB 4X4ME 2XTJD 1I1AC 3EW3B 4FXKB 5FGRA 5T1DH 35C8H 3HZYA 3QUKB 1B2WH 2H32H 4WEMB 5E5RB 5D5MA 4HIXH 4JM2B 1RZFL 1P7QD 2AKRB 3FCTB 3VXPA 4X7DC 3U1SL 4E41E 4F80A 3HR5A 4GG6A 1T7VA 5EIQA 4RGOL 1QA9B 1XGPB 1P4LA 1N3NA 1NLDL 5IBUB 4X7SL 1JUFA 1CD0A 3P30L 1S7TA 3V6BR 4Y88A 3DO7A 5CGYD 1QBAA 5DJ6B 5ICYA 4OFPA 4X5LA 1JHTA 5EZLB 1KEGL 4Q0XH 1M71A 2V5SA 1UACH 4TRPH 5CD5D 3HI1B 4RMVA 3LVEA 3RQ3A 4YXHL 4YHIB 4XP5H 4G42B 2H41A 4ODTH 5TGBA 1OP3K 2C4XA 3TVMA 4XC1H 1FNHA 5AG8A 4HUKB 2GIYA 1MCSA 4NSKA 3S34L 1QFUL 3KJ6H 4XVTL 2VXSH 3TNMB 1LWRA 2HFGL 4O2CB 4WHTA 3O2DL 1RY7B 4N8VA 5FYLH 5KSUA 3VI4F 5ADPH 5I75C 4KUZL 4S1RL 1IARB 3VH8G 1RJLB 4X7CC 2CH8A 3QDMB 3WJJC 3SDCB 4NKIL 5ECJE 1J1XH 4NGHL 2Z0BA 4PJ9D 3KYKL 3S96B 2E9WA 5D7SL 5IW6A 4V1DA 4TSBL 4QRTB 3TCLB 3H0TA 4N8PA 1QYGH 3UTSB 4P4KB 1GPOL 3L7FB 2VOTA 4JGMA 1LO3H 3ULVL 1QRNE 5FYLD 1VENA 3MV9B 4U1IB 3WLBB 2DQHH 4QWWC 2L7JA 1I8MB 1C5BH 3HTLX 5D7LE 1TTFA 4HLZG 4YHPB 1XH3A 4ELMA 4F7CA 3RY6C 3DETD 1DQLH 1WC7A 2X7LB 1F3JA 3KYOA 4UV4L 2XACC 4U49A 4XXCC 1OLLA 4Z7WA 3C5ZC 3CH8A 3DV6A 5KTEH 5JW3L 3L3HA 4KKBD 3ZO0A 4G6AD 4OIIH 4PJHA 3ULSB 3ULUC 3HNTH 4B0MM 4LPCA 4JRYA 1P7QB 2F74B 3UP1A 5E2VL 5IB4B 1IQWL 2DQGH 2D7QA 3OKNA 5B3NA 1KCGC 3GSNA 1ZWIB 4S0SD 5CJ5A 4O02H 4FQQB 3MLRL 4UBDC 2H32B 3OHXB 1L9NA 2VQTA 1CT8A 3QI9C 2RJMA 4Y5XA 4IOIA 4I0PD 4KKCC 4HLZH 1QLEH 4UQ2B 5EO1A 5A16A 1BOGA 4NFBA 3EAKA 4KJYB 4NN5B 3K0WA 4K3EL 4X4XB 5IV2A 2CDFA 3EDJA 2P48B 3BD3A 5LGKA 3MOAH 2VXUH 2XZZA 1H15A 4I4WA 4I3RL 4YO0B 4P5TD 4D9QE 5EU3A 2OLDA 4OZHE 4EUPA 1C5CH 3T2OA 4DOHB 2E5EA 5FYKL 2XWBA 3QO0B 1BIIA 3MODH 3IJHB 5F1KC 1QRND 1R6VA 4PJ9B 4Z9KB 1RUQH 5JXED 2WANA 2WWKT 4LSUL 3A6CH 5GS3A 2WWMC 1MCQA 4N0UB 3G6AB 3MJ8B 5D7LD 2OL3A 5I1DA 1PEWA 2ILLA 3WSQL 1HHKA 3WFEL 4NNXB 2ZG2A 1K3ZA 4XCNA 5M95B 4GAYA 3QPXL 3EDEA 3O3UN 3W39A 3HC4H 1RZ8B 4P4RB 1BVLB 1NDMA 4FP8H 1CFQB 3W11D 1I1YB 2DQCH 3CDGA 4F7TB 1T2QL 1FIEA 4PJ8C 4QYOB 1X5LA 5C0BD 4M6NL 3M45A 2D4DA 1YEIH 2G9HB 1CE6B 4M6AA 4FXKA 4PPTA 1LVEA 4NCC2 2H2PD 2XIDA 3E1F1 3D3VD 2IFGA 3BDBA 3O2VL 4JM2A 1AXSA 4Y16A 4P5KB 3GIZL 4J3XA 4P0DA 2XNAA 1MCJA 4JVWA 2DKUA 4LSSH 1QA9A 1D6EB 1NAKL 3NIGE 4LAQH 5DJZA 4PJGE 3WO4B 4CAGA 4RRPA 4YGVB 2YUVA 1XF5A 4JM4H 1OTUD 4LP5A 1C08B 1IAII 1VGEL 2DQFB 4I0PB 1F00I 1HN1A 3B6SA 3NZHL 4H88H 4ZOCA 5JW4N 1L8JA 5HVHB 4P2YA 3EJYC 1JPFA 4D9QD 4U6VH 4F2MA 2FZ3A 1A3LL 4WW2C 4X5WB 1N0XH 4RAVA 4ORGB 1DFBL 1RK0B 1Z9MA 1NANI 4TSCL 4JPWH 2JJTC 5DD1L 4MGXA 4Y5VC 4P5TB 4XCYA 2XZAL 1A1NB 1JL8A 3TNMA 5I1GL 5CHNB 2NY2C 4JHAL 2G2RB 4I0KA 4AJ0A 1ZT1A 1RJLA 1C16A 3O6LH 3SJVE 1NCTA 1OAYL 1QRNB 3QDMA 1PVHA 3UBXI 4JKPH 4YR6A 3S96A 3RGVD 5D7LB 2YK1H 1P5UA 9CGTA 2NR6D 2ORBH 1I8KB 3FT2B 1K6QL 5EORL 1A9EB 1UCBH 2R1WA 3IJSA 4IBLT 4JE4B 4ZTPL 3UTSA 4P4KA 3L7FA 1ZLWK 5ESQB 5INDB 3BP7A 3T8XB 5C0CD 1IGTA 1E4XL 2Z35B 3KNBB 3OG4B 4HXBL 4J6RL 2ZSWA 5L2KA 2R0ZH 1I8MA 2H1PH 5EZJB 3A67L 2RGSA 5IEHB 4YHPA 4XVJL 2NTFA 3QCVL 2H26A 2Y36L 3GBNL 4PRNB 5HYJE 4RMSA 3MZGB 2X7LA 1UZ6E 3C08H 4YUEH 4JRWA 5C0BB 2Q8AL 4PJ7F 2WAHA 4L8CB 2XFXB 3ALXA 3HB3D 4PB0H 4UTAH 4WU7A 4GKOA 1E6JH 3DUSA 4NRXB 4JN2B 3ULSA 4ZXBC 1A6UH 1KCLA 1P7QA 4UOW0 1ZSDB 4M5YL 3H2WA 3LS4L 1DBJH 1QSEE 5IB4A 3ZT6A 4M7KL 1G7MB 4KRMB 5FYJE 2EEDA 1T22B 1CGVA 5SWZA 2Y7QB 2Y4SA 1ZWIA 1ODAA 4U3XA 1CGSH 1MF2L 3IDYC 2FD6L 3I6LE 4FQQA 4PJHF 2H32A 1KNOB 1WICA 3HE7C 2ESVA 4ODXA 4Z7QF 3NCEB 3QXWA 2A2QT 3F7YB 4UQ2A 3O8XC 4OZHB 1S78D 3VD4A 3GSNL 2WUCH 2HLAB 3B4NA 4X4XA 4HUNB 4R97C 2AI0H 6CGTA 1S9YB 4JLRB 1EHNA 3O2WL 4GAJL 1INQA 2YD4A 4YO0A 2HT2C 5FXCH 1XIWD 1KELH 2D31A 2GQHA 1SEQL 1T21A 3W0WD 4Q97A 4TNVF 1F6FB 5DQ9A 3E2HA 5FB8A 1RZ7H 3DX6B 3DBXB 2ZCHL 5TDOB 2ZUQB 3IJHA 4LF3A 5DR5H 3RGVB 4KTEH 3HE6A 2VZTA 4YHLH 1G9MH 1P53A 1G9EA 1PFCA 4N0UA 2FX9H 3P9MB 3CLEL 3MJ8A 4KROC 4AEHH 4XNMA 3BRFA 1HCVA 1JWSA 5C0CB 1U8QB 3SDAD 1JGEB 2FRGP 1SQ2N 4NNXA 3CLFH 1U91A 3BXNB 5IROA 3JZ7A 4X4MA 1MHPH 5CINL 4UUJB 3MLVH 3OV6A 4G7YL 4HWEH 3CH1A 3N1FC 1JF5A 1KN2H 1RZ8A 4C56E 4P4RA 1BVLA 3WNPA 1CFQA 2APTA 2OL3L 2OXHA 1BFVH 4F7TA 5EIVA 5HYFA 3SE8L 3NN8A 4E41A 4QYOA 5GGRA 3H42L 1QSED 3CJJA 3GSVB 2EIBA 3BWAB 4QGYA 5AUMB 1RZIA 1N2RB 1RMFH 5MI0C 1U8OB 1WCQA 1NUGA 5C0EA 3DECA 4LU5L 1IILE 4H1LG 2R8SL 1LO0H 3RVWC 4WFGE 2AXHA 3FT4B 3IDMA 4P5KA 1TZGL 1RUKL 1NDGA 4TUOB 2A73B 3MBEB 2CD0A 5MP6L 1PKOA 1KB9K 3O3BB 4DUXA 1NCAH 5FOBA 1D6EA 3BVNB 3ZSSA 5HGAB 3VH8A 4HUXB 3ZHDA 1Q9KB 3U4BH 1HEZB 4I0PA 4YHOH 4ZFOA 1YMHA 4ALAH 1AE6L 1YEHL 4MJ6B 1UB5A 1FP5A 4X5WA 2CXKA 1RJYA 1UH3A 5I1CL 2FWOB 1RK0A 3VA2C 1CTOA 5EIIB 5LBSL 4MD4B 4PV8B 1ZLVH 1OT1A 1XIWB 3B83A 3MRNA 5T3XL 3W0WB 3EDKA 5CHNA 5DRNB 3RVVD 5BV7C 4HWUA 1MJUL 4NYLB 3LKOB 4H1LH 4EOWL 4LOUC 3I6GA 3V4UH 3QFJE 1QRNA 1G7HA 1JF6A 1T1YB 3D85A 3HG1D 3WHE0 2NW2B 3BDYH 3T3PF 4YZFE 1QPPA 3CPLB 5D7LA 3ZKXC 3QA3B 1OCWH 1I8KA 5L2JA 1A9EA 2Z31D 5EULV 3SDAB 3O9WA 5HVFB 3VGEA 1KGCD 4LKXB 4F15B 3VXUE 1HKFA 4TVPE 2AEQH 2AJYH 5INDA 4DN3L 3KLDA 4KWUA 4WRLA 4ERSH 2DQTH 5DUBB 1IE5A 5C0IB 1OTTD 2VQ1B 3EUUA 1N5AB 4ZG1A 5AAMA 2G5BA 3W81A 4XNUL 3HAEH 5ICZB 3O6FD 1CVSC 3RWIB 5AYUL 4NN7C 1I7RB 2CGRL 2XZQL 2ZUVA 5D96B 3VRJB 4FQPA 4OT1L 5CBEB 4NIKB 1GGYA 5JHDE 1T20B 1XCTA 1QSEB 5GRUL 2EIZA 5K9OA 4L8CA 4XPHH 1CDYA 5IHUL 1KEML 4U6XA 5JXAL 2WUBH 4N1EA 5D4QA 3K1KC 5JIHA 5D8JH 1ZHLA 1B6DA 1MEXH 2CK0H 3ALWA 2WSKA 4AM0B 2AABH 3BZFA 4HWBH 4OUOA 2XG5A 1EFXD 1G7MA