3MV7E

Crystal structure of the tk3 tcr in complex with hla-b*3501/hpvg
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
241
structure length
241
Chain Sequence
DSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSARSGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allelic polymorphism in the T cell receptor and its impact on immune responses
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
total genus 55
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2010-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mv7E02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mv7E01
3E6HB 4PV8A 5D5ME 3QYCA 3W81A 4CNIB 2V2XA 5KG9B 4NQTA 2DJSA 4M62L 4LCIL 5KSAB 4JPVL 1JWMA 1JPTL 2DQJL 3BO8B 5JQ6H 3SKMA 5DK3A 3KPLB 4KQ3L 1IC7H 3NFNA 4ZD3H 3EJYD 3S35X 1I1FB 3MRQB 3RWIA 1Q1JH 1UM6L 3T0EC 4ZMAT 5CUSH 4NQDE 2H6PA 3WDIA 3BSZL 1UYWL 2MSPA 1CF8H 3QFJA 5BXFA 2JCCE 4YHIA 5HI3D 5IJKA 3U0WH 3UO1H 2VZSA 3I02B 3V0VA 1VACA 1AHWB 3MA7B 1J8HD 1PLGL 1ORSA 1P7QB 1J0IA 4WU7A 2PO6C 5AWNL 5L2KA 1II4E 2EDHA 4K71C 5HYSA 1MFAH 2FLBT 4BSWA 4HQQL 5CWSB 4LIQH 5GRUL 3TBVB 2QBWA 1NCBH 3RGVB 1D6VH 5F9DC 3SGJC 1U8MA 3TA3A 4PRHE 1WWBX 1A7RH 1QZ1A 3QH3B 4B50A 4KVNH 2ZOLB 1AO7E 3KS0J 5B21A 4HXAL 1J5OL 3WKMH 3H9SB 5I1DB 43C9A 4WY7H 3B5TA 4OZFH 3UPCA 1FZOA 1U58A 5BVJB 1NLDL 2AQ3A 3V5DA 5I1KL 4KI1A 4Z7UF 2NY0B 2DM4A 3K4ZA 5FA4A 2N7AA 1B4RA 3HAEA 1QEWA 4HK0B 1IZKA 4MD4A 3K1KC 5T33L 2EDRA 4MXQC 4BFGA 1U9KA 2XI9A 5J1AA 4M7ZC 5I8KH 1U91B 3K2UL 3BMWA 1X6NA 4M6OH 5EN2A 3I3EA 4OLVH 2OJEB 4FXLA 1S7RA 1I3GH 3DXAD 5CINH 1GL4B 2DKSA 4MQTB 5HVGB 5C07D 1XF3A 1KIUA 3PHSA 1UWGH 1ZA6B 4JRYE 4RISH 5DDHB 4KFZC 2E8YA 2FDBP 4OF5A 4PJEB 2DRUA 3HZVA 4R8WL 4U6HA 3SY0B 1I9JL 2X4NB 4OGYL 1KCLA 3VGDA 5E6YA 4JQVA 4IOIB 5EOQH 4F33B 5E99L 2YKLL 2AEPH 1TCRA 4PJXA 3VG0L 1EEYA 4XMLL 4DVRL 2ICWB 5DHXB 4JPVH 4Y4KD 5EIIA 1B6UA 1TETL 2LTQB 2YZ8A 4NN5C 3FFDB 3SDCD 5D7KD 3PHQB 5FYLE 3CZFA 5JA8B 1QVOA 1FH5H 4MAUH 2F53A 2RGSA 4G5ZH 4PB0L 2V6HA 4HH9B 2CDFA 3EO9H 3K80A 1U3HD 4LU5L 1EEZB 2BVUA 5JXAL 3TP4A 4N68A 3QEHA 4AH2A 1NANH 3ILPB 4YHLH 4GLRH 1VDGA 3X14A 5L2JA 1T5XA 3IYLW 5DEGB 2FATH 5HGGS 2CO6B 4KJYA 4Y8DC 3GKWH 4JR9L 4LFHG 4JCLA 5C07E 1CICC 2PTTA 4HQQH 4PJ8D 3D0VB 4LLDA 5D1ZC 4P59L 4N0CC 3B4NA 3MACL 4JREB 4WEMB 3LS5L 4HJ0D 1HDMA 4AG4L 3KPRB 1GGYA 1YEGL 2APXA 1NGYB 2VDQH 3OGCA 4UU9A 3IB4A 5IBUG 4W6XB 4JZOB 2PW2A 4JPIA 4OF0A 4TULH 1YPZB 5F9JB 4P3WA 1VHPA 3C8KA 4OAWB 4HG4K 2JB5H 3BP7B 2DICA 3O9WB 1RIUL 3U7WL 3UYOD 4KTYA 3FOMA 4EUPB 1PQZB 1TPXC 4Y1AB 1E28B 3GSQA 3IJYA 4NKMB 3SDCA 1RZGB 1SEQL 1J86A 2APBA 3DRQA 1MI5D 1OAZH 4HUMB 2EKSB 3EO1B 4R2GB 3E6FA 5EO1B 2DI8A 5C09A 4OLYH 4OB5H 1S7TA 2IPKB 4IRJC 4AM0B 1UKQA 1SY6L 4PJ7F 2RQ8A 5MENA 2DLGA 2X4OB 4FNLH 2AQ1A 3AM8A 5I16B 2XZCH 2ORBH 2J8UF 5EWIH 3V5KB 1O7SA 3MC0A 3RVXC 1KG0A 3U0PA 2EIEA 1LP9B 2A77L 1PW3A 5HDBF 4Z76B 3QHFH 4BK5A 4H1LB 1UZ8A 3VFVB 4KRMB 4WV1C 1S9WA 4Y88A 5EOQL 5EZLA 4JM2C 1BFOB 4OIIH 4POYA 3IDNB 2VABA 2AAVA 2F54A 4U1JB 5J1SC 1OGTB 1RIHL 4R7NB 1N59A 4OBSA 4X7TA 1DUZA 1JYXA 4JRXB 2CQVA 1N5AA 2X4QA 4ZUSA 3ARVA 2MCPL 1FVDB 1JGUL 2EH7L 4TVPH 1I7RA 3C6LA 1YY8B 2IH3A 3G5YA 3V52H 1YYMH 1A4JA 2H1PL 4FZ8L 1XFPA 3LAFA 4RNRA 3U30C 5BVJA 4QHLB 3K46A 4XRCA 1RUPH 3VWJD 4NQEA 2E7HA 1G0XA 4MSWA 5F97E 4HBCH 1Z5LA 3QUZC 2X41A 1QFWL 4PGJA 1EX0A 3QR2A 5I75B 3ZKMD 2CLZA 3A6BH 5IIEB 5B39G 3MLRH 1IM9A 1XAUA 1FFNA 1MWAH 3LQZA 3MUJA 3QDJB 5DS8A 2X05A 1F90H 1JPSL 3TNNB 1S9XB 4FFWD 2R2EB 1RJCA 4P2QB 2RCSL 4ZXBA 1K4DB 3FHQA 2VOTA 1KNOA 1FNAA 3UBXA 3U1SH 4P5KB 4N9OB 4EOWH 5IVZA 4TVSa 4MSWB 1Q9KB 1QSFB 3ARFB 2GAZA 1ORQB 2G2RA 4JVUA 4HGMA 5J3HC 2EKSA 3EO1A 1HHGA 4PG2A 3U7AA 4LNRB 4JFEE 2ZZUT 1I7ZB 1O5DT 5C07A 4U7SA 3MJ6A 3GMLA 1OTSD 2W60A 3OKDB 2GK2A 4TOYL 4HWZA 4JPWL 3C5SB 5HYJB 4WJ5A 1KPVB 3T2NH 1K4DA 4IIQA 5BZWB 1N64L 1YEKH 5HVWA 4R7DB 2HKFH 5DD3H 1ZLWK 1AR2A 1F6AB 1H0DB 5DJ0A 4MA1B 2DQUH 4YXLL 2X10A 4X0KB 1CFQA 2BSSA 2VLRE 2R0LH 2HJLA 3G6DH 1V3JA 1YY9C 3TESA 4X5XA 5D1ZD 1I8IB 4QXTA 1VA9A 35C8L 4IOFC 3O8XC 5EU6B 2NX5B 4POUB 5T1DL 2Z4QB 5HHOD 5DEFB 3SGKA 5JTWA 3SE3A 4P2QD 1IM9D 4PJCB 4LPVA 3PWUB 2YPVH 4FP8L 5I8CB 4L3EE 1KYOK 5DEGA 1X5AA 3NZ8B 5IT2H 5CGTA 4P5TB 1CD1B 1XIWB 4H26B 4YZFF 1AE6H 2E6QA 3NN8A 3QCUH 2XRAL 5CJQL 1T2XA 3ARRA 5ALBH 3X3FH 1FJ1B 1AY1L 5F6IB 4ZXBD 2AK4A 5ESVA 3P4LA 5CHNA 4XCYB 1ZEAL 5C0EB 2PXYA 3DUUB 3GB7A 5JIKA 4GW1B 3RWDB 1J8HB 3HUJB 1U42A 1NAML 3EYOA 4PJ8A 5E8OB 1E4WL 3ARGD 1CE6A 4F9PC 4NQSA 3VXMB 4KJWC 3O6KH 1G1CA 4GXUN 2W65B 3SDXB 1BBDL 4P2RA 2EH8L 4Y4KC 4CVWA 2FJHA 3PWJA 3GMPB 4N90E 1LEGB 5D1XC 4I48B 4PR5B 3RDTC 1OHQA 4NRYA 2GY5A 3ZZ1A 3C60D 1G7IA 3EKCA 1LK2B 4P2CG 3P11H 4HXBH 1YC8A 1G9NC 1DQTA 2VZ3A 4NRXA 1P1ZA 1LDPH 1NH6A 2Q8AH 3HLAA 3ZT7A 3VH8B 2OLDA 3VDBA 4PRHB 4NM4H 3ZTNH 4LBEA 5TPWL 5DD1L 2CO7B 3VFNA 3BIBX 1JFQL 4KUZH 3SJVB 5ACZA 5I2IB 5A2FA 4IS6B 3STZA 1KCUH 1MCQA 3X11B 4MA7H 3FMGL 4UT9H 7FABH 4HKZB 4PGBB 3MLPA 1NSNL 2AK4D 5CD3B 4KJPC 5KSAD 2N4IA 1T7VA 2OTUB 4LLMB 2QADB 3ARSA 3A67L 3WL9B 5DJXB 4MA8L 4EXKA 4DGYH 5I1CH 4A2LA 4TQEL 1W8NA 3MV11 3H9HB 3NZHH 1CXHA 2HKFL 2YMXL 5HI4D 1HOCB 1BVKB 4GT7A 4YK4B 2YD2A 1JZ2A 1LP9F 4YDJA 4ONFL 4PRBA 2BK8A 2BZDA 2ZJSL 1LO4L 4HS6B 1WWWX 1JHLH 4M00A 2ZSVB 3UJTH 5TDPA 4WY7L 3CVIL 3PG2A 5D7JA 4X6BB 1S7VA 4RMSA 4K8RC 4P3CL 4F7MA 1ED3B 4JO4H 3MV7B 3PGCA 3RL2B 3QI9D 4BSWB 1OAKH 2Z31D 2R1XA 3GHEH 2AS5M 1R3KA 4LAQL 4XCEA 5FGBC 3TO2B 4HKBB 4JFQB 2X1WL 4QXUH 3VXQA 1HXYB 1X6LA 4TUOB 5C0AE 3HN3A 2DQHH 1C8PA 5ILTL 3R4DA 4FN0A 4RQQB 3CFBA 3TNMB 3B6SB 5SWZB 2ZUTA 2A0LD 3RWGA 1U8HA 5IWLA 1A1OB 4ZFOB 2VE6B 2K7PA 4C4KO 1LO0H 1RZ7H 1S5HA 5DJ6A 2EYRB 5BQ7B 2HT2C 1I3GL 4N9GA 5FCUL 5HI5C 2EH8H 4XC1L 4JFOA 1A9BB 3MCLH 1RULL 4WU5B 1CXFA 3RAJL 1G6RB 1M05B 1G9MH 4LVHB 3RGVD 4D9QD 4Y16A 1I7ZA 4L4TB 4OZGE 4ERSL 4HK3N 2ZCKL 1MFDH 3KDMB 3UTTD 3LKNA 1ZGLP 4JFZH 5SWZA 3P11L 2X44D 5E9DE 1WT5A 1EHXA 4M5ZL 4R2GC 1INQB 3PQYB 5E4EC 1DJSA 3MLTB 1ZE3C 3RWCB 1NLDH 1UM5H 4ONHA 2OQJB 3UJJL 1P53A 4HIJA 5D7JD 2GW5A 3NCYP 3DV6A 1F2QA 5DVKA 4GG6E 4PJ9D 2A9NH 1IC5L 3C8HA 4IDJL 3BP6B 4HWBH 5LWYH 3MUGB 5F6HI 4JY6B 1MAML 2Q7NA 2NTFA 3CH1A 2OI9C 4HIHA 4U1KA 3HE6A 3D39D 4Q6IB 3VXUE 3UTPE 4RFNC 4PJBA 3V5HA 3DX8A 1FO0A 3PP4H 5KZCD 3PF2A 4QF1A 5FUOL 5HHOA 3GMQB 3VFGL 4OGXL 1WVZA 2HG5B 5DK0A 1RZGA 3GKWL 5DC9B 4MA1C 4UINL 3RVVD 5CILH 2P5WD 4TQEH 2MCG1 2VZTA 5DJYB 5FOJA 4KKLC 1TFHA 3D0LA 2FLRT 4MJIB 5DT1H 2AJYL 2E5EA 3IRZA 5KSBE 2CDEB 1YEJH 1PEWA 5C0AB 3RTQD 4OLUH 5EULV 1MF2H 2VLKD 3T0BA 4HT1L 1NBYB 4HW6A 4YHNA 3FB6B 4P2YA 4JO4L 4NZUH 1CDUA 3MLUH 3MV7E 4I5BA 4EBQH 1QPXA 4WIQA 1MRFH 1L0YA 2H41A 1CD9B 2FIKB 3BW9B 4DTGL 4YDVB 4TUJA 4F8TA 3C60A 4NZRL 3HPJB 5MENB 1OQOA 4PJGB 3U7YH 3KPRD 4NRZA 1FLRL 1M6OA 2B0SL 1UWEH 1A5FL 4KKCD 1GHFH 3BDXA 5FECA 2DTMH 3MRCB 5FUZL 2VDLL 5A2IH 4KHXL 4F7PA 3CXDH 3BDYH 3P4NB 3TO4D 1Z9LA 3ZKQD 3U4BL 4BYHA 2XTJC 3FQTB 4CW1B 1Q0YL 5DMJB 1F4XL 2GT9B 3QXTA 2K9UA 4KVCL 2ZCLL 2CJUL 2DLFH 4Y5XA 4GJTB 3G6AA 3SCMD 3WIFA 2HVKA 3IDGB 3UTSB 1YC7A 4P9HL 2D7TH 4LCCB 5K59E 2VDPH 4Q6IA 3BN9D 2HRPL 3WBDA 3HZYB 4Z7VB 5C0DB 3BAEL 4GRLB 3QEGL 2AEIT 4M8QA 1A6VH 3EAKA 2YBRA 3G9AB 3T4YA 4PRBB 5DRZB 4M7LH 4TVPL 1HKLH 4PGZA 1BWMA 2A73B 4GAJH 1S78D 3RJDA 4YO0B 4TRPL 5H37G 2OQJA 2VH5L 3DV6B 5FYLL 1JZ4A 3SDXE 3GNMH 3PWPD 3REWA 4WNQB 1FL3A 1ZHNB 4M03A 2FX7L 1KGCE 2C1OA 4HWZB 3HMWL 1RUAH 1YECL 1HQRB 2CDEA 3F5WA 4OZIE 1IARB 3VWKA 3C2AH 1SEBA 1OPGH 4TNWK 4KMTL 1LK3L 3D85B 3ESUF 1MFBL 4KI5E 4OGXH 2ZG1A 4YJZL 2JIXA 2F53B 3RVTD 5CEYA 1M7DA 2H2PD 1YNTB 4JB9L 1LO5A 2YPLA 2WK2A 4QRRD 3QUMH 1QSFA 3ARFA 3GMQA 4I2XE 1FL6A 5KN5A 4G9FD 3VI3F 2GUOA 3TV3L 3QXDB 1YJDH 3HAEB 4LSVL 3MODL 1CE1L 4HDIB 5ALCL 1KELH 3TZVB 1ZOXA 1REIA 3CVHL 4WI7A 3CLEH 3W9DA 3N0PB 4M1GH 2AXFA 1JNJA 4G6AC 3TWCL 5HYQA 4IRJD 3BRFA 5IFAH 3HC3L 1NC2B 5ID1B 1CFSA 3VGEA 2X1OA 1FGNL 1FYHB 5ANME 4BH8B 4J12A 4L8SC 2VLMD 3OAYH 5L0QB 5IB5B 4A6YL 3CK0H 4W4NA 5DJ0B 3FT3A 4WV1B 1U8IB 1WISA 4GUPB 4XPFL 1CU4H 4U1MA 5DVNA 2HT4D 2OX5A 3VXSD 2LU4A 2YSSA 4H1LH 4OBRA 4K9EH 2ITDB 3FQWA 3TPUB 1MCKA 1P4IL 4U05A 3WS3B 1WSST 1P4LB 1JVKA 3B2UD 3DI3B 1CS6A 5DK2A 4F7TA 4XAWL 1XF5A 2O26U 4MD4B 5C2BL 3UZVB 3RTQB 3GMLB 4XNZB 4XPHH 5EZOH 1NCDL 4P23A 1WBZB 4HWNA 4OLXL 2I07B 4LCIH 3L1OH 3WUWB 4KVCH 5HYFA 3UYPA 4NUGL 5CS7A 4U6XB 1AC6A 2NY2D 4ZD3L 2FB4H 5GS2D 4WENB 1FZJA 4K07A 3MRNB 4GAGH 4OD3L 4O00A 5DEZA 4WCYL 4Y4HB 4J6RH 2V5RA 4U1NB 3DWTA 4FQ2L 2VLME 4WNQA 4DAGL 1QSFE 3UMTA 5KS9E 4JY5L 4WHCA 4KZDL 5EPMB 1PZ5B 1QBAA 3O9WC 1Q9OB 1XEDA 2V9TA 4M7LT 3SBWA 4PRID 2FNBA 5C9KA 1TZGH 3THMH 3OZ9H 3SDAD 1L9MA 3BGFB 3BE1L 4IRJA 4K94H 5D7LE 2JLLA 1IQDA 3QJHB 5INDA 4XWGL 4ELMF 3HC0B 3U0WL 5D93B 5DUML 3AC0A 4J4PC 4FQCL 2AABL 5FYLH 2NTSP 3W9DB 3GSRB 4MYWB 2QLVB 3S34L 2LFGA 3QUXD 5DSCB 4QGYA 3ULSB 2DI9A 4WHYG 3SDYH 5FXCH 3MMEA 5E4IA 5D71L 5CIPH 1D6VL 4F15B 4H5SA 3VXTA 3S5LB 2Y9RT 3O41A 3KLSA 2VLJD 1RZIB 1ZKAA 1I3RA 3WHXA 5K9KB 3ULVD 4J4PD 5GGUA 2XKUA 5I1LB 4ODUB 4LSVH 3QIWC 1LP9A 3T04D 5HD8D 3KPOB 5DD1H 4WFGE 3B5HA 5E00B 5GS0L 3VGAC 4ZAKB 4PGEA 1NGYA 4D0BA 2WV3A 3SKNA 1WGOA 3QUYC 5FYJU 2JK5A 4BFBD 2XWBB 4OLVL 4GRWH 1MFEL 5CINL 1K5NA 3O4OC 1WV7T 3D1MC 1YNLH 4JFFE 4XHJC 4TUKL 1BGXL 1QD0A 4Y89A 5KAQF 1E28A 4K9EL 2IANB 3MRKB 3IT8D 4NC0B 4NJ9L 3SDCB 4ELKB 1MLCB 1PJ9A 4OSUH 1BVZA 4ZUUB 1SMAA 5B3JE 5GIRA 1QSZA 4PLJD 2XWBA 4R8WH 3QO1A 1YPZE 4IRSD 4GXUM 4PG9B 2EE3A 1PVHA 2HWZH 4X7TB 3CDFA 3BUYB 3FQXB 5AEAA 2R56H 3L1OL 5CD5D 1OSPH 2K7QA 3RL1B 3BPCA 4PJBF 1WITA 1WEJH 1AGBB 3GJEB 3CJJA 1I1AA 2ERJB 4F57H 1IAIM 2EDYA 3PWVB 4DAGH 4QRQB 1W8OA 5F72S 3HZVB 1KSRA 3TCLB 2XN9D 2P8LB 3MGOA 2QR0A 1NGPH 3MMEB 3CIQA 1AGFA 2AJZB 2FD6H 3F7PC 4QCIA 4MAUL 5DJDA 2V5SA 2B5IC 1PSKL 3GMOB 4YGVB 3MRLA 4NO3B 5MHSE 3IFNL 3JV6A 3IF1B 2GJ6D 3ARBB 2W9LA 3IJSB 3SKOB 1L0XA 1MEXL 2G60H 1DE4A 1WIOA 4QWWD 4AYFA 3O8XA 4ONGH 3V6BR 3RWHB 1DBJH 4HH9A 4N8PA 3QIBC 1D9KB 4HULB 4N8CH 2BVYA 3KXFA 4WUUE 4NBXB 2IBZY 2UUDH 2DQFA 5DA4A 4YX2L 2VLKB 5CBAA 2WM0A 1CICA 2VDKL 2E7CA 4QHLA 3VFSB 1D5BB 1NFIB 4N9GB 2R4SH 1B4JL 1OAKL 4OLZH 4OM1H 2ADFH 1F3JA 5F1KC 5SWZE 4JFOB 5DZNA 2DL9A 1ZGLB 5IMKA 3O2WH 4Y4FB 1MHEB 4G8EA 5FHAH 3UDWA 5HHXH 5SWQA 4WJ5B 2YN5A 1SBBA 4JZNA 3CH1B 1JGVH 4XVSH 4KI5C 4CRPA 2P5EE 1MCSA 4PJIF 2HVJA 4P23B 2BX5A 1IQWH 2XFXB 1U8KA 4ZO9A 3WFHB 1ZA6A 1DFBH 3FO9A 1MAMH 3QJFB 5D4QA 1INQA 1MCWW 1KXVC 2GTZA 3WE6A 12E8H 5E9DD 3MBEA 2XWTB 2NLJB 2IJ0C 5C0GA 2VABB 4D9RE 5J1AB 2RB8A 2YUXA 2E7BA 2M1KA 2VXSL 3TCXA 4UINH 3FN0H 1F45A 1FVEA 3KR3L 1P9MA 2DYPB 3BESR 1MFDL 2CDFB 3CX5J 1UT9A 1KULA 3ZKXB 4XC3L 3AY4C 1MNUH 5HDBE 3MJ8A 2UZIL 5FK9A 1LMKA 3BZDA 2VXVH 2ZG3A 1Q9WA 2BMKB 4JPKH 4NHCL 4TPRH 5TE4L 3OX8A 5HDLA 4FQ1L 4JFDD 3WIFB 4QXGH 3GKZA 1RVFH 1VFMA 3IGAA 1ES0A 1XGTA 3LKPA 1GYAA 2P5ED 3NA4A 4Q0XL 2QQQA 4CVXB 4A6YA 3KXFB 4TSBL 1FLRH 4L4JA 4E41A 1U3HC 4XNMA 4R90L 1HWHB 4X6BA 2VERN 5C92A 1SJXA 4UQ3B 1KN2H 3MLXH 1SBSL 1PSKH 2F5BH 5E56A 2ICEA 2YD6A 1UB5B 1AGFB 3OKMB 3RY5A 4R4BA 2BNQD 1S7SA 2C7UB 1QLFB 5DC0A 3OKYA 1NC2A 5K9JL 4WFGD 5H2BA 2D31B 4DGVL 3JV6B 2IAMC 5DD5L 1U8QB 4KKNA 4TUJB 1U3YA 4G8EB 3DVGB 1GGIL 5E7BA 4Z7WE 4I48A 3K4DA 1PKQB 4FQIL 4EOWL 2WIIA 4XNQA 3DNKA 2VLJE 2VDML 5ESQA 1KLUB 4CMMA 3U9PH 1IC7L 5DRXB 1C5BH 2D3VA 4JFFD 2FHCA 4FXKB 2HTKC 2GITB 2JCCA 4PJDF 4EBQL 1LO2L 2W0PA 5DQJA 3HS0B 2J4WL 5FA3B 2EDNA 4WW2A 1R3HB 4YHKH 4KV5E 5GGVL 5CBEB 1DZBA 4OIAA 4NP4H 3LHPL 5EU6D 5JLZB 3BP7A 4B0MM 3BPOB 4EI5C 5CJXA 4M1DL 4PRHA 3L7EB 1FN4A 3KYMA 4LEXL 3WN5B 4JG0H 4G7VH 1AP2A 1CD1A 1XIWA 5C0CD 4XPAH 4X5LA 1OW0A 3U4BH 4XBGA 2NW2A 3RIFK 4KMTH 4OT1H 3TJEL 4JG1L 1J87A 5HYEA 1I1AD 1A3LL 1GOFA 3CPLB 5JPMB 4BFIA 3EYFB 1JMXA 1T83A 3BT2H 3QEQB 3R06B 5AZEL 1BLNA 3S36L 3K2MC 2NYYC 1NPUA 2V9QA 5IT2L 5JXEC 1JGDB 1T03H 3T8XB 5I73B 1NFDA 2YA1A 3MBXL 3QO0A 5FO7A 5I1KH 5J11B 1UH3A 4NCC1 5KTEH 1U8LB 1UB5A 3F7VA 3EJYC 4WHDA 4FQXC 5F7UA 4YBLC 5KJRL 2F74A 2E27H 3EDFA 1AGEA 4RGND 4X6EB 1QFWI 1UYWH 1UJ3C 4MD5A 2OZ4A 1SVZA 3L5XL 3KPNB 1T2JA 4HHAB 1JGLH 1PKQA 2XTLA 1I9IH 2Q20A 2EZ0C 3SQBA 2BSED 4E42B 2H3NA 5EFIB 3HZMA 4IRJB 2E9IA 1K3IA 1OGAA 2XY1A 2ADJA 5KVMC 4J23A 2GTWB 3LKSB 1ZANL 3CDYA 2FSEB 4DVBB 4MAYC 3QUKB 4OZIA 4ONHB 4PJDB 3GHBH 1YDPA 3UPRA 3ISWA 4NUGH 4FQQA 1K85A 4S1RL 3T65A 3FCTA 1FC2D 5TPWH 3HG1E 1FFRA 1H15A 2X5PA 1HH9A 2A9ML 3X12A 3VRJB 2NLJA 3KPTA 1S7RB 3SJVE 1CBVH 3GFUA 1IE5A 3D0LB 4CVXA 4R7DA 5D2LE 3LKNB 4JY5H 5SV3A 4KZDH 2J5LB 1HINH 5BMFH 1AHWA 3WV0A 3B9KD 4RNRB 4KTEH 1JNLL 4WW2F 3LOWA 2YK1L 2B4CH 2C9AA 4MS8D 5HHOB 4JGMA 2J4WH 4WI4A 1I1YA 1AXIB 4Q9QL 2F19L 4WW2C 1ZLSL 3V7AE 3BO8A 3B9VA 4BKLB 4KHTH 1LP9E 1RZJC 1WZLA 3OR6B 5HBBA 3IS0X 1S9XA 1Y6MR 3T0VA 5I1DA 2XTJB 5DUPL 1VADB 2VDNH 5ADOH 4ZO8A 4HUXB 4YDKH 5EB9A 2JJSC 3SE8H 1QYGL 3UZQA 5D7IE 3LEXB 4O5LL 1A7QL 4Q58C 1OGAD 3JV0A 4PJXF 3JTTA 1MPAH 1DQJA 3L6FB 1MHHB 2R1WB 1MH5B 3NA9H 4LPCA 5M95B 1WAAA 1NL0L 2YOCA 1INDH 5J12C 4HUVA 1HSBB 4OFPA 2H3NB 2ARJQ 3RBGA 4HUUB 1RFDH 5GSRB 1BFSA 4QY8A 1BVLB 1RJYA 5DVLA 1NLBH 4Y16B 5E0QA 1KC5L 2C4FT 2FZ3A 2KZ1B 3ESVF 4LAQH 3K8MA 1SYVA 1TZGL 5IHUH 2YPLB 2DQHL 4HUKB 1QKZH 1QO3A 2NX5E 3VFRB 4L8DB 1LK2A 3MQIA 4ZPTA 1QNZH 3EYVB 4RZCB 4Z0XA 1UGNA 4UV4H 3O4LA 1TTUA 2OR9H 4OZGF 3VRJA 1MJ7H 3QO1B 5HVHC 5GGRB 3DOSA 3NCYS 4PJEE 1JPST 5ACZB 3VGGA 3IU4L 3P40A 2AJXL 1EIBA 2A0LC 1OVZA 1OGAB 1IEBA 5I2IA 3Q6FB 4LARL 2CMRL 4XVJL 4RGNB 3T4YB 2VR5A 3IXAB 3TFKD 2E3VA 4Y8AA 1UJ3B 4ZTPH 2DKUA 2VMFA 4MQXD 3ALWA 1MQKL 2Y36L 2HT3C 3RWEB 3DYMA 3L9RA 1W72B 2A6DA 3T77A 3V4VL 3V8OA 4HWBL 5EZIH 1XGYL 3AAZB 4RDQG 2D4DA 4YLQT 2NY1C 3VD9A 4Y4FC 5L9DH 5ADPL 4MJIA 4DN3L 4PLKD 1XT5A 1JNLH 4OAWA 1RMFH 3G5ZA 4R2GD 2AXHA 1P2CA 2Q86B 5D7LD 4OCMC 5I1JL 5DYOA 3T8XA 4IMLA 3LN4A 1GZQA 2R2BB 4LLQB 5D6CB 1U8NA 2YD7A 2EKJA 4OLYL 4PTUA 1CLOL 2FL5B 3S36X 4L1DA 5BJTA 3S3SA 3UJIH 2VB5A 5FUOH 1MJJA 1PEZA 4WTZA 4LEOA 3VG9B 3RGHA 4HUWB 3WN5C 4OZGA 3VFTB 5CILL 2P4AB 4YDVA 3NGBB 3O6FA 5LGHH 3NBNA 2YPLE 4N0YL 4DKEL 1VFUA 4PJFA 5D2NB 5M7QA 3QWQB 1QYGH 2RCSH 1AXTH 3ILPA 4MCYB 1SHMA 4KK9D 1RU9H 3KPPA 1B4JH 3OKLA 2BJML 3W0WD 4KGLA 4XXCC 3BZEA 1R5VB 2AXGA 3ECBA 3I6KA 4R4BB 1T66D 3VXRA 4ETYA 1D5MB 5GGRA 1H3PL 1R3JB 1DBBL 5FO9B 1MRFL 1NLBL 3GM0A 3QDJA 3TVMD 3W2DL 5M94B 1D5XA 3L3GB 3AM8C 3O81A 1A3QA 3WFEH 2XV6B 3T4AA 1J0JA 5KSUA 3M1BB 3EYUH 3BWUC 4RIRB 2BNRE 5CD5C 2PR4L 5EBMB 3KGRA 3VMNA 3DI2B 3QUZD 4YXLH 4PJ8C 1O0VA 4ZPTB 1FZJB 1CFVL 1KBGH 2BOCB 1B0GB 1A0QL 4JFEA 3MRGA 3R8QA 2EDQA 2WBJD 2WNGA 3WNNA 1OTTD 4ALAH 2FH6A 4I9WD 4NQVA 4MB3A 1HSBA 2DF3A 1ZXQA 2HA1A 2H8PA 3TBVA 2C7UA 5DK2B 2YPKB 3QAZB 5LCVL 2X4PA 1KXTB 2PN5A 5ERWA 5IEHA 2D2OA 1UQSA 4OM1L 5TDOB 1JNHA 4FTVE 1OAUL 2A6JB 2CIKB 3KDMA 2DB8A 4PRNA 1F5WA 5HI4C 1KCRL 3TM6A 4PP1D 1IAKA 2FO4B 1KPRA 4ZOEA 1NCCL 4XI5C 1P7QA 1CFQB 1JF1B 1MQKH 3GSNL 4MAYD 3D3VB 4JFYB 3MZTA 5DK0B 3MCKB 3NGBC 4JM4H 2ZOKA 3FT4B 1I7TB 4H25B 3HE7A 4LKCB 4NBZB 3KPLA 2DDQH 4PGDA 2VDRL 1VFAB 3OJVC 3OKDA 2DM2A 3F7QA 3P73A 4U0RC 3R1GL 2J7LA 1YN6B 5J6HB 2B4CC 5HYIA 2HLAA 5HHQA 2CIIA 4X6EA 2R29H 2V2TA 3QPQD 1QSEE 4MNQD 1J8KA 1KELL 3D2UB 5T1KA 3FFCD 4QGTA 4OV6F 5EO0B 3ES6A 3M8OH 3FQWB 3ULVL 5CWSA 2BVTA 3WHE1 1F4AA 1SJVA 8CGTA 1CVRA 2P24A 5ALCH 1NMAH 4D0CB 5J3HD 3IJSA 4RAVA 1MIML 3MRPB 3QZWB 5I1IH 2VC2H 1G7HA 4QXGL 2J8OA 5I8KL 5JR1H 4HCRL 1D6EB 4PYHA 1OD7A 1U95B 4LGRB 3EHBD 3KHQA 5CZXC 3FMGH 4BQ8A 3MRRB 2X4TB 1TQBB 1ZA3B 4S11A 1OF2A 1IGIL 5HJ3A 5ANMB 2ARJB 5E03A 1L7TH 1T2QH 4HDIA 2Q87A 2P8LA 1SBSH 2F5BL 4G7YH 4KKCC 1C7SA 2RJMA 4Y5XB 5IQ9B 2WWMC 4HHAA 4OLEA 3S97C 4P4KC 4DGIL 4NN6B 3MPCA 4ZYKB 3T4AB 1JUFA 3LB6C 1AXSA 1UKTA 5I9QB 1A6WL 2FEDC 4NKMA 2VLKE 3UX9B 1XCQB 5E8DL 2X1XR 7CGTA 1QVOB 5DD0L 2Z8RA 1A22B 5MEND 1MLCA 4XCYA 3TA3C 1A2YA 4Q9BA 3UP1A 3KLDA 5ID0A 3BISA 5IQ9A 3C60B 4HC1A 4KRPB 1M6OB 1T5WA 1ZVSB 1CD0A 1HOCA 5JXAH 4UZGA 3WJLA 2J2ZA 3L5XH 1P4BL 4K2UL 3GMPA 3HZYA 2MQCA 2NY3C 5FHBH 3IFLH 3IKCB 5HVFB 4PLJC 3C5JA 1IGTB 2XYCA 1KJMA 3WUZA 2OK0H 1AO7B 5TQ0L 5I30L 1N7ML 4G8FA 3O6FD 4CJ1A 4LSSL 3O3AA 3QDGA 5I18H 1WC7A 5CIPA 3RX5A 3PDOA 4DCQA 1FBIH 4OJFH 2GCYB 3RIAF 3UCRA 4ZUTA 1MIEL 2AJVH 4WFHD 1IFHH 1RZKH 4XBPB 5I75C 1T0NA 5E8PA 2CDGB 4OCRH 3RWDA 5BZDA 4AT6A 1EVTC 2CLRB 1ES0B 1S3KL 5SX4I 3NIDE 3GBML 2F8XC 1WF5A 5HHPA 2H45A 3SPVB 1DBKL 2IANE 1I8LC 4FHBD 1U3HB 1T1ZB 3NVQA 3PL6A 5MHSD 3EDEA 1K5NB 5FYKD 1OOAA 1Q94B 3RNKB 3TVMA 1TZHB 5B8CA 3MFGB 1IL1A 1BZ7B 3D6GA 4ZUWA 1YNKL 3MRRA 4LLAA 5L8LB 1XGQA 5KSVA 2QQKH 3PGDA 4ZOBA 3FO0H 4J1UB 3QQ3A 4LLDB 1YN7A 1X4YA 1D3CA 3EDDA 4APQD 2ZSWB 3O2VL 5T3XL 2IFFL 1ZAGA 5IHZB 4ODHH 2Q6WB 2IH1B 1DQQB 1X5HA 3QFJD 2BSTA 3QIWD 1QLEL 1F4WL 4A6YB 2V2TB 2YRPA 4U1SA 5D5MA 1RULH 3RVXD 1G9ML 1HHGB 3L5HA 3EYVA 1N3NB 2BVEA 3HG1A 3QHFL 5GS0C 4MCZB 4OFVA 2ZCKH 2WUCL 4P5MB 3Q3GB 4O02H 2H9GA 5IB3A 5BV7C 2WWKO 3FOLB 2D7PA 4S2SA 2C3VA 1BVLA 1M05A 4QRTB 2ZNXA 3H3PL 2XIDA 3UC0H 3IDXH 1IQDB 4HCRA 2W07A 1GOGA 4NQDA 1YMMD 1EEQA 1VFAA 1P7KB 3O3DB 2A6KA 4S0SD 4I18C 3DSFL 5BO1L 1WEJL 3HE7D 5SWSA 2YUVA 5D72L 1DDHA 2Q1EA 4YAQA 4ZXBB 3ARTA 2KQNA 2DYPA 2ITDA 3EOTH 5E1AA 2ZOLA 5CLWA 3MGAA 3EO0A 2F19H 4PS4H 1PZ5A 4IMKA 1WFUA 3VFMA 4EDWH 4EIGB 1UM4L 4BQ6A 3C5ZC 1EVUA 5ISZB 1KIRA 3GSNB 2VDLH 5DJ8B 3OKKA 4OF7A 1KIQB 4QYOA 4XNZC 3OBAA 4X7SL 2B1AH 4ZAKD 5F6HJ 3WMSA 4M43H 1YY8A 2IH3B 3WLWD 2IGFH 1GZPA 4ZFZB 5BV7H 1A21A 2BNUA 3DMMD 3QNZA 5JOFA 1CGXA 1HNFA 4N8VA 4ZODA 1DVFD 4WDIB 5IB4B 3MRFB 5FYJD 4WWKC 2G2RB 5EU5B 1JWUB 1H3VA 3PV6B 1BD2B 4AENB 2QSTA 4J8RB 3GBMH 2H6PB 5KSUB 3TLRA 2VXUL 4Y2DA 1KN4H 2YUZA 3DO7B 1OSZA 5GRVK 3C6LD 2Q6WA 1U8OA 3QNXB 4PJ7A 2ADFL 4JFXA 5DYOB 3GO1H 3OB8A 5D1QD 4S10A 4C56D 4G9DA 4HPYL 1RHHB 3S98A 2IAMD 3P77A 3T2NL 3S37L 1EXUB 3UDWC 5CEZE 4ZS6C 1U93A 2YD8A 3LEYH 2VH5H 2IBBA 1EA9C 2IFFH 1AQKH 1EO8H 3SE9H 4WW1A 5F7DA 1ZLWH 2FX7H 4RMWA 3GRWH 1NMBL 3WYRA 5HHPB 4PJAF 2C3VB 2AKRA 2R0LL 2NNAB 3KPMA 4LCWD 5C0DA 1OARL 2Z91B 2VDOH 4ZSOE 4EN3B 5T5NF 1OPGL 1YEEL 4U7MA 4EXPX 4HJGA 4QRPB 3WFCL 1OLLA 3ET9F 1ZLVK 4O2CB 1NUNB 3R0NA 3F7VB 3LH2L 4XMKL 4Z18A 3O0RH 4LCUA 4EVNB 1T6WA 2WQRA 5IKCA 4PJAE 1CE1H 4LLMA 1AGEB 2VXVL 2DL2A 1AE6L 1GZQB 2R2BA 2IG2L 1T89A 1KCSL 4QRRB 2X4RA 1ZHNA 3I2CL 4MDJA 4QXWA 1S9KC 2MPAH 3QUXC 1TTGA 5I19L 4LP5A 5GPRA 5BVPH 4U1IB 3BAEH 1T04B 2X6MA 3AREC 1X7QB 1RZFH 2EE2A 3MV9E 4HJGB 4QRPA 5IEKA 4JFHE 3VMPA 5JZ7C 5KVEH 4XPGL 2A38A 1FH5L 2YC1A 3JZ7A 3QEQA 4U2ZA 1QBML 2R8SH 1JN6A 1UZ6F 4Z95H 4F7EA 2VSCA 2NXZC 4NIKB 5D7KE 5ESVB 5EOCH 2BXZA 3JXAA 1TJGH 3HNSH 3QXAA 1FZMB 3K3QA 5D70L 4KZEL 3HPLA 3WKNA 3C08H 3O6MH 4ZNEA 3O6LH 1FYTB 2G75B 3BYYA 1F3DH 3FQUB 4QHUB 4XAWH 4I3RL 5E00A 4NQCE 2B1AL 1UZ6E 4ISVB 3LZFL 5E1HB 3S6CA 4PJAA 3AB0C 4DFIA 3FQRA 5J6GA 2XQYG 3S3JA 4APQA 1EXUA 3VXPB 1DEDA 1NBZA 2EXYC 8FABA 3CZFB 3QCVL 3I6LD 3NABH 4X4ZA 2JJTA 3T3PE 3O4LB 3OG4B 1RU9L 3LEVL 5DMYA 5J57B 5MEOB 2VDMH 4WI5A 1QFUH 3MLVL 4R6UA 3HE6C 3SEPA 1A4KB 5ETUA 1W0VB 4GRWE 3BZFB 5JW5A 1RK1B 1UH4A 4FQLH 1SYSB 5TDNB 4F58L 2YHGA 1MVUB 2AKRB 3P9WB 2I07A 4D0CA 3KYNA 4XH2B 4F33A 4PB9H 5GSRA 4PUBL 2HLFD 3HG1D 1FVEB 4XPFH 1LEKA 1HEZA 1U41A 4NCDA 3LDBC 4LASH 1J0KA 3ULUF 1WIPA 3MLTA 3OV6A 4LIQE 1K2DB 5KSBB 3D2UA 4NNXB 2AERT 2E6JA 5EC2A 1ZHKB 4U0RB 2XWJB 3KYKH 2J12B 1MH5A 2AGJL 2WBKA 4Z7VF 2G5RA 4RGMC 5JIPA 1CG9A 2NY6D 3D48R 2NXZB 4G6MH 3RJQB 4NQED 4OCWL 3TT1L 1JYWA 4DZBB 2ORBL 2XZQH 5E1AB 3D39A 2OL3B 3RRQA 3QIBD 3V8CA 3G6JF 1UACL 1E6OH 1CFSB 3MJ7A 5E6IA 2ID5A 4BA8A 5EBLA 4BSVA 3DX8B 1DQLL 1BX2A 4I0PB 1WBZA 3G5YB 4KTDH 4JM2D 4XCCL 1KCSH 1IGJA 1GOHA 3HB3C 3QQ4B 5DWUL 1KCRH 3S35H 2FGWL 4QRRE 2VE6A 2Z31B 2ZUQC 3VRIB 1RY7B 5J13C 5KSAA 5CSZB 2KBGA 5IW3A 1LO5B 1RUKH 3VJ6A 5CJ5A 2GY7B 1RK0B 4NWTH 5F7EH 5MEQA 4QKXB 3FONB 2VLKA 5CZKA 4CAGA 5AAWA 1DLFH 1XF5B 4M5YL 4NC2B 2EYTB 5SX5H 2R8SL 4K8RD 1H15B 4PJGF 3DV4B 4ZUVB 3BQUA 4BJLA 3REVA 4ONOA 3ECBB 3N1QC 4AK1A 1H9VA 2DQCH 4I0CC 4OCXL 4WI2A 5ID1A 3O4OB 4RA3A 2BHZA 4YDIH 3GGWB 4XXCA 5TGBA 1RK1A 4U3CA 2Y25A 4K7PH 1D5ZA 3LMJL 3VD7A 3ARZA 4L8CA 4G42B 1KENH 3ARDD 2WZPD 2EYRA 1MWAA 4OZGB 5F1IA 2NY1B 3AFLA 5IV2B 5IQ7L 3QIBA 5IR1B 5EBWA 1KCVL 4ZQKB 4LLUB 2B4CL 1JV5A 1ZVHA 3RY6C 5C70A 1QFUL 1HI6B 1D5IH 3QISA 1Q94A 3SN6N 4HAGA 5DFWH 1NGPL 1BD2E 5DLMH 4JZJA 2DQIH 5IF0A 4D2NA 3KYAA 4DZBA 1AD9B 3VWKC 1A02N 4PBWD 4NFCA 4LLVB 4A2MA 4WI6A 4WUKH 2BY2A 4XP4L 5E95B 1E0OB 4X4ME 3UTSD 1HE7A 5BZDB 3QEUB 4HWBA 3TC9A 1ERNA 4HS8L 4PUBH 3SE4A 1L7IL 1MCPH 5MENE 4OZHE 1A7NH 2FYYA 4WWKB 4EI6B 5I1EH 5GRWA 5HGDB 2P44B 1JGDA 4K3DH 1LEKB 2X42A 5DD3L 5FECB 1K4CB 2HMID 4LPUA 4N8CL 1PKOA 2QR0B 4ZPVB 4WRLA 2VDNL 3U2SB 3MV7D 1KJMB 2BNRA 3HA0A 4IRSC 1GGBL 2F58L 3QIUB 5BJTB 1EFXB 5ETUB 2ZP0T 2VWEE 3BEWA 2M8XA 4RFOH 3QEQD 4PJ9A 5LJYH 5HGHB 3F58H 1EV2E 2PYED 2QHLA 5FGCE 3IKKA 4NQSB 3VXMA 4PP2B 3L3GA 4O58L 1Q1JL 3HNTL 4OUUB 3SE3C 2J5LC 3QDHA 2HVKB 3BP5B 2HTLC 1QKZL 2DBLL 5K59F 4ZXBC 1EFQA 4I3SL 2HFFB 4HIEB 1IQWL 4YHYC 4K2UH 1ZS8A 1FSKB 1GHFL 2NXYC 4MJIE 4ZTOH 5IB2B 3MRKA 5IHUL 4IM8A 4X4XA 2W38A 3EOAA 4XNXL 3Q1SH 3DUUA 4TNVK 1FIGL 4RX4A 5FF6B 1JMZA 1EJOH 4NFDA 4C56B 1F02I 4LSPH 3VA6A 4ZFFB 4POZC 2A74A 2GHWB 5DEFA 2CJUH 3SGEI 4D0BB 5F1IB 3RDTD 1J0ZA 4LOUD 4LNVA 4NYLA 4G9DB 1I1AC 2A6IB 4Y4KB 1QFPA 3VW3H 4R3SA 2J8UE 4PJHE 2R0KL 2DLHA 3QUMB 4GQ9H 1QQDA 1KEMH 2R4SL 1XF3B 1F6AA 1E6JH 4TSCL 5CJBA 4CVZB 2A1WH 3MV8E 5J11C 2A83A 3EO9L 2W0FB 5BW7C 3FO2A 1NCAL 2FWOB 5F88B 5F8QC 3TBTA 1J8HE 1TCRB 4HKJA 4Y5YC 4N8VB 2I60H 4PRPB 4OZ4B 5DMIH 4MAYB 4QTHB 5KANI 1F4WH 1AI1L 4PRIA 1IGJB 5I1GH 3MCKA 4H20L 3SOBH 1ITCA 1T21B 2IGFL 2JELL 3WIIH 3QUML 4N0YH 4DKEH 2W0KA 4N0CD 3UAJD 4UOW0 4JM2A 2NY1D 5F96L 1L6XA 1RD6A 2IBGA 2WUCH 1IGMH 3H9ZA 1G7PB 5DQ9A 4PJFF 1R5IA 1JZ6A 1HXYA 5I8EA 3EJZD 3L5IA 4LDOB 5IMLA 4TVPE 4GKSA 5EU3B 4TULL 2QQLH 4J3UA 3L3IB 1NJ9A 5SWZD 2XFXA 1ZHLA 5D7SH 1PG7W 5D7IF 3C60C 4MGXA 2HYMA 4U6XA 5D72H 4JO3L 3ZYOA 3BQUD 4O58H 4JFEB 3TZVA 3QWRD 5E8NA 1A6PA 4Q0XH 1A14L 5FDWB 3ARBD 1G6RA 5D8JH 1AIFA 1PG7H 1J12A 3AS0A 3T09A 1DUZB 5EUOA 3MOQA 1NFIA 2JIXD 1U58B 4UAOC 1FFOA 3MNWA 4M6MH 5C0FB 4G7VL 1G9NL 3CFBB 4K3EH 4IBLT 4MB5A 1LE5A 4EVNA 4WV1A 1S9WB 4QHNA 1I8LA 1QBLH 1T1YA 2AJ3A 3ZMRA 4E41E 1I75A 5K9OA 4Q9RH 3ZDZE 4FQJH 4YHMH 4KRLB 4KPHH 3TVMC 1TTFA 1R3KB 2AP2A 1QR1A 2FB4L 3HC4L 5IM7A 5C71A 3B2VH 5D96C 4Z7VE 1P84K 1TVBB 4IOFD 3Q2CA 3N85H 2UWEE 1MCEA 2EDKA 2QL1A 2R4RH 1EEUA 2IMNA 4OZ4A 3BH9A 1RJZA 2JCCF 5T3XE 2CRIA 1F97A 1EO5A 3C6LB 5I19H 1PYWB 3RVVC 4K7FA 1RURL 1CZ8L 4GAYA 5E7FA 4KK5D 1B0GA 3ZYZA 4O2FB 1E6JL 3K1DA 2ED8A 4Z78A 5CFHA 3VI4F 4YZFE 3TIDB 3SQOH 3VD5A 3Q3GA 2DM7A 2A9NL 2KL6A 1QSEB 1X5IA 1WZ1L 1EGJH 1MJJB 5T3ZH 1OAZL 2HAZA 3HMXA 2CDGA 1EPFA 3VFTA 4E9LA 5FYKH 3F7RA 4YQXL 3PP3H 4P23D 3GRWL 4M3KB 3HUJE 4PFEA 5D1XD 1NBZB 5F1NA 2R29L 3HRPA 4RFNB 4QRPE 4G8FB 3WFCH 4U1LB 2KZWA 4TYUA 3R1GH 4LLWB 3P0VH 2P1YA 5DQDH 3I6KB 4MLIA 5F7WC 4UDUB 1CDCA 1GGTA 1I9RL 3RP1A 3WIHA 2APTA 4ZS6D 5CGMA 3TN0D 5DJ8A 2VC2L 4F3FA 3FAWA 4FTVB 5JR1L 4XPTH 4XVTL 5J13B 3ULVE 2C1PB 4PJFB 1IAMA 5H8DA 2JE8A 1T1ZA 4P49A 4Y19E 3G6JA 5GGRY 1IGIH 2GT9A 1FORL 4I0PC 4X6CA 1QBBA 5KVEL 2E9BA 3NFPB 3EYSL 1AGDB 1YQ2A 2FHBA 5JHLL 4HCRH 1PD6A 1NFDE 3RDTA 4Z95L 1A14H 4OD1L 4TUKH 2DQGL 4NZRH 4HSQA 1B0WA 3NMEA 3K8KA 3U7YL 3DECA 3UTTA 4Z77A 1S8DA 5EOCL 1BOGB 1ZT1B 3CFDB 3HUJA 4DGIH 5IR1A 4DUWA 4NWUH 1K8DA 1NDMA 4M6ML 3UZEA 4DWHA 4QNPF 3KPQA 5GS1A 3G6DL 2FO1A 4NJAL 5DUBA 5IW1B 4UBDC 3QA3A 1ZA3A 5E9DA 3FB6A 4LRIA 4MZ2A 4U31A 4OI7A 5J9PA 1MPAL 4I5BB 4J2XA 2AK4B 3CX5K 4O2FA 4F57L 1Q0XH 5B22A 1WTLA 3QEUA 2YPLD 1BZQK 4FQXD 1HQ4B 5MEPB 1CXIA 5E2VH 2H32A 4PRDB 5GGQL 1HINL 3VFMB 5IFJB 3ZDXF 3RVTC 3MNZA 1T0MA 1KIRB 2IADA 3GSNA 4XNYL 1DUYB 3L3KB 5I8OL 3S9DB 4B41A 1OSZB 1S5IH 2D7QA 4OCSL 5EBWB 1DLFL 5T1MB 5ITFA 3IDYC 4MNHA 4OJFL 1T1YB 3IFLL 1UA6H 4YK4C 2LVCA 1WZ1H 4NN7C 1IL1B 1BZ7A 3D5OF 2OR9L 1A6AB 3LY6A 3KHOA 3P9MB 5SWSB 3JVGC 4G42A 4J8RA 5DZOA 4EN3C 2X9WA 2VWEC 4PRAB 3V6ZA 1GCFA 3VFSA 2FZ3B 3TGXA 4S1DD 3IU4H 1EFXD 4K7PL 3SE8L 3L3OB 5LKNA 4NQEE 4NM8L 5JUEL 3TZVD 1S7XB 5T1DH 1UACH 1FL5A 3FTGA 5ISZA 5JW4M 1JF1A 3D85A 3DV4A 4ZUVA 1BQLH 5J1TC 4LAJH 4EDXA 1P7HL 3TYFB 1P84J 5IQ7H 3MODH 5IGXH 1NUGA 1U8IA 4GRLD 3CVHH 2BVOA 4XCCH 3WO4B 1UEMA 4XPBH 1YUHA 5D7JB 5AZ2H 4RGNC 2NPLX 3OWEA 3MLYL 5JPNA 3P9LA 2WIMA 4GBXD 4P2OD 3TO4A 1VKXB 1OGAE 2DQIL 2YN3A 5DS8B 2VIRA 12E8L 1PZUB 4ZDHA 3HFMH 4DKAA 3VXSB 3B8SA 5I74B 2P8MA 5IBUB 3OPZH 4HS3A 1BIIA 1UXWA 3RVWC 1FZOB 4F15C 4Z7WB 4OLWL 1EBPA 1JWMB 1KB5L 1FNGB 1SJHB 1MJ7L 2E8ZA 4C55A 2W9EL 4BM7A 3RI5K 3O9WD 4U49A 5KN5B 5JORB 4JKKA 5IOPA 1G7MB 5CMAA 3C5ZA 3ARBC 5FO8A 5L6YL 1A1NA 2IADB 4Q7DA 3V6OA 3X17A 1CTOA 1AO7D 4Q6YA 5HI3C 4BFEA 3KPSE 4QRUB 2H32B 4PRDA 4XP5H 3I9GH 1KENL 1T0MB 3MV8A 4MHHI 3QHTC 2GEEA 1HH6B 4DEPC 4TSAL 3QI9C 3REWB 3KLHC 3AROA 3OG6B 1FLTX 1UCTA 3VG0H 2Y36H 3DURB 1VACB 2VKXA 3B9KC 3QDMA 1C1EH 2GFBB 2AV7B 5DC4B 3CPLA 5HHMD 1HHHB 1SJEA 2WP3O 1F42A 4HS6A 3O6FB 1UB6A 3R06A 4PJDE 4OGZA 3BPLB 4XMPL 1BM3H 2I26N 3RL1A 3OTTA 2IWGA 4NKDB 1D5BA 4EDXB 5B8CB 2R2CA 1NBYA 5K9JH 5E5MB 2JTDA 2DMBA 1RZ8A 1MCOH 5T1MA 3NACL 2FATL 2DWDB 2WUBH 3MJGX 3LDBB 4ZO7A 5GGUB 1T22B 4YDLB 3L7EA 4M43L 1GGIH 2JJUA 2BNQB 2CRMA 2HFFA 4HIEA 3GSQB 1RHFA 3LQAL 5D93C 3LB6D 3SDYL 3MFFB 4HFUL 2EEBA 3HCVB 4U6YB 5TF1H 4K3JH 4M5ZH 3C5ZD 4M61B 5HGBB 4NO5B 1FQ9C 4XVUD 5C0JB 5E2UH 4WW2B 5E8PB 3IF1A 4Z7WA 1UM5L 1FAIH 5GZOD 3JUZA 4N8VG 2UY7A 4HJJH 3VXSA 1BQLL 3MYJA 1KJ3L 2VITA 1ZLUK 1NAKL 4Y5VC 3HC0A 2EECA 3MV9D 5ESQB 1QFHA 3DGGA 2FX9H 5KBNC 1RIUH 1OAXH 1EO8L 3U7WH 1QR4A 4PRPE 3UXFA 3WIHL 1H8OA 5IHLB 1T6VN 1LD9B 3G04B 3RPIA 2HJLB 4W6YB 3VI4E 3QUYA 1UH2A 3N1FC 2OZ4L 4URTB 5ERWB 5FCUH 5EC1B 4MDJB 3QUZB 2NR6C 3EYOB 3S5LA 1FPTH 2BNQE 3C9NA 43CAA 3MV8B 4WFFD 1ZWIA 1DVFB 2JELH 3KPSA 2D0FA 1KFAH 1NGQH 2A77H 3DTXA 4XGZB 2HFGL 3SGKC 4MDIA 5F96H 3SGDI 2XA3A 1R3LB 2WBJC 3TIDA 4KKAD 2X70A 3NN8B 5D7IB 5E08L 4JFFA 5FA4B 3I2CH 5D6DA 4PY7A 5IW6B 2PXYB 3GB7B 4HK0A 3BRGC 3AREB 1NGWA 5ICXB 3V5HB 4P4KA 3H9SE 4NKDA 3ULVH 4UTBH 4QF1B 2D0HA 3VWJC 3MROA 1P5VA 5IVXE 1OAUH 4PJGA 3VI3E 1RZFL 4ORGA 3JBG7 2V7HB 5EU6A 1ADQA 1BIIB 2Q7YB 3U6RB 3GBLA 3TF7C 1V8HA 2LABA 1NBVH 2O5XL 2O5YH 3ZKNC 1JHKH 4ELMA 5GHWH 3HNVL 2H26A 3IAQA 3MJ9A 2MKWA 2PTVA 1QBMH 3U46A 4HBCL 1GJIA 4JFYA 3KG5A 4PJFE 1GAFL 4AIXA 4FA8A 3TIEA 4JJ5A 4XAKD 4W4OC 3U9UA 3HI6L 4Y2DB 2KDGA 2VAJA 1BD2A 3RY4A 1NANI 5L8JB 1QEWB 4MB4A 5F9OL 5DFTA 3MBED 4FXGA 4C4KT 3B9DA 4UIMB 1QOKA 3JWDC 4CN4A 5FDWA 4I3RH 1AQDA 5SWQB 4XH2A 3QZWG 1IT9L 2VL4A 4K7FB 3CNKA 4M62H 1A1OA 4ZFOA 1GZPB 4ZFZA 5CEZH 4L4VA 2DD8L 3HKFA 5BQ7A 1S8DB 1FFPA 2ZWLT 2FBJL 1LO3L 2DQFB 2OTWB 1MIMH 1RURH 4TNWF 1F4YL 4LPWA 1LNUB 4TOYH 3HE7B 3HE7C 3FCTB 5HHXL 5TGBB 3I75A 2FSEA 2GQHA 1E4JA 2Y5TB 3U4EA 4WFEE 2N1KA 4L8BA 3LD8B 3IETB 1NGXB 1UXSA 3SKOA 3UO1L 3FFCE 2EYSB 4Z76A 4JFDA 2Z9TA 4I77L 5FYJE 2IAMB 3DX9B 3U36B 4BZ2H 1DFBL 2ICWI 1C12B 3BVNB 3QULA 5D1ZB 3BH9B 2B39A 4G7YL 5KW9L 3D69B 1UJ3A 2F8VA 3DX7A 3WFHA 4E41D 2UY6A 1YJDC 2KQMA 3QXDA 4GBXC 1EH9A 2AEQL 3LRHA 1ROWA 3MLSL 4P2OC 5IW6A 5B38B 5CZVH 2VR4A 4JRXA 3MGOB 3ZDYF 5CP7B 2Y5TA 4JB9H 1SYSA 2QJDA 3DMMC 5TDNA 3FB8B 2AJZA 3FO2B 5D2NE 4NPYA 4R7NA 4MS8C 1ZGLA 5LBSH 1WZMA 3P30H 1EK3A 1HHJA 1P9MC 5DJCA 4GSDL 4ZUSB 4OCYL 5E2TH 35C8H 3FOMB 2P5EB 4LDEB 4U6VH 4BUGA 2EEDA 2RHEA 4QWWC 4M9PA 1KC5H 1KLGB 1MAJA 2XKNA 1DN0B 2JJWA 3C87A 1UWXH 4HAFA 4Y5YA 1QPPA 3PWLB 3B43A 2YR3A 4Z77B 3QCUL 3JWDH 1JNNH 5FEBA 5F7KC 1XGPB 4GG8B 3FQRB 1RVFL 3VCLB 1IM3A 5E70A 2HT4C 1CU4L 5T3ZL 2JJVA 1ZHBA 1NAMH 1ED3A 4KDTC 4OTXL 3AAZA 5AWNH 2DI7A 3RNKA 2Q3ZA 3VA2C 4LBEB 4LHUG 4H26A 4ESKA 2BCKB 5ESAA 4B53A 3MLXL 3TYGL 3P0YH 2AJXH 1MFBH 4LPYA 4WO4C 3IU3B 1DP0A 1W0VA 2UVFA 1GIGL 4KXZH 4R0LC 3KPNA 3U4EB 4OZFB 2OTWA 1U8PA 4XZUB 3D39E 4ORGB 1OY3B 3WKML 2C3XA 3MV9A 1YJDL 5D9SA 1QRND 3SDXA 1X44A 4N0UA 4OIBA 2FJHB 1MRDL 4V1DA 3P4OB 4Z8FL 1LDPL 4P99A 4RMVA 2ADGB 3P4NA 5BCAA 1XGUA 2X4SB 5JHDA 5F3BA 1P2CB 1C5BL 1GRWA 1RZIA 2EE9A 4OF6A 4AEEA 4IMLB 5ADPH 1FORH 4WGWB 4O2CA 4ZNEE 5JDSB 3X3GH 5D2LA 5C0BD 2BRQA 4OCSH 4IOIA 4K94L 5CSGA 5CEXA 4RMUA 2VTFA 5C0BE 3QPXH 1J1OL 3ZHDA 2Z4QA 1CLOH 4DGYL 5I1CL 3W5NA 3SHSA 2XG5A 3OJDB 4O4YH 4HIJB 2R1YB 2NX5A 4OKVA 3PHOB 4XB7A 4P4KD 4L9LB 1X5ZA 3NCMA 4XPAL 3PWUA 4PJHB 3O3BA 3MACH 1I9JH 4DW2H 1N5YH 1INEL 2IBZX 4XTRD 1VGKA 2DQDL 2YKLH 4X0KA 4AEIL 2AJ3B 4RZCA 4Z0XB 4QTHA 5DURD 4WCYH 4NHUB 4BKLA 2XTJE 1QUNA 4RFOL 2I9LB 4NRZB 1CGVA 1H3PH 2JB5L 4JCMA 1VSCA 5BS0A 4HMCA 4Y2OA 5FV2A 3QI9B 5EUOB 5KTEL 2P42B 4V1DE 5JOFB 2P43B 1DQMH 1N6QL 2BNQA 5I15L 1Q9LB 3PGFL 1ONQB 3B9KA 3OPZL 4YWGH 4FABL 2YUWA 5ACLA 3HG1B 4NN6C 5DRWB 3T0EE 4X4MA 1IAIH 4H88L 5LGJB 4DUVA 1HK6A 1I9EA 1LO0L 1RZ7L 1Z2KA 5I1HH 3Q1SL 3MV9B 4L9LC 1AFVL 4D3CL 2YEZA 4JFZL 3MCLL 3X12B 3OAZH 1WCBB 2PF6A 1N6UA 1CR9L 3ZKSD 5D71H 3VXSE 1IEHA 1U91A 4I18A 1RUMH 3QDMB 1DDHB 3RHWK 3VXRD 3QHZH 3STBA 3GM8A 1B3JA 1DBMH 3CSYB 4WEUD 5B39A 4AIZB 2BDNL 3KNBA 2XOTA 3LKOB 3LKSA 2QHRL 2BVPB 4C59B 4PRIB 4AM0A 2XA8H 4S1SL 2ESVA 1JWUA 5I6XC 4L3AA 5F6IC 5CBAB 2E9JA 5DJXA 3QRFM 5J12B 4X83A 1P6AB 4WHTA 1T1XA 2A2QT 2BFVH 3RA7L 2I60L 5EORH 1R0AL 1YYML 2V2XB 5C08D 5GJSH 2FEDD 4XMPH 1MFEH 5LXGH 4BK4A 1HXMA 2FO4A 3N1PC 5LWYL 2C5DC 5CEYB 5C08E 1X5JA 1HZHL 3QG6A 4JFED 4B5EA 5BW7A 2CIKA 3PGCB 5FO7B 3RL2A 1CYGA 1ZHLB 5DJ2B 4N5ED 3SO3C 4KRPD 4GW4A 4GUPA 2ATKB 1KT2B 1MHCA 3G04A 1X5GA 3NPZB 3DIFA 3DUSA 4H20H 3SOBL 4YEEA 3BJLA 3QFJB 3M8OL 5JW3H 2IPKA 3BGFC 5L2KD 3LN5B 4C58B 4PJ5E 4X6CF 3M17A 3C5JB 2N56A 4CN6A 2G5BB 4K3JL 4H1LG 1IGYA 1A7QH 3WEXA 5MI0C 1INEH 1ACYL 1OD9A 4MAYA 3CSBA 2DLEA 5EBMA 3NA9L 4AEIH 5KS9B 3C6LC 3JV5A 4JFFB 2Z8VC 1MOEA 3CSPA 1PBYA 1IAII 4GKNB 2NY5H 4K55A 1OTUC 4CJ0A 2CLRA 5F7MC 4RGOL 3WNLA 1VESA 43CAB 1NAMA 3V6FA 5EDXA 3OGCB 5INCA 3RUGB 1OB1B 2F9BT 3AB0B 3B2UC 3V4PL 4QHMA 4WO4B 5GXBB 2VQUA 2PKDA 4AL8H 2IQAA 2VXSH 3CSYA 5B39B 1C16A 3BGAA 4K3EL 4KQ4L 4YFLI 3P9LB 3TBWA 3TO4B 2ZSWA 3MLRL 1VKXA 2DOCA 5JDSA 5DRZA 2P5WE 5BRZA 4HZAA 2RR3A 1P5UA 5IBTH 2BVQA 3QIWA 1YEHH 4ELME 1T5WB 1JZ7A 2A74B 5C0BA 3SDDA 1HXMB 5H2BB 1XH3B 1ZT1A 3V7AG 3T2OA 2Y06L 2MNUA 4FMFA 2BDNH 4P0DA 4PTUB 4JANB 3S4SG 1AP2B 4CDHA 5CCKH 4FQ1H 4RWHA 1RI8A 5IMOB 5J9PB 1QFOA 3VXPA 4HKXA 1S9YA 2XA8L 4S1SH 5CJXC 1KEGH 4OGAC 1UCBH 1RUKL 4JM2B 2RBLA 1FGVL 2BVPA 1N8ZB 4AZ8A 3BI9X 3MRHA 3JTSA 4H8WL 5FFLA 1W72A 4HLZH 2XPGA 4K3HA 4NO0D 5TJWK 3BZ4A 5HY9B 1MREL 4YIQA 4HUUA 1EDQA 3QBTB 4P5TA 2OYPA 4OKDA 3ZE1F 3HRZB 2DQUL 4OCXH 5ITFB 1C08B 5DQDL 1UXWB 3S88L 1DUYA 1KNOB 3FL7A 3ORJA 3T2PA 4POZD 3O3EA 4JKWA 4X6CB 3OR7A 3OQ3B 2APFA 2FIKA 3BW9A 4L29A 3UAJC 3W9EB 1CGYA 1CXLA 4MXVF 4NNYA 5DDHA 3N9GL 2BSSB 4M1GL 3S4SB 3U9PL 2AV1B 3DMMA 2E9WA 4X9GA 3HC3H 2XICA 1JZ3A 2NY3B 3T1FA 2FJGB 3REVB 1ACYH 4MXWL 3HI5H 2BERA 2PYFB 4QO1A 1SVCP 4P3DB 4ODXB 4BZ1L 1JZ5A 1OM3H 3TBWB 4H5SB 1AKJD 3QA3B 2HP4A 4DJMA 2DQGH 3HR5B 2NY5L 3F6IA 1FGNH 2P7TB 2W1NA 3GI8L 3O6KL 1Y18A 5JHLH 3RVUD 3UTOA 4A6YH 1AD0A 4JREC 4LPXA 1YEIL 4LEXH 1CIUA 1UG9A 3RBSA 1A7NL 3SJVD 2GAZB 3E8UH 2EDDA 3V9FA 2AJSL 1JPFA 4E5XB 1CIDA 4Y4FA 4X6CE 3DROB 4DQOH 3V6FB 3WD5L 4HX1B 4JGJA 4OT1L 5IMLB 4O02L 1AJ7H 1CLCA 4L1HA 2ESVD 5DD5H 3BP6A 1FO0H 4KI5D 3H3PH 1L9NA 2Y6SC 2DJ4A 1FDLL 2Q3AA 5FM8A 1KPRB 3WHE0 3MR9A 4LKXA 1QLRA 2F53E 4OLXH 3MA7A 1WZKA 4EUPG 2VZUA 5BO1H 3QXUA 4NM4L 2XWTA 3RKDD 4GO6B 1CDGA 2OL3L 4JJHA 3QG7H 1KLFA 1E4XH 1OWRM 4NO2B 2BVQB 3HNTH 2B1HL 3BIKA 2B20A 4HLJA 5FGRA 3JWDL 1UVQB 4NKOA 5DLML 4ENED 1RUQH 4ZOCA 3CMOL 5E9DB 5IMKB 4YHZH 2IQAB 3SKUD 2P45B 1LE5B 4YXKL 4D9QE 4FFWC 2EIDA 1KXQE 2RAMA 4X8XA 4L4TE 4CU8A 5T1LD 1FIGH 2AVGA 3FQNA 5I1LA 3L3IA 3AVEA 3IDNA 4CDGC 3NFNB 4NHUA 1U8LA 3WCYA 4XWGH 3PWVA 2XQBL 2DIBA 1Y6KR 4PGBA 1IKFL 1CICB 1DVFC 1MUJA 3OKOB 3NZHL 1HCFX 4Z0BH 2PW2B 5CLTA 4NQDD 3DVIA 3S88H 5HYQB 3VWJA 4OKVB 5AZEH 4XCNB 1GGBH 3HRZA 1IZJA 1DE4B 3ILQC 4LSUL 4GAYB 5C0AD 3ZE0E 4OFDA 4M8QB 4WU7B 4MZ3A 2OI9B 4IS6A 3V6OC 2NXZD 5LGJA 2PETA 4XCFL 3TBYA 1MCIA 4HPOH 4HZLA 4QOKB 1VFBB 3TN0C 2PCPB 2X4UB 1FL6B 3DRQB 25C8H 1N2RA 3JTTB 3MREA 4PLOB 3ULUC 3T0AA 1BPVA 4P4RB 5F71A 2FIRT 5EBGA 4ZFOL 4N1CA 1NMAL 1MAKA 1RJLA 2R69L 1URLA 3E2HB 4IDJH 1JNNL 2LAGB 2YK1H 3QNYA 3VD3A 1FZKB 3T3ME 5GS0H 3PQYD 2F5AH 5A2JH 5CP3A 3MLYH 1N59B 4W6WB 3ZT6A 3OAUH 5EIVA 3SGJA 5E4EB 1R5WB 2R9HD 4JO2H 4YFLF 3LVEA 5GGSA 2BHYA 3TYFA 5HHMB 4XNUH 2YD4A 1RIVL 4MJ2A 1AKJB 3ZKMC 2I5YL 1IKNC 2GK0B 5ICYB 3FFDA 2ZUVA 1S9VA 3D3VE 1ONQA 4OZHB 1ZTXL 3PXJA 1G7QA 1JRHH 4M7JL 2VLRD 1UVQA 1FZKA 5A3IC 1VEMA 3Q6GH 4HEME 5BS0B 1ZVSA 3JSSA 1A6WH 3BKYL 2C3HA 4HWUA 5L2JB 5JOPD 4GRMB 1MCBA 2FX8H 5TE6L 2IANA 2VISA 1EHLL 3GSRA 5DVOA 3MR9B 4LKXB 4JY4B 4UQ3A 1MI5A 3MRBA 5EUOE 4P5TD 2CGRH 5E6ID 1U6AL 2QSCL 4OD2B 3FN3A 1G7JA 1BQHA 3TH4T 2J6EA 4GMTL 2ITCB 3H2WA 1TJGL 3HNSL 3WJLC 4PD4J 1H3WM 3PV7A 4PJXB 3BD4A 5FUZH 1J18A 4JPIB 4Q9CA 2ICWA 5A43C 3MROB 1TZHA 3R0MA 3E0GA 5EIIB 3DO7A 1FFQA 3KPOA 4UB0L 2I27N 4IOSD 2IC2A 1F90L 1B9ZA 3VG9C 1ODAA 3CC5B 5C0EA 1IKFH 2XN9E 3BPOC 1JPSH 2FEEI 3DXAA 3NTCL 1QO3B 2WUBL 3VFRA 2D4FA 5JO5A 4P57A 2ZKHH 4P4RA 1DQDL 2DQDH 5L88H 1GC1C 4X8JB 5B38A 2Y6SD 1YEJL 3SGDH 4YX2H 3O2WL 5FHAL 3QUYB 1BQUA 5F7DB 1INDL 3OKKB 5GGSB 3OKMA 5CGYC 3DARA 3BOVA 2EYSA 1NCWL 2SEBB 5FUCC 3TT3H 5KVGH 1CZ8H 3U4AA 4APQB 3IFPA 4GKZA 4HPOL 1FNSH 3B83A 5A16A 3QJHA 1T20A 3IU3A 4Y4FD 4YE4H 1QSVA 4Y4KA 1A1NB 5I15H 2R69H 1G1YA 2AI0L 5C9JA 1YDPB 5KAQG 3UPRB 4XBGB 1MUJB 2B0SH 3O2VH 3VRIA 4DK6A 3AREA 5ICXA 5A2LH 3H9SD 4ODTL 2A6KB 3RWIB 2YA2A 4I13B 3C09C 5INCB 3MSPA 5ELIA 4DK3A 5E08H 4RISL 5DFVD 4AEFA 1MQ8A 1CR9H 3GBNL 4FQJL 1I3UA 3KYOB 2FWOA 1NGQL 3DHJA 4PY8I 1R24A 2WLYA 2N7BA 1GGCL 5L7XL 5ICYA 1I4FA 5J8OA 2PW1A 3EYQD 1I9RH 4EEEA 4UIKL 2HLFC 3LRSB 4NQCA 1DBML 4CMHC 2R2HB 3ROOB 1KUMA 3MBEB 3OAYK 2VDPL 3RX8A 4UTAL 2Z92B 1IEAB 5B3JF 1QFWM 3U9UB 1KIQA 3BKCH 4QYOB 1MNUL 5ENWA 1U8PB 4XVTH 4XZUA 4ACPA 4KROC 3MOBH 3W5MA 5C0ND 4WTZG 1QHOA 2WINB 3JWNC 3QDGD 2ICWJ 3O4LE 4NWTL 4LRNL 5F7EL 4TPRL 5TE4H 5GHWL 1E4WH 3IRPX 4NGHL 1KTDA 1U8QA 4YDJB 3LQZB 4KUCD 4ODSH 4ZPVA 4L29B 5BRZE 4YH6A 4H1LA 3D2UD 1PYWA 1EGJL 1S7WA 3PDGA 1BAFH 3QQ4A 3NCJH 5EH1A 1FVCB 5D1QA 4RGMB 4NO5A 1OCWH 5GISH 3V4PH 1P4IH 4YUEL 5FCSH 2VZ1A 1IEAA 3MA9L 2V2WB 4IEFB 3PGDB 3RNQA 1DL7L 3FOLA 4S2SB 5IJKC 3RI5F 3UJIL 1CL7I 1TITA 1FHGA 4ENEC 4H0IA 4LGSB 1NCDH 1JF5A 1OAYL 2GJ6B 5IB2A 4WVRA 1JTTA 5CEZL 5CBEA 2P48B 3RZCC 3WDHA 4CN1A 5C86A 5F7FA 2FJFA 3GMMA 4HKXB 3VXNB 3ABZA 3UBXG 3JV4A 5F3HB 3JWOL 4Y16D 1LO2H 1FZMA 3G08B 3GMNB 3MOAH 1C5DA 3ARFC 5KOVC 2ZSVA 3P2TA 1FC1A 3PV6A 4O9HL 3MLZL 4JE4B 1NCWH 3V5KA 5I8OH 4AMKL 3EYFA 1N4XH 2BY1A 4X9HA 2CR6A 3L3DA 4KJYB 5D2NC 3V2AR 5F3BB 2PTTB 3ZTJH 3VXNA 4L3ED 2Q76A 2AI0H 4NQCB 2EDJA 4ODVL 3RWCA 2VDRH 3ETBF 5DO2C 5HHOE 2EDWA 4YC2B 4OF8A 2ARWA 5EO0A 2DM3A 4NNYB 4PBXA 2BXYA 4M61A 5HGBA 1TZIA 1OQXA 3STZB 5CSZA 1OARH 1PGRB 4TTGA 5DR5H 2FECL 5SWSD 4HKZA 1EEZA 4X98A 5EWIL 4JG1H 4TNVF 4L3CB 1VEOA 1G7LA 3B8YA 3AMKA 4GH7B 2VLRB 4WTWA 2DJUA 4HK3J 4XMKH 3IGAB 5LBSL 3G5VA 1EUUA 3O0RL 1I7UA 5HY9A 3O3AB 2DLTA 1YEFL 4FQ2H 4KMQA 3L5WA 5KJRH 4I18B 3IXTA 4YPGB 3LKQA 5GRVL 2BNRB 1T7XA 3QIUA 4JHWH 3BWAB 4WFFE 4V2CB 5DTFA 3MOBL 2VR9A 5IUSA 3D9AL 1TNMA 5BV7B 4QXTB 1D5ZB 4PTTB 5MEPA 3BE1H 4H8WH 4HMDA 3STLB 1DVFA 5IFHH 1MJ8H 4UI2A 4KKBC 5IFJA 1MRCL 4GQPH 4XC1H 1BEYL 2Y4SA 2R1XB 3KPPB 1YYLH 3SDCC 1EAPB 4YHNB 1FE8H 1MFCH 3TBSB 2WBJB 3H3KA 3GMMB 1JN6B 3WD5H 2PYEE 4Y2DD 1T7YA 4GW1A 2J3SA 3DGGB 2CSPA 4G8GD 5IF0B 3KWWB 1HHIA 1Q9WB 3FO9B 4I3GA 4XP5L 3VXMD 4KKBD 4LDLB 3L9RB 3TFKC 4C56A 4MQSB 2XQYK 3E2HC 4UT6L 3GI9L 3EYQC 4DZ8B 4G9FE 5FYKU 5HPOA 5DMGD 3CMGA 5F1OB 2VLLB 1T3FB 1XZ0B 4HGWA 1MRDH 4MXWH 3G5ZB 3DX9A 4GRLC 3ZL4L 1UM6H 1JYNA 5FKPB 3IJHA 1VPOL 3FB5B 5ACMA 4PJEA 4MDIB 4I1NB 4HJ0C 1CF8L 4LVOC 5E94A 5A2KH 5D2LF 3WS6A 1TVHA 3EUUA 4X5XB 3D39B 4FFYL 1BF8A 4RRPA 2BVOB 4JEGB 5DXWA 1KT2A 1BBJB 2FBOJ 4NNPH 4R97C 3GI8H 3RGVA 1PLGH 1YUHB 4RDQF 4Y4HA 4OLWH 5I18L 3FB7B 3VRLF 4LASL 4Y1AD 2CLVB 4HKBA 4JFQA 3L3DB 3FZUD 4Q2ZA 5GS2H 3L95B 1KPVA 5HGAB 2F54D 3ZKND 5FB8B 4IRZH 1T1XB 4HH8A 3ARPA 4TTDC 5ECJE 4Q6IC 2QSQA 4YPGA 1MSPA 4Y5YB 3GIZH 5DJDB 5GS3A 2FRGP 4LSUH 5JORA 3V0AC 4DW2L 1PKQE 1Y0LA 2RFXB 4NKQB 4RMQA 5JQ6L 3MRDA 4JJ5B 2VQTA 3P9MA 3MRJB 2MHAA 3DVNB 5F89B 2C1OB 2Z0BA 4L3CA 3LCYA 1DQML 2GYSA 5I8EB 1QSFD 2Y7QA 3ARFD 4NKIL 5CUSL 2VKWA 2EEAA 4WWID 4OFYD 5T33H 4XP9L 2F5AL 4GRMA 4ZSOA 5HHVH 4D0DA 1FV1B 2GTWA 4CADA 1IRAY 2EDOA 4DEPB 4ZUUA 3L3HA 2GJJA 4UDTA 3H7LA 4HUVB 2NY2C 1QNZL 3UTZB 1MRCH 4XCEB 3EOBA 4M6AA 4LVHC 4QRTA 3MRLB 1IM3B 3G6JE 1AGCA 1OTTC 2YS4A 4KPHL 4Y4HD 4X99A 2EDFA 2D03H 5JW5B 5J4MA 1A7RL 3R8BB 3CUPA 4I8DA 5IVXB 4PJ7E 1KACB 1RHHA 4CUCA 5KZCB 1KLGA 2CMRH 5E99H 2E6PA 3BXNA 4LSTH 3PWLA 4KI5F 3GK8H 4R4NC 4NRYB 3O11B 2CRYA 1OP5K 2UZIH 2CUHA 3CFDA 1EZVY 1BREA 5TF0A 4L3EA 5EZIL 1HN1A 2J88H 3KPRA 1HKLL 3WL9A 5DHVH 1KIPA 4HV8B 5FO8B 3CU7A 5JPMA 4TRPH 1KG0B 2PYEA 3NH7H 3QXWA 4LU5H 3O3BB 1E27B 2B8OT 2O5YL 3JVGA 1CDBA 2WP3T 4G6JH 5ICZA 3K2UH 4Y7MA 4Q2ZB 2MFNA 1NUFA 4L9LA 2XNAA 3OAUL 3CFEA 5IG7B 3ARGC 3LKOA 3FRPA 2AW2A 4BSVB 3QWOB 2I9TB 3NZ8A 1NJ9B 1RIVH 5ID0B 2VZOA 4NC1C 3EDKA 1NMCB 4MNGE 2ZCHH 1IGCL 4EIZC 1ZT4B 4HIIB 3QPQC 3ULUD 2D7OA 4KMLB 5LVEA 5IEKB 4NQUA 1I85A 3L3KA 1NBQA 4M7JH 5DD6A 2OCFD 4J3XA 3NTCH 4WO4D 5SWSE 4HEPG 3QIUD 4AG4H 2BOBB 3ARDB 2PXYD 5L88L 1JZ8A 3K4AA 2AEPL 3IFPB 3MTRA 1OW0C 1WQVT 3BKYH 5F1NB 1CQYA 4KV5F 4ZFGL 5I1AA 2VAAA 3LN4B 4OQTH 2Q8BL 4YIQB 4XRCB 3QDGB 3DO3A 1AXTL 5GGSY 4WUUB 4GXVL 1R24B 4P2RD 4KJQC 1I1YB 1ADQH 5CEXB 2CUIA 3NCBB 4KGJA 4XP1H 3ULSA 4QXUL 3DETD 3MNVA 2VLJA 2D31A 4AT6B 4UIMA 2CD0A 4NQXB 1XF2A 1U6AH 2QSCH 4RMRA 3VXTB 4NOBA 5I9QC 3CFCH 4DN4H 5HGDA 1HIMH 4ZTOL 4WTXA 3UEZA 4GKSB 4G8GA 3RY6A 4OB5L 2NR6D 1CXKA 3I6GB 2WW8A 5FV1L 2H26B 3RDTB 1F13A 3IJHB 1MJUH 4IHOB 4JKPH 4NZTH 5INDB 5IBTL 1S7QB 1WBXA 4P59H 5E94B 1AGDA 2NY6C 2XT1B 3GRWA 5DZLA 1IC1A 3TN0A 1OP3K 1JWSB 1CFVH 1KBGL 4WFHE 2FH8A 1MCCA 4PJ5B 4Z5RA 2NY4D 2V7HA 1YEGH 1JPGA 2P5WA 3BP4A 1CLYL 4I4WA 4JAMA 4MA3B 4WI3A 4G8GB 5BZWA 5HD8C 4FQPA 1T80A 4U6VL 3BZ4B 4WO4A 3MBXH 2R0KH 4GQ9L 4Z7NE 4R0LA 4JVWA 1LO3H 3FRUA 3CFEB 5IG7A 3HE6B 3RTQA 4XGZA 5CCKL 3OZ9L 1TZIB 5DUBB 3HR6A 4U1LA 4YHKL 4TVPD 1RZJL 5K9QI 3WUWA 2HFEB 2H9GB 2UYLB 1KEGL 1Q9KA 3ULUH 5DJAB 1SEQH 2YRLA 1JI1A 1MHPL 1SM3L 1BAFL 3LEYL 4AJ0A 2ZPKH 1FGVH 3SDDB 1LDSA 1JGEA 4KAQL 3QWRA 4F2MB 2LV4A 3QDMD 4ODTH 5EU3A 3GMRB 5IWLC 2HTLD 5I0ZA 3C09B 3GZKA 3O6LL 1S7XA 4QTIH 3VGBA 3DX6B 3PL6C 3KS0H 1GVIA 1MWAL 1U95A 4G6KL 1L6ZA 4KKAC 3LRGA 1S78C 3WIIL 4D94A 2WWKT 1WWAX 1XR9B 1YQVL 4M3JA 3FT2B 3RWEA 1NDGB 4RAUA 2ATKA 3EFFA 4LHJB 3IDIA 3L3HB 1TIUA 3OKEB 3DUHA 2PO6D 4NQEB 4UTAH 1FNLA 2YD1A 3K74B 4LSDA 4MJ5A 4LRIC 1H5BC 4OFKA 1CGSH 4XWOC 2JIXB 5IROA 2KPNA 3CDCA 1ADQL 4FMKA 4S0TD 3HFML 2CIIB 5I71C 1T4KB 4PPTA 3RWJA 4D8PA 4QNPE 2ENSA 2NMSA 4FZ8H 5AUMA 1G7MA 2O5ZL 1OL0A 2NY4B 3RWFB 1D5MA 1BF2A 5D8JL 2UZYB 1OP5H 4K8RL 4JN2A 1MWAB 3DMMB 3QDAA 4MVBC 1YPZA 5F9JA 4KHTL 3WLWC 3EFDH 1HHKA 4MJ5B 4BQBA 5J89A 3DSNA 3C8KB 3T3PF 2G9HA 2G5BA 3CXDL 1H8SA 1NFDF 5DURB 4LQFL 1GIGH 3A6CH 3W39B 4JRWA 2A73A 1IAKB 4GRLA 3IFOB 3RVUC 2OL3H 1SQ2N 3X13B 4B7IA 5D5MF 4JN2B 4Y16C 3IDUA 3VU2A 5C09B 2WQ8A 3FB7A 1RV6X 2B1HH 3HI1A 3MGTA 5DWUH 1Q72H 3EO0B 4PG9A 4O9HH 1JGEB 3QUXB 4JHWL 2QTEA 5F7HA 1PX4A 2PO6A 3CVHA 4IMKC 4MHHG 4FQLL 1N4XL 1TXKA 3S5LG 1BM3L 5B38G 4OI9A 4Z7QE 1EGJA 2P8PB 1MJ8L 3O9WA 5C1MB 4YWGL 2UWEB 1BBDH 4KUCF 1CVSC 3SBWC 5GJTL 1Y0LB 2RFXA 4X9BA 1NFDB 1MIEH 4YHZL 5HYSG 4PJ9B 3ULVC 1KJ2A 3OKLB 3MRDB 2ZPKL 3M45A 5I76B 4X6FA 3FT2A 3PABB 3LKRB 3ZHLA 4HLZG 1A8JH 3EFFB 3UYRL 2AXJA 3LSOB 2ZOKB 3OJMB 3MV01 4JAMB 5DF0A 4JVPA 3VFUB 4YDKL 2FR4B 1NMCC 1KJVA 1I1RA 1T89C 3GMRA 2ADIA 3HPJA 5CJ8A 2PYFA 2NCMA 3FKUS 3WNMA 2VITB 1IGFL 1DEEA 4OLZL 3C8DA 3QQ9D 2EYTA 4Q97A 3GSVB 3FO0L 1TPXB 3ARBA 1V7NL 2BSTB 3KYOA 4XHJD 5AD0B 1NAKH 2EDLA 1NQBA 5A1AA 2DKMA 1OAXL 3V6ZB 4R26L 5GS1B 1KJVB 4P57B 4E5XA 3PGFH 2QKIA 1NDMB 1ZT7B 1NKRA 5LXGL 1YN6A 3O8XD 5J6HA 5EOTB 1K3ZA 4CMMB 4OV5B 2VLLA 1IAIL 1L7IH 1MCPL 2AEWA 5MEOA 3SCMA 2EC9T 5D1XB 5JA9A 4JO2L 3IDMA 3HR5A 1U2HA 2HFGH 5JXEA 5C9JB 4PJBE 1DSFL 1U93B 4BQCA 3AXLB 4HWEH 3Q6GL 4K3GA 1FYTD 3MNZB 3P77B 3T1WA 1HQ4A 4RSVA 1G7JB 1A1MB 1IKNA 2FJGA 5F93C 3DRTA 4BQ9A 3OXSB 3NIFF 4YHPB 2F58H 3QUXA 1QLFA 1G7HB 3QHZL 1MLBA 32C2A 4G9FB 3MCG1 2IALA 1LEIB 1E4KC 1ULVA 3ZTNL 2BJMH 1B2WL 1BOYA 1Q0XL 1U3ZA 2R1YA 3WDJA 4XP6L 4E41B 3RKDC 4EJ1C 1A6TB 1XF4A 4F9LA 1ORSB 1I4FB 5C6WH 2R0WH 3RZWA 5GZNC 1FG2A 2HLAB 1NC4B 4BFIB 3VFUA 3W0WE 1A9BA 3FFCB 5IMMA 1RMFL 3OJ2C 2VXQL 4PRAA 5TFSH 1QACA 4L4TA 4FFVD 1J1XH 2VUYA 3H7BA 4M93C 4QRRA 4UB0H 3JWOC 1A7BA 2R0ZL 1HILB 3V0WL 4I0PA 1UM4H 5KVDH 4J3VA 5GJTH 2VXTH 1U2CA 1VERA 4AEHL 2EIZB 2F15A 4X7SH 3G6JB 3FO1A 4EI5B 1K8IB 4RQQA 3NFPA 4ONFH 1T4KA 5JW3L 5FGSA 5JXED 3HPLB 1YEHL 5EC2B 1T21A 2DBJA 1GPOL 1IAOA 3Q0HA 2FBJH 1G0DA 2L0DA 4WGVB 2V2WA 5GS1C 3GJFK 5C0RH 1M71B 3M17B 4AQOA 1JTPA