3MV8D

Crystal structure of the tk3-gln55his tcr in complex with hla-b*3501/hpvg
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
200
structure length
200
Chain Sequence
QVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQDLGTSGSRLTFGEGTQLTVNPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
publication title Allelic polymorphism in the T cell receptor and its impact on immune responses
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2010-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mv8D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mv8D02
4FQQB 4MNGB 3PJSB 4JE4B 1NCCL 1U8KB 2LABA 4JM2D 3G6DH 2V2XA 5D1QB 5FA4A 5ESQB 1CLCA 1NMBH 2V5SA 3P9WB 4JHZA 4N0UE 3VXME 3RP1A 3L3IA 2VDKH 4XBGA 3CK0L 4UT6L 5EUOE 1PQZA 3BEWA 2EIZB 2ORBL 4JG1L 3RTQD 1OWRM 3EJYD 4PLJD 4QRPE 3WLBA 3U79A 1QRKA 4KRLB 4OLWL 3WBDA 4MS8D 2X42A 1F2QA 1D5BA 5EIVA 1AGEB 1XF5B 1XGQA 1G84A 3F5WA 4WJ5B 5F7WC 4GG6F 1H3UA 5EZIH 4DK6A 5J8OA 5T5FL 2V2WA 2OYPA 1MJUL 1DBMH 3PWPA 2H8PA 1CDUA 1QFOA 3T4YA 4OM0L 4LHUB 3BXNA 1BFOB 3HKFA 3SGDI 5D70L 1R3HA 4YQXH 1KN4H 3BUTA 2XWBB 4JG0L 1FNGA 4NC0B 1CXLA 4JFEA 2MWCA 4MX7B 1D6EB 4ERSH 2ZUSA 1P9MC 1CXHA 3NCFB 4UUJB 4KI1A 5EA0L 4XMLH 2GQHA 1FYTA 4U1LB 1NGYB 4WFFD 5J11C 1MEXL 2E7CA 5CBAB 1H9VA 4BSWA 5KANG 5DJCB 1OWWA 1CFNB 4N9GA 5HY9A 4ELKB 4BH8B 4PJ7B 4PBXA 3KWWB 3OGCB 1MWAL 1S78D 3ZKMD 1TVDA 3MREA 4M4PA 3CH8A 1OLLA 4DVBA 1W8NA 5KSVB 4TTGA 3L7EA 1PKOA 4S2SA 2D9QB 4OB5L 5DHVH 4P5TC 1CR9L 4X5WB 4MNGA 3PJSA 3LMJL 4OI8A 3K1KC 4PJFF 1C08B 5D1QA 1MI5A 3B9KB 3MROB 1KUMA 5ESQA 1HHHB 4LSSH 3BMVA 4K8RL 4RFEB 3LV3A 4MJID 5FGRA 2MCPL 1IM9D 4TRPH 3RKPA 4ZUTA 1I9IL 1AC0A 5AZ2L 2EIZA 4P2QA 2BNUB 4FNLH 3QIUC 2Y72A 1C16B 5HHMD 2DF3A 2KUTA 3OKNB 3JV6A 4WJ5A 3SCMC 4P4KD 1CGYA 4KDTA 2VN7A 5DMKB 5ALCL 2WWMC 4OIIH 5HDBE 1VGKB 5DJ6B 1K8DA 5FEBA 5E1AB 1BF2A 3RUGE 2UVEA 4I1NB 4LHUA 2C5DC 4J6RH 4MAYB 1TENA 3UTTB 2NY4C 1AO7E 4BYHA 2XWBA 1Q0XH 1NEZB 5GGUB 3TBSB 4OCYL 5DQJB 1D6EA 3WE6A 3BZEB 4LEOB 2JCCB 2NZ9C 4A6YL 2G75B 2X1WL 1NGYA 3V8OA 3QEGH 1U91A 2WLZA 4XNYH 5EIQA 4OSUH 5CBAA 3MRCB 2MPAH 4RGOH 4ELKA 1CFNA 4KI5F 3QCUL 4PJ7A 2EDQA 3GSUB 2ZUUA 3KWWA 3O8XD 3OGCA 4JHAH 1IT9L 1OD7A 3AS1A 4LP4A 3PE9A 1QRNE 1DVFA 4EDWL 1FNSL 5KSVA 4NQCA 1DBBH 2VDRL 3ZL4L 4I48B 3C5SB 2VZ3A 5DR5L 1QPXA 3T2PA 3MLUH 4X5WA 4ODVL 4FQXC 43CAA 1JGVH 4X6CB 3UJJL 1C08A 3B9KA 3MROA 3K80A 1F3DJ 1HINL 2AK4D 1NBYB 4RFEA 4ZFGL 5A2JH 2R0WH 1FL3B 4JM2C 5EU5B 1DL7H 3OTTA 3LN9A 3OKDA 3NGBB 4JFQB 5JOPD 4J3SA 1CZ8L 2I25N 3VXTB 3CDFA 3RTQC 3EJYC 3ZMRA 5EIIB 5DMKA 1VGKA 2A6IB 3HC4H 4BH7A 1MLCA 5DJ6A 2LTQC 3C87A 4MS8C 4GH7B 1EAJA 3HUJE 2VH5L 1KCUH 1H3XA 3EO0B 5E1AA 3KAAA 1HSBA 2XTJD 2I9LB 1UWXH 3UTTA 3H0TB 4U0RC 3IDJB 4M48H 4IRSB 3JTSB 5D71L 5GGUA 2H2SD 3TBSA 4WWKD 4YHIA 5KN5A 5DQJA 1ZT4B 3BZEA 4LSTH 2I26N 4LEOA 4PJXA 2JCCA 3AFLA 1LDPL 1IM3B 3HAEG 4LSVH 2VDQH 2G75A 1UZ6E 4I77H 1YNKH 4MA1B 2B1AL 4OLYL 1U93B 2PCPB 2NX5E 3MRCA 3C8KA 5EUOB 2B1HH 4KK9C 3BGFB 1I8IB 3UMTA 3GSUA 4ZPVB 1BBDH 2FD6H 4W4NA 1G9MC 3KPOB 3E0GA 4RWYH 5GZND 5SWQA 3P0VH 4Q9QL 3TNNB 5KSAC 1IAMA 4LCCC 2GJZB 2VXUL 3ZDZF 2EDYA 3ES6B 3FL7A 4I48A 4X6DE 5MI0B 4W6WB 3ZKMC 1JZ8A 3BT2H 3B9EA 3T3PF 4LVOC 4X6CA 2LU7A 4EQ2A 1AJ7H 4Z7UE 5HGHB 2UWEA 1NBYA 3PWPD 5TQ0H 3ZHKA 3ULUD 1RUQL 2CUHA 4JKWA 1FL3A 2APFA 2Z8VC 5EU5A 1WFOA 3INUH 2IQAB 3OKKB 1TZIB 4JFQA 1EH9A 2JJTC 3SKJH 2VDML 3CFBA 1X6NA 5CJOL 2X7LA 2CLZB 3OHXA 4WI5A 1J10A 1KLGB 2AI0L 5EIIA 3BQUA 3FCTA 3HCVB 2A6IA 2C3HA 4KQ3L 4AH2B 5KZCD 4KV5F 4QHLB 4DUWA 5I1IH 2W9EH 1JGLL 1FYTD 4P4KC 2P5WE 1RHHA 1F8TL 2I9LA 1CFQB 1KB5L 2HVKB 5C09E 4MXQC 3H0TA 4NN6B 2FLBT 3IDJA 3JUYA 4PJHB 4OCLC 3CFDA 4IRSA 3FOMB 1I85C 3JTSA 3M1BB 3VGAB 2Y07H 1X4YA 3KPTA 1AD0B 3KPSB 4N8VG 1DLFL 1JNHB 2VE6B 3BP5A 3CZJA 3GIVB 3CVHB 1IM3A 1I3RB 4UTBL 3IVKB 1S9WB 4Y8AA 1F3JA 3BO8B 3ARFB 3GBNL 4M3JA 4P57A 4HJJL 3OJVC 3SKNB 1I8IA 3O3EB 3T0WA 1A64A 2PXYC 4YHNA 2I27N 3LQAC 2GJZA 2W60B 3ES6A 5JTWA 1JE6A 4N0YL 4JRXB 1OGTA 1KB5A 2GCYA 4QOKB 2HP4A 1MH5B 1KB9K 2B5IB 4GS7B 2DLFL 1Q0YH 3ZYZA 3MOAH 2GW5A 5HGHA 4LPUA 4WFGE 1XCTB 4NM4H 3TFKC 3V95A 4ZFZA 1GGIL 4I18B 2O5XH 3HMXL 1BVLB 4I5BB 2C3VA 4CN6A 4PJFE 2J88H 4ALAH 3VXUB 4HS8H 1KPRA 2IQAA 5LKNA 3OKKA 4V1DB 1TZIA 2GK0B 3MRNA 4XP9H 4NN7C 2D7QA 1CGSH 1KLGA 5FYLE 2NTFA 3MLWH 4CW1B 3HCVA 4AH2A 4QHLA 3UTPE 2DQIL 2W9DH 4YIQA 1EO7A 3B5HA 5DD3H 3EZ8A 3VD4A 2HFFB 1CFQA 3VH8G 2HVKA 1NSNL 4Y4FD 3KGRA 5DD5H 4WW2A 5E2UH 2Y23A 2A73B 2XTJC 4YAQB 4LMQI 4MCYB 4JFZL 1JNHA 2VE6A 3BDBA 1B4RA 3BKYL 3N50A 3IVKA 1AGCB 1KEGH 1FC2D 1G9MH 4FQ2L 4OT1H 4K7PY 1IGML 2H2SC 5JW5B 3BO8A 4L1DA 4OQ1A 3K2MC 1HQ4B 2XA3A 1N4XL 3B9KD 3SKNA 1Z9MA 1XGPB 3O3EA 5BS0B 3DTXB 4X7SH 2FGZA 2CK2A 4XWOD 2VQ1B 1OAQL 2HTLC 3MODH 5FCSH 4KZEH 1T0MB 4M7LH 1TXKA 1BQHA 5I1AB 1KCRL 1T04B 4F7EB 3D3VE 4JRXA 2VLLB 5GZNC 5KJRH 3DGGB 4LVNB 4QOKA 3G6DL 1JGDA 5FUCE 4OI7A 1MH5A 3EJZD 1P84J 2VDKL 4NN5C 3DURB 4MVBD 1AGFA 3DUSA 1MAMH 1P69B 2CLVB 4I18A 2HJKB 1BVLA 4HWNA 4MAYD 3W0WE 3UTTD 3VXUA 4V1DA 2IGFH 3STZA 2GK0A 3ZSSA 3NZHH 4EUPA 3ULUC 1N3NB 5IEHA 2GHWB 3AY4C 4PD4J 4U3XA 3MRQA 1P7QD 5EO0B 3HZVB 4CW1A 1DBML 3VD5A 5DF0A 4ZFOL 2QV2A 4YDVB 3S34H 2NX5B 1A8JH 5DHVB 1MJ8H 4WTXA 4YQXL 4P9HC 4CN4A 5DA4A 3U82B 3O4OB 2ESVB 5IR1B 5E9DB 4U1HB 4ERSL 4PY8I 3VXRA 2QQKL 4YAQA 2V2TB 4PR5B 1UYWH 4JJHA 4MCYA 4OIAA 1NUDA 2IWGA 3SGDH 1ZWIB 3BPLB 4XMLL 1FG2B 1NUNB 3BPNB 5HVFB 3WNMA 3MJ7B 4JKKA 5A2LH 2MSPA 4KJPC 3GMNB 3PV6A 5K9JL 1SJEB 2HRPH 2XTLA 5EN2A 1HQ4A 4FQHB 4MWFB 3AB0C 3LQAH 1XGPA 5F7EH 5BS0A 3VDAA 3DTXA 2E7LA 3E3QE 4ZFOA 4QXGH 5E94B 3LRHA 2DQFB 2VQ1A 5FUZH 1FNLA 3CXDH 4L8CB 5H37H 3EOYG 1CBVH 1T04A 4F7EA 2VLLA 3DGGA 3EW3B 3ARTA 4JGMA 4LSSL 4DEPC 3BHBB 4TRPL 1DN0B 4Q58C 3FTGA 3DURA 4HIXL 3BE1H 2CLVA 3WHXB 1PG7X 5C09B 3K81A 3T3PE 3JTTA 1U8MB 4C83B 5FECB 2XKUA 2X4OA 3VJ6A 3H9YA 1G9EA 1TIUA 2EDKA 4IRSD 4B7IA 3OQ3B 4PRIA 4OIIL 2OSLA 1FZOB 5EO0A 5L8LB 1G1YA 3HZVA 3U2SB 1MLBB 4X99B 4HWEH 4YDVA 1KTLB 1CGXA 5CHNB 5MERB 3RY6A 3T4AA 3AU1B 5E6IC 1G0YR 4J6RL 4KUCF 4G6MH 2X10A 4O58H 5DHVA 3ALXA 2IC2A 1H3PL 1OGAB 2LVCA 4OZFB 2J3SA 4WV1A 3QWRD 4KV5E 4NKDB 2E6JA 3SE4A 5E70A 5E9DA 1J87A 2COQA 1NBVH 1S7XB 3AGVA 1EDQA 3QFJA 5FDYA 4KTYA 1UKTA 4HUKB 1FG2A 2E7HA 4Y4FC 2FDBP 4JPIB 3I6KB 3GMNA 4AM0B 3QEGL 4OSUL 5K9OB 1JNLH 2MPAL 4RGOL 5KSBB 1BD2E 2X4NB 4MWFA 4JHAL 1JF1B 1TZHB 1T3FB 3OAZK 2Q7NA 5I19H 1DBBL 2DQFA 1URLA 1ZHBB 3IETB 3OAYH 4M5ZH 4L8CA 2Z0BA 4CMMA 3GHBH 2ID5A 5DZOA 1WSST 3MLUL 1JGVL 2R29H 5A16A 4R4BA 4LDLB 4XWOC 3F7YB 4HWUA 1DN0A 3B43A 4PJGA 3SKOB 1KEMH 2C4XA 2R0WL 3FQTB 3WHXA 2W0FB 2ADGA 1BQLH 1DL7L 3EJZC 5T3ZH 2VIRB 1I4FA 5IVNA 5HYEA 3HI5H 5D7KE 3C8DA 4XGZB 1UJTA 2DMBA 4ZOAA 2FCBA 4MVBC 2Z35B 3P4OB 2WNGA 2NMSA 1GZQA 1CYGA 3KPSD 2XKNB 4MMXC 3SDXF 3TV3H 3WIHH 4MAYC 4P9HH 3U2SA 2D0FA 3T0VA 4JDVB 4LSPH 1KCUL 1KTLA 2LQRA 2J8UB 4MD4B 3AU1A 1AD9B 5EO1B 2BY2A 3CSPA 4E9LA 3ARFD 4L9DA 3H9ZA 1OGAA 2ZUQB 4UV4H 4NKDA 1O7SA 3HE7A 4BUHA 5IBUB 5DRWB 3T65B 3RWHA 3V6OA 4URTB 2C4FU 3P40A 4LSTL 2JJSA 3MRJB 3H3PH 1MCKA 5L88H 4LSVL 1JZ6A 2VDQL 2L7UA 4JRXD 4JPIA 3I6KA 2CLRB 3C60C 5J12B 2BJMH 3GI9H 4JDZA 4QOKD 4LU5H 3MJGX 5F7DB 2X4NA 3S96B 1BBDL 2FD6L 4WI3A 3X14B 1JF1A 3P0VL 1T3FA 2UUDH 1ZGLA 1HILB 3WHE0 1KFAH 1ZHBA 1MCLA 4L4TA 3RVWC 3VXUD 3UZEA 3BT2L 4V1DD 3V5KA 4IRZH 4WVRA 3O45B 4EVNB 4DQOH 1AJ7L 3RHWF 3SQBA 5AG9A 2BOBA 5DVOA 3CGTA 3F7QA 3F7YA 4J4PC 3NGBC 4KKNA 3FQTA 5SX4I 4W68A 1EGJH 4YK4B 1B3JA 1XT5A 3INUL 2VIRA 5IF0B 5A3ID 1JL8A 5DLMH 5DJ8A 3S5LG 3SKJL 4XGZA 1QRND 2Z35A 3QEUB 4FFWD 4H8WC 4L4VE 4LHUG 2XKNA 2D9CA 2IPKA 5GXBB 2R39A 5I1IL 2W9EL 2R8SH 4Z8FH 4LDOB 3QUXC 3RWFB 4IRSC 4X6FB 3UTOA 4GJTB 4MD4A 2JE8A 5F9OL 3VFRA 3LKRB 1AD9A 5EO1A 3GSWB 1VFAA 2AJUH 5GZOD 2W07A 1DEEB 2D31B 1SYSB 2D0GA 4OFPA 3L9RA 2Y07L 4PB9H 4HUUB 5I8EB 4ZPTA 2V5RA 2ED7A 2J5LB 1G7IB 1C1EH 4HCRH 2GJ6E 2VITB 4M8VA 3BGFC 1A0QH 4PGEB 1DDHB 2CLRA 4CGTA 1HEZA 3I6GB 4V2CB 3U48A 5F7DA 1L9MA 1F6AB 2DRUA 3D2UB 3X14A 1HILA 2AV7A 1B0RB 3A6CH 1Q94A 5IMLB 3MUGB 2Y25A 2QSTA 3KNBB 2YRZA 4MDIA 2A74B 1R0AL 2YPLB 3QI9D 2X4PB 3O45A 4EVNA 1PKQB 1Q0YL 2E7MA 5HVGB 3MOAL 1G7QB 2PN5A 4JQVA 4NM4L 5DEZA 3CSBA 3ARZA 5F8RC 5I0DA 2IADB 2O5XL 4NKOB 2WIIB 5JPMB 5D2LB 2VJXA 1RZ8B 2KPNA 2NX5D 2J88L 4ALAL 2UV3A 4MNQB 4HS8L 2WWKT 5E5MA 4RIRB 1A4JA 4YWGH 5IF0A 2X40A 4OV6F 1N6VA 1AY1H 4NKMB 1C12B 1F2XK 4XP9L 2ESVD 2IQ9H 3QEUA 2IMMA 1DSFL 3BP6B 5E9DD 1CGSL 1JNNH 1CDHA 4NKIH 4NNXA 1MCEA 4MJ5B 4GRLB 4JO1H 1DQJB 4NN6C 4NOBA 4Y16B 3RWFA 4JO2H 4X6FA 5DD3L 4NRXB 3LKRA 5JPNB 3NH7H 1AXIB 2YOCA 4DFIA 3VFNB 4NOFA 2YA0A 5FYKL 1DEEA 3HE6A 1GC1C 4KGJA 5DD5L 3J7HA 5EUKA 2W0PA 1BZ9A 2VLRB 1MFEH 3ARFC 2FL5A 1BOYA 4HT1H 1J8HB 1G9ML 4OT1L 4XB8A 5F3BB 5CIPH 5B8CB 4OF3A 1HQRB 4LGSB 3I6GA 1BFTA 3BEVB 1MHEA 5C0EB 1QTYT 1MCCA 3IJYA 4WENB 3UDWC 4X7SL 1ZLVH 3AMKA 3D2UA 3EOTH 2HWZH 3FB6B 1YZZA 2FX8H 4U6TA 5C09D 3QRFM 1B0RA 4M7LL 3B5GA 3MUGA 4GS7C 3E1F1 2X1XR 3KNBA 2BDNH 4W81A 5JIIA 1AH1A 2VDOH 2DJ4A 2VB5A 1UJ3A 1BF8A 5KJRL 4MLSA 2YPLA 2X4PA 4HLZG 4L3EB 1PKQA 3TLRA 1KPVA 2FEEI 3SE9H 1KENH 5GRWA 1MAML 3P4MB 4JLRB 5DUBB 2IADA 3WN5B 4NKOA 2WIIA 5D2LA 2JJUA 3RIFF 1RZ8A 4QRRE 3VD9A 1G9NC 3NOIA 2B2XH 4M61B 2XI9A 2VC2H 2IGFL 1OGAD 5L2KA 4Q2ZB 2P4AB 1JZ7A 1C12A 3RIFK 4XNUH 2OM5A 4LF3A 2C9AA 2X9WA 1FLRH 3T08A 3PHOA 4MJ5A 1HK6A 1HDMB 3S34L 2OL3B 4GRLA 1TCMA 1DQJA 4Y16A 4FXKB 2KZ1B 1R5VB 4FFWC 2PNDA 3FQWA 4KJYA 1MJ8L 5JPNA 4HJ0D 4L8BB 2NY5H 4L3CA 3VFNA 3SDXE 3BD3A 4N8CH 3RVVD 3GMMB 3L3JB 3KPNB 3SQOH 5FK9B 4OF6A 1JMZA 4U1MB 3WHE1 1IBGL 3ARDB 5DUPH 3KPRB 1J8HA 1ND0B 3BX7C 2HRPL 1MY7A 5B8CA 3O4LB 4F9PA 1LEKB 3BEVA 3LQAL 4NO2A 1W72H 3UTPD 3ECBB 3QXAB 3QDAA 3OJDA 4XXCA 1CXIA 4QXGL 4LGRB 4QO1A 3VW3H 1MCOH 3MZGB 5FUZL 43C9B 4YDKH 4C56A 3U46B 3OB0K 5I74B 4L4VB 1MJ7H 2XICA 3S36X 4L3EA 1M71B 3UTSA 2Y5TB 2NYYC 1OP3H 2IANE 4G8EB 3WXVH 1QSFB 1IKNC 3BE1L 3MJ6A 3P4MA 5HJ3B 3TN0B 3WN5A 3QI9C 2BOCB 5ITFB 1LE9B 3QDHA 1QD0A 3TH3T 4M61A 4M6MH 1AXTH 4X83A 1QEWB 3LKSA 4ZTPH 4U1KB 1LEGB 1C5BH 2IPTH 1WAAA 1J18A 1Q8MA 1U42A 4XX1G 1I9JH 1T5WB 3K8LA 5E95B 4HWEL 1HDMA 2W38A 2VZUA 3WFZA 1I1CA 2OTUB 3O4OC 1R5VA 2AKRB 1ZV5A 4G6ML 2B4CC 3Q5YA 1A2YA 4L8BA 4P2OB 4G9DB 2M26A 5ISZB 5I73B 5I1KH 4J3WA 1NBVL 3BPNC 3GMMA 3L3JA 3KPNA 3EJJX 2YD5A 4Z95H 1NGWB 5FK9A 2G5RA 2QKIB 4U1MA 1OVZA 4HIJB 3QEQB 3E8UH 5I66B 1CDJA 3RWIB 3ARDA 4GKZA 4X7DC 3ZE0F 1JNLL 2M8XA 4RMUA 4UIKH 5JMOC 3CVIH 4UBDD 1LEKA 3I02B 5F6HJ 1NPUA 3DX9A 1FBIH 3OR7B 1BQHG 2JTDA 3HFMH 3ECBA 3PWLB 1FZKB 5DYOB 5I19L 2C4FT 4IDLA 2DM2A 1OAZH 2QLVB 4M5ZL 43C9A 2BCKB 3GHBL 1J05B 2UYLB 3U46A 1T1ZB 3MLRH 2R29L 2AEWA 4JZJA 4X4YA 1MHCB 1TQCC 4QRTA 1FFPB 3D6GA 4YHPB 2Y5TA 4FQJH 4Y19B 4G8EA 3LQMA 1QSFA 1KEML 2VUOA 1KTDA 4HJGA 5HJ3A 3TN0A 4EI5A 3PDGA 1NH6A 4EUPG 1BQLL 5ITFA 5IW1B 5ANMB 4G9FB 5T3ZL 4JFHE 1LE9A 2NCMA 2YA2A 3HI5L 4X9FA 2QEJA 1TTGA 2FX9L 4HPYH 1QEWA 2BP3A 3MOBL 5FO7B 3ILPA 5E8NA 3GI8H 1MCWM 3WIHL 1OSZB 1T5WA 4P9HL 5IFHH 1WBXB 3VRJB 4LPTA 4LSPL 5DD6B 2AKRA 2LU3A 1YY8B 4XAWH 1UEMA 4P2OA 4OI9A 1GHFH 2P42B 2F8VA 3B8SA 5L0QB 4UV4L 2R1XB 1T4KA 1JPFB 3D2UD 3SGEI 3QYCA 1NGWA 4HJ0C 3H3PL 2W1NA 3B83A 4X5XA 5L88L 2WP3O 2QKIA 4AYFA 4OCSH 2J1KA 3TF7C 4P2CG 4HIJA 5I66A 3RWIA 4P4RB 2R4SH 3D9AH 4RISH 5SWSE 3GI9L 1JGUL 5LG1A 1U8JB 4LU5L 3EYOB 2YPLD 4O2CB 3DX6B 3LN4B 3EDJA 4NDMB 2CSPA 4R26H 3OR7A 2J6EH 4XTRD 1GAFL 4JZNB 5I6XB 3WIHA 1FZKA 2WM0A 4H1LB 3QHTC 2CD0A 2Q1EA 1TVBA 5T1DH 1KFAL 3RJDA 5J7CC 2BCKA 5D1ZB 4MNQD 4Y88A 4CU8A 1J05A 1T1ZA 2BHUA 4IRZL 3V6BR 5HYIA 1MHCA 4DQOL 3BP4A 1B0WA 1FFPA 4NZUH 4YHPA 1K6QH 1RZGB 4FQ1H 4YHLH 4Y19A 4Y5YB 4RFOH 4GRLD 3D39E 3GIZL 4Y16D 1OAYH 1EGJL 4HK0B 4WDIA 5CJQH 4F7CB 1MHHB 5IW1A 5ANMA 4G9FA 1PGRB 1WTLA 3FB7B 4Z0XB 5DLML 5T3XH 5M95B 4UT7H 5JXAH 4XHJD 4IMKA 4JGUA 3TBVA 1EFQA 4MHHI 3GSRB 2Z31B 5SX4H 3WLWD 3WFBH 2OR7A 1OSZA 2ICEB 1WBXA 2VLRD 3IDYB 4NYLB 4KWUA 2R8SL 1S7RA 1H5BB 5DD6A 5SV4A 2ZUQC 4I0CC 2YPKB 1G6VK 2AAVA 4UQ3B 4N0CC 1CLYH 2DOCA 2AJUL 4OZHE 1KJ3H 5IROC 5TE6H 1UVQB 3ARWA 7CGTA 2R1XA 4PB9L 3SDDB 3W5NA 5JNYA 4C4KO 5J12C 1FAKT 5E7BA 1C1EL 5D7KD 4HCRL 3O6FB 4ESKA 3EYUH 1A0QL 4GT7A 4U31A 2ZSWA 4P4RA 4N90E 4PRHB 4U2YA 5JUEH 1U8JA 5I1DB 3DX6A 3V52H 3WXWL 4L3ED 5IJKC 3LN4A 5I1JH 3TZVA 2MCG1 3VXSE 2FJFB 5DJYB 3V0AC 4JZNA 4PJCB 2BC4B 4HH8A 2XRAL 1KV3A 4H1LA 4TULH 3EOAB 3MA7B 3A6CL 1RURH 1RZIB 4UBDC 2DWEB 5D1ZA 1NAKL 3RU8H 1GIGL 4NHCH 3MLTB 4LCYB 4MZ2A 4PJDF 4AEFA 4PJ5B 1KCLA 2Q8BH 3U7YH 2CDGB 5E8OB 3VWJB 2R0ZH 3L3HB 1RZGA 2XY2A 4Y5YA 3C5ZC 4NC1E 2XZCH 3N0PB 4HK0A 4HCRA 4F7CA 1MHHA 3MJ9L 1YN6B 5EOCL 1HSAB 3FB7A 4EOWH 4Z0XA 3TM6A 1NCAH 4OGAD 1AY1L 4HKBB 1WEJH 2IQ9L 3FB5B 1JNNL 4PRPB 3TPUB 2RHEA 4NKIL 5DA0B 3GSRA 1MFCH 1KULA 4HIIB 3PQYB 1K9TA 4UMGA 4JRYA 2Z4QB 4JO1L 2ICEA 4NYLA 3BPOB 1H5BA 3LEXB 1T66C 3ARDD 1D6VH 3KPRD 1JZ2A 2YPKA 3E3QC 2BNRE 2NY7H 1T03H 3NH7L 4K2UH 4LHQB 5AZEH 3O4LD 5GGVY 5GRVL 5L7XL 4LSDA 2J5LC 3NZ8B 4TSAH 1KYOK 5ICZB 2KZWA 4D9QD 3OR6A 3OXRB 4PGCB 5EC2B 4JGJA 1MFEL 1IC5H 5DVMA 4FABH 1P4LA 3O6FA 4HT1L 3MUJA 4Z7WF 4OGYH 2DB8A 4I0PC 1XR9B 2YRPA 4L4VD 4PRHA 1CI5A 1EHXA 1MCHA 5I1DA 5FYLH 2WSKA 3KYNA 4AY0A 2FJFA 5DJYA 3EOTL 1XR8A 1QSFD 4HIEA 2LV4A 4YPJA 4PJCA 2BC4A 2FX8L 4G80A 4NUGH 5FOJA 3TN0D 3EOAA 3MA7A 3RPIB 4NP4L 2BDNL 1PX3A 2VDOL 3U7AA 5CJXA 2F19H 3MLTA 4LCYA 4WEBH 4K7FB 4UU9B 4PJ5A 2CDGA 5E8OA 1VACB 3QUZC 3VWJA 4GQ9H 4XXDB 1QLFB 3L3HA 1XGTB 3SE9L 1NC2B 1KELH 1KENL 4K7PH 3CSGA 4QRQB 2BMKB 1NCTA 2IPUG 3IGAB 5DQDH 2WQ8A 3U30C 5SX5K 5GJTH 5IESH 4H8WL 3U0WH 4M1GH 1YN6A 2B2XL 2J4WH 1HSAA 5CIPA 4P2OD 5DRXB 4F58L 2XA8H 5ISZD 1J1XH 4HKBA 1VADB 4XNUL 3DX7B 3MBEA 4DWHA 4PRPA 1B90A 4LSQH 1FLRL 3FT4B 3HN3A 5INDB 3PQYA 2OQJA 2Z4QA 4RMQA 4PJ9C 4XHJC 4KQ4H 5C0NC 3VI3F 3QEQD 2PTUA 1U9KA 1S7WA 1TJGH 4OUUB 5HYJB 4JCLA 2X44D 1NGXB 2V7NB 3WLWC 4N8CL 1UB5B 1OW0A 2EXWD 4FFZL 3SQOL 2E3VA 4DZ8A 1LGVA 5EC2A 5F96H 3PDOA 4HUVB 1AQKH 5CEZE 3HR5A 1NC4B 3O3DB 1W72L 1UT9A 4OLXH 3DARA 4M7ZB 4Y19D 3BFOA 3VW3L 2H3NB 2PYEA 1MCOL 3MTRA 1ORSB 1B0GB 4YDKL 3X13B 3KPQB 4G9FD 3HZMB 4K7FA 4UU9A 2CKBH 3VFVA 1GCFA 3W11C 3WN5C 4XXDA 3W82A 5KS9B 3WXVL 2FR4B 2DYPB 1NC2A 1A6ZB 4QRPA 1IAIM 4QRQA 2KBGA 2NZIA 2BMKA 3IGAA 3O6MH 3S3JA 4DOHE 4OZHB 1N7MH 1ZLWK 1D5MA 3M8OH 1KCRH 1AXTL 1RZJH 5FUOL 4ZTPL 5JIPA 4DGVH 1UADC 2R0KH 1C5BL 4ZO9A 2IPTL 3MLYH 2BZDA 1W72A 1RULH 3DX7A 5HDQH 2ZKHH 1I9JL 3FT4A 3ZKSD 5INDA 5F1IB 1KXVC 1S7SB 5LAXB 1OAUL 4OGAC 1QBBA 2Y7QB 1WIOA 4XP6H 1A21A 5L8KB 4OUUA 2E27H 3FT3B 3W81A 5C9JB 2YR3A 3JXAA 1NGXA 2FIRT 5LWYH 4FZ8H 3MZTA 3QXUA 2FGWH 2CDFB 1CXKA 3IXAB 3GMOA 4CAGA 4Z95L 4H20L 4GW5A 4HUVA 3E8UL 5D1ZD 2WBJB 1W0YT 4EN3B 3ESVF 4IS6B 4UIKL 5J13C 3CVIL 3RDTD 1D9KD 2AERT 3RWDB 1FBIL 4KTDL 3HFML 4Z7QF 4L5FH 5T5NF 1YJDC 4XPAH 4O2EA 1SBSH 4KMTH 1OAZL 3S6CA 1ORSA 3NA9H 3KPQA 1NMAL 4ZFFB 2W9LA 3HZMA 3MRBB 1K4CA 4TVPH 3MLRL 3MNVB 5HHVH 2FJGB 2ICWB 2DI8A 1JWSA 2DIBA 3QO1B 1E27B 4NFDA 1J1PH 4FQJL 2Z31D 2VXSH 2FR4A 1A6ZA 2H2PD 2P8LB 4J12A 3Q48A 4PJDE 2X1OA 2C3XA 4UQ2B 3SEPA 2JELH 3RGVA 3MUZ1 3O11B 4WIQA 4XRCA 1MRDL 4R7DB 1LHZA 1DR9A 3SDDD 3DO7A 5IFHL 1TQBB 3RUGA 4DGIH 2EYSB 3KJ6H 5F1IA 3VFPB 4YHKH 1SHMA 5LAXA 3O6FD 5I73C 2Y7QA 1CWVA 1IGIH 4RA3A 4PRHD 1D3CA 5C9JA 1WZ1H 1GHFL 2GYSA 5M7QA 2CDFA 2FBOJ 3NPSB 3PL6C 3IXAA 5I1EH 3S37X 2P5EE 1JWUB 1MCPH 5HPMB 2HYMA 5GJSH 3VCLB 1HXMB 2I07B 5D6CA 2AXGB 3TBYB 1A7QH 4OCSL 1GPOH 4DN4H 1OQXA 2ZUYA 2R4SL 1WQVT 3D9AL 4RISL 4HF5L 2EE2A 2EXWC 4LRIA 3NFNB 1MAKA 1QLEL 3G6AB 4PJ5D 2V9TA 1U8PB 3VWJD 2YMXH 2JLLA 4R96A 1I7UA 1NGZA 1AE6H 1SM3H 2IALB 4Z7WE 5BRZB 3D25B 1R5WB 5T1DL 4F2MB 4M8QB 4J2XA 1ZA6B 4HV8A 1F4XH 1G7LA 4GLRI 5D5MB 4ZFFA 4IEFB 3N1GC 1J9CT 3MRBA 5IB3B 3TCXA 5D7IF 4RGNB 4NQDE 2FJGA 3GBLA 4NZUL 4PRPD 1TZGH 1K6QL 2V7HB 3QO1A 3ALPA 5I8CB 4FQ1L 4YHLL 4JPKH 3PQYD 4PJIE 4RFOL 1A7PH 1QQDB 2P8LA 2XWTB 1TLKA 1OAYL 1M7IA 3E6HB 5CJQL 4YE4H 4D9RD 5HGAB 3QNYB 5HHPB 5KW9H 1RV6X 1II4E 5T3XL 1LO5B 4IM8A 4UT7L 5JXAL 4JY4A 1QNZH 3S4SG 3GSNH 5I76B 2YN3A 1LVEA 2UZXB 3TIEA 4NCC1 2EDEA 2J6EA 4R7DA 2B4CL 1PJ9A 4TN9A 5C0RH 3F62A 2QJDA 4GG6B 1JJUA 2EDXA 2EYSA 3VFPA 5L0QC 2ZJSL 4D0BB 1T5XA 4BQ8A 4QHMB 5IQ7H 1CLYL 2NQCA 4MD5B 1KJ3L 5TE4H 1NLDL 5TE6L 3GM0A 1VEPA 3WJLA 3VI3E 1LP9F 3ARVA 4U6HB 4J3UA 1BEYH 2DBLH 4NRYB 2I07A 2AXGA 3TBYA 3EYUL 3ROLB 4OLVH 3KYAA 4ZYKB 5JUEL 3GRWH 4MB4A 5I6XC 1U8PA 3V52L 5I1JL 3UYRH 3TO4C 5JHLH 4LLVB 2IJ0C 1NC2D 4CVXB 4TYUA 4JO4L 4PTTB 5BRZA 4K94H 3ULVF 4JFOB 4F2MA 1R5WA 1FHGA 4X6DA 3RDTC 4M8QA 1D9KC 1F5WA 2R2EA 3OJMB 3RU8L 5D5MA 3ZO0A 4NHCL 4I3SH 3SGKC 1AGBA 2DMKA 2JIXA 5IB3A 2Q8BL 3U7YL 2H6PB 4LIQE 5EFIB 2R0ZL 3R4DA 1ADQH 1JGEB 3DI3B 1N8ZB 4MQ7B 2V7HA 2X05A 3MV9E 5I8CA 2XZCL 5HGAA 2VQUA 5EU6B 3ME0A 1ITBB 3QISA 4Q6IB 2OMBA 4EOWL 3MNZA 4O9HH 1LO5A 1NCAL 5HYJD 2Z31C 1WEJL 1QA9B 1WZMA 3IDYC 1HOCB 2AJSH 1JPTL 1MFCL 2YD3A 1DBAH 5J6GB 3F6LA 3IYLW 3ZE1F 1FZMB 3IDNA 4M1DH 4GG6A 1OCWH 2P5WA 4MA7H 2ITDB 1D6VL 1Y18B 1FAIH 3UXFA 2D3VA 2NY7L 4D0BA 1T03L 4HX1A 1NC4D 1WJ3A 5AZEL 3BZFB 4NC2B 3SDDC 1YMHB 5B21A 3QB7C 3GDBA 1FPTH 3LSOB 2DICA 3K46A 4U6HA 1IC5L 3X11B 5IWLA 4FABL 2C1OA 4FTVB 4RAVB 4O51B 3WO4B 4QWWD 3ROLA 4ZYKA 5KAQG 4YHMH 5IMOA 2E6PA 3CNKA 5FYLL 4WI6A 3EKCA 4GBXB 3GGWB 5A1AA 4S0SD 2ZOKA 4LLVA 2DYPD 1NGPH 3F65A 5F7LB 3P9MB 2WQRA 4JKMA 4NUGL 4R2GC 3H9SB 1C5DB 4JFOA 5K59F 5F7YC 4OGZA 3G5XB 1X5KA 1UH3A 4WEBL 4Z18A 3QG7H 2H6PA 4HH9B 5EFIA 3SDAC 4XCNA 5DC4B 4ZG1A 1JGEA 1RI8A 1WBYA 3WFEH 1N8ZA 3KYMB 1KELL 4K7PL 2HAZA 4PY8J 1EVUA 1SYVA 4LVEA 5LGJB 5EC1B 5DQDL 3SPVA 2DMCA 3TJEH 5HGGS 5GJTL 3RWGB 5IESL 3WV0A 3U0WL 4M1GL 5EU6A 1V3LA 2J4WL 3O9WB 2XA8L 1I7ZB 1KJ2H 1ZANH 1J1XL 3DHJA 2OZ4H 1QA9A 2YKLH 1HOCA 1SQ2N 4HPOL 4LSQL 3BPOC 3QDJE 5I9QC 1AQDA 1V05A 4U1IB 2F8XC 5J6GA 4Z7VF 3D85A 3OAZH 4NUJB 2BNQB 4KQ4L 1EEYA 2ITDA 3P3YA 2WBJD 4HS3A 1TJGL 4APQA 4RCAA 5IMKB 1YEHH 4EN3D 5FDWA 1YMHA 3HRPA 2H26B 3M45A 2JB5H 4NFCA 1I1FA 3CX5K 4JFFE 3LSOA 5DMIH 4HK3J 4OGXH 5F96L 4MA3A 1NLBH 5FO9B 5JQHC 1AQKL 4KK8D 4RAVA 4O51A 3V7AG 5FAAA 4HBQA 4MQSB 5IM7A 2FNBA 4GBXA 3GGWA 4OLXL 1E4XI 5D2NA 4XC1H 3H9SA 1C5DA 5KSUB 4J23A 3LB6C 1VDGA 4DKAA 1A6AB 2CKBL 4HH9A 3OKYA 3U6RA 4WO4A 4XNZC 1JVKA 3TESA 3BOVA 3DVIA 1U8QB 1RQ5A 3AREA 4ONFL 1KN2L 5EC1A 2Q8AH 3ZT6A 1HHKB 3QPQC 4L9LB 3C8HA 3O6ML 3EYFB 1N7ML 4Z76B 3M8OL 1YPZB 1MFBH 3G5VB 1RZJL 4G7YH 1BWWA 4DGVL 5C6WH 3O9WA 1I7ZA 3MLYL 2VLJE 3VFUB 4JDTH 5HDQL 2ZKHL 3HS0B 3V4UL 1HNFA 3L3DA 5EBWB 4U1IA 1UXSB 1MJJB 4OTXH 5FOBB 5E5UB 2GSGB 1T83A 4KXZI 1LK2A 4YBLC 3IU3B 4XP6L 5IMKA 3HAEH 3EGSB 2E27L 1YDPB 3OSKA 5LWYL 2CKBA 1ONQB 2VLKE 4FZ8L 3FKUS 2H26A 3VWKA 1BAFH 2FGWL 3PV7A 4LCIH 1FDLH 4IRJB 4JM2F 1IGFH 4NBZB 5BRZD 2YUVA 2NY1D 2ZWLT 1YQ2A 1GJIA 4ZDHA 5FO9A 5FYJH 4O5LH 2G5BA 2PO6C 4ELMF 4PJEF 3LVEA 4L8DB 5LJYH 5E6YA 5IG7B 1KPUB 1XIWD 4M7ZC 3MV9B 1LP9E 4RGND 1F58L 3F12A 2P24B 3PHSA 3HNVH 3HZKA 2FWOA 4L5FL 2ICWJ 3BAEH 4QWWC 4XPAL 32C2B 3EYSH 1SBSL 3NA9L 5KSUA 1B88A 4TVPL 3Q1SH 1FN4A 1LO2H 4Z7OF 4BSJA 3ULVE 4Z9KB 2VXSL 4A2LA 1IGJB 2X41A 1U3HB 1U8QA 3DX8B 4P9MH 1TITA 1S9VB 2JELL 4MNHB 2DQDL 1HHKA 4L9LA 1EMTH 3NBNA 3EYFA 1DQMH 5JDJA 3MRRA 1CN4A 1I1YA 3V0VB 1DCLA 3H42H 5FM5O 3AM8C 4JFDA 4OV5A 2M2DA 3BH8A 3T1WA 4JHBA 3VFUA 1FNEB 5T1KB 1L6ZA 8CGTA 2P48B 4ETQB 5SWZA 5I1GH 1UXSA 4DGIL 3KJ6L 2G60H 1MJJA 5FOBA 2GSGA 1IGIL 3TIDA 2EDLA 2N7AA 3DMMB 4R97C 3RA7H 1G7JB 1I7RB 1U92B 2XFXA 4KKLD 1CK0H 2PETA 4P3CH 1WZ1L 1YDPA 3BWAB 5GS1B 1ONQA 4HFUH 4K3JH 1EXUB 4IRJA 5I1EL 2WBJC 2FH6A 1GH7A 4NT6B 1MCPL 5GRJH 5GJSL 4EN3C 3HB3D 3VFWA 5J3HD 4U1JB 1A7QL 1GPOL 4DN4L 4OZIF 1QOKA 1V5JA 1IC7H 4L8DA 1NFDF 1QFPA 2UZIH 2X89D 3ZHDA 5IG7A 1UGNA 3EAKA 3G5YA 1IZKA 3GSNB 2YMXL 1NBQA 4ZUUA 1F90H 2FRGP 4IMLB 1T89A 1K8IB 2P24A 1AE6L 2VQTA 3ROOB 4G43B 1SM3L 2VAAA 2XN9B 2WUBH 3IRPX 5FYJU 3AS3A 3O3AB 4CVUA 3FO1A 4R4FH 1F4XL 5EU6D 2ARWA 2EC9U 3SE8L 3RGHA 2CUIA 1JK8B 4MCZB 2DQCH 2X9YA 3TBWB 3HPJB 1CIDA 1JYVA 3U0PA 1TZGL 1VHPA 1IGJA 1A7PL 3IKKA 3DX8A 4RQQB 4GLRH 1QFWM 4JPWH 1DE4B 4MNHA 4YE4L 2BFVH 2VLME 3LY6A 1OARH 5KW9L 3PXHA 4OFYA 5I2IB 2D7TH 3T0XA 5HVHB 3HPLA 3NTCH 3T1FA 4FQCH 1AGDB 2F5AH 3I6LE 3K3QA 4WI7A 1FO0B 5IHLB 2EE3A 1TQBC 3GSNL 1UCTA 4NZRH 5A2KH 5EU4A 3PNWB 5INCB 2HJLB 5JHDB 3NIDF 5C0RL 1OF2B 4H5SB 3OZ9H 4FTVD 1SY6H 4IOIB 4QXTB 4YO0B 5IQ7L 3O3UN 4X6BB 3DMMA 1Z6JT 1G7JA 4X8JB 5IHUH 3ET9F 2QHRH 4P99A 1G6RH 5TE4L 3VXOB 4QRSA 5E8DH 4IOFD 3GSOB 4WUUE 3BWAA 4Z7VE 4YDLC 3QXVA 2FBJH 1EXUA 4P46B 1A22B 1BEYL 5B38B 3GK8H 1JPSL 5JA8B 3MCLH 3H9SD 1RZ7H 1CD1B 3TJHD 4U1JA 4HUNB 2OTWB 2YD7A 2JB6B 4OLVL 3IDMB 3GRWL 2G9HB 4Y4HA 3GSNA 2NY1C 1U95A 3UYRL 5JHLL 4IMLA 3ALWA 1ZEAH 1K8IA 3EYQD 5GPRA 3ROOA 4UDTB 2R2CA 1TDQA 2ED8A 2HT4D 4K94L 2EXYD 3VFGH 3FFCE 5LVEA 4UTAH 1XIWC 3IFLH 3O3AA 5T1LB 1JWMA 4LVHC 4RGNC 1T1YB 4J8RB 1BMGA 2X1PA 4I3SL 3HI1B 4MCZA 1AR1D 3HPJA 3O9WD 2F53E 1A14H 1CLZH 1ADQL 1LNUB 1KCKA 1XFPA 4YEEA 3U9PH 5HPOA 4DZBB 3ZTNH 1WITA 1YN7B 2BNQD 1MCBA 5C0BB 5I16B 1DE4A 4U6XA 4K3EH 4FP8H 5DVNA 5I2IA 3GRWA 2A1WL 3CDCA 1AGDA 5KVFH 4XCCH 4OF5A 1WK0A 3V5HB 4XZUB 1DBAL 5INCA 4ODHH 5JHDA 3UC0H 1KCVH 4M1DL 4MA7L 1JI2A 3SJVB 1FAIL 1X5ZA 4QXTA 4IOIA 4NHUB 5BW7A 4YO0A 5BQ7B 4X6BA 3OB0H 4NO3A 4X8JA 1ED3B 2E9IA 2JK5A 3VXOA 3VFOA 1ADQA 3GSOA 4AJ0A 5IVZB 3T3MF 4OFKA 1FPTL 3ARQA 4LLWB 4F33B 4QXWA 4QTHB 2ZOLA 2ZG2A 4TNVF 5TGBB 3TC9A 5B38A 1UM5H 1ORQB 4HKZB 4KKLC 5E24E 2F54B 3BKJH 4C54A 4ODXB 2E8ZA 2OTWA 4LPXA 3ULUF 3BYTA 5D7LE 2VMFA 3I85A 2HKFL 2NY0B 4TNVK 4YHML 2O5YH 4PTUB 1KJ2B 1V7MH 3HB3C 3BDYH 1J0YA 3C9NA 5HHNB 1MFDH 4NQEE 5DJ2A 5J3HC 1NGPL 5BCAA 4UDTA 4ELME 3DI2B 4OCWH 4FXGB 3IJSB 5GGVH 5T1LA 1L9NA 5LXGH 1T1YA 4J8RA 1BJ1J 2NTSP 3VA2C 1QR1B 1MELA 3HI1A 1GZPB 2EICA 1A1NB 2NLJB 1CDYA 3QG7L 3UTZA 4ODWA 1LNUA 3JVGA 2GAZA 3WFEL 2HRLA 4X8XA 3NA4A 4K55A 1Y6NR 4Q6IC 1EJOH 3QJFB 1ZHKA 4TUJA 4ZAKB 2OK0H 2R1YB 1YN7A 5C0BA 4Z7OE 3BISA 4I13B 3TJEL 2OCFD 5I17A 4TVPD 3MO1B 1Z9SA 3GNMH 3DV4B 1MQ8A 3KR3H 1ZANL 3R06A 5D1XA 2OZ4L 3MJ8B 4KKAD 2YKLL 2VL5B 2YZ1A 4XZUA 3V5HA 4IRJD 5D7JA 2F74B 3U4BH 1ZGLP 2PTVA 3BUYA 5DQ9B 2EDFA 3SJVA 4OFDA 1U58B 4KKBD 4WFFE 1YEHL 4BJLA 3O2DH 3CMGA 5BQ7A 4F7PB 3MV9D 1ED3A 1BIIB 1KLUB 3T0AA 5AUMA 2AQ1A 3GSQB 5IVZA 4ZSOB 1WFUA 2ICES 3WO4C 5DMIL 2EYRA 4OGXL 4QTHA 1C5CH 4M6OH 5TGBA 1KIQB 1ORQA 1NLBL 2R69H 3L5JA 2Z93B 1OM3H 4IOFC 1K3IA 1P84K 4NRZA 1Q9OB 3IDUA 1D7FA 4PTUA 1KJ2A 4BSVA 5EB9A 1O5DT 4WTZA 2IAMA 2OZ4A 3GEWB 3QIBB 3TJHC 4MJIE 4S11A 3DGCR 1U8LA 1A1OB 1UG9A 1U3HD 5E5RB 4OAWB 5HYSA 4HUXB 1XF1A 1B4JH 4FXGA 4Y4KB 1NFDE 3D0VB 3IJSA 4GO6B 4PJAB 1FFNB 2XNAB 3HAEB 4Y5VA 5HHME 1QR1A 4MB3A 1RZKC 4ZMAT 1GZPA 2MKLC 1A1NA 1MVUB 2HT4C 1WCBB 4LFHD 5DJZB 3RVUD 5T1KD 1E4XH 4I2XE 2C26A 3HRZA 2BSED 3OPZH 4PJ7F 3WSQH 2BSSA 3QJFA 2Q8AL 2UZYB 4ZAKA 5CEZH 2R1YA 4QRRA 2GY5A 1F4YH 1HZHH 3G08A 3UX9B 4A2MA 4G6FB 1MFBL 3MO1A 4NM8L 3DMMD 4G7YL 4U3HA 3PABB 4UT6H 2BRQA 3MJ8A 1IEBB 4JDTL 5E2VH 3ZDXF 2AGJL 2EDBA 2HG5B 2F74A 3OKEB 1U41A 4YGAB 2VZTA 4OTXL 4RDQF 2PW1A 3O81A 4Q9CA 1CICB 1G1CA 5DQ9A 5C08B 5DT1H 1BIHA 1U58A 5DRZB 4KGLA 2K3TA 2R9HD 4ZS6D 3SDXA 3NIDE 5T5FH 2OI9B 2DD8H 1KLUA 5F7NC 1BAFL 1SEBB 4LCIL 3LPWA 1FDLL 4L29B 1T0NB 1IGFL 5GGSY 1CD8A 2XN9D 1KIRB 1S9YB 2CUMA 4GRMB 4KXZH 1Z9LA 2C1PB 3S98A 1XGRA 5D70H 1KIQA 2EKSA 2F53B 4O5LL 4LAJH 1AHWC 5I1CH 5ID0B 3WDJA 1Q9OA 1TMCB 4K71C 4YX2H 1ACYH 2ZP0T 2A9NH 4P3DB 1ZLUK 2AK4E 3HNVL 3QIBA 1IAKB 3SE3A 4PJBB 3BAEL 3ULSA 1A1OA 1OAXH 3FFDB 4N8VB 4OAWA 2XIDA 3EYSL 1MEXH 1MIMH 4W70A 5BVJB 4OJFH 8FABB 1X5IA 1PBYA 4PJAA 1FFNA 3Q1SL 3HAEA 1MWAH 4B5EA 1AFVH 5JOPE 5CD3B 2ADFL 1KGCD 1WCBA 2DWDB 4WHYH 5JHDD 3CFCL 3DXAB 1EMTL 1PZ5B 5GRVK 4LLQB 5H2BA 4OKVB 1YMMB 3H42L 3QXDB 1KTKE 2GIYA 4K8RH 4G8FB 1QBAA 2RCSH 3PABA 3MRKA 4HSQA 1I9IH 4D0CA 5GS3A 5TQ2H 3GMQB 4I9WE 1FSKB 4PREA 4X6CF 3GJEA 5I1GL 4P46D 3OKEA 2G60L 2P7TB 4B50A 2EECA 5IFAH 5C86A 3QZWA 4J3VA 1NDMA 4R4ND 1CICA 4KKAC 5C08A 1QPPA 1WC7A 3RA7L 3FZUD 4P3CL 1CK0L 4G6AC 3V0WH 2DIAA 2Q86A 4JFXA 3REVB 4HFUL 4K3JL 3K4DA 4L29A 1T0NA 4QYOB 3LH2L 5GRJL 3VG9B 3JWDH 3MRLB 1S9YA 1Q9KB 1G7PA 1F45A 5C71A 2C1PA 3O41B 5T1LD 1IGYB 5ACZB 1IC7L 3T3ME 3VGEA 4P5KB 1F90L 5DJ0B 3QO0A 1UKQA 1A7NH 4P3DA 2OMNA 3OG4B 4JN2B 2B39A 5FGCB 4PJBA 3MNWB 1OTUD 3PWPE 2WUBL 4CUCA 1RZKH 5C0BD 4QT5B 4R4FL 2CQVA 5BVJA 8FABA 4PP1D 2Z91A 4NIKB 5GS0H 1VESA 1EZVY 1G6RB 2AXFB 5IKCA 1U3HC 3JWNC 1NMCC 4U0QB 1VKXB 1R3JB 1IFHL 1FNSH 3MGOA 3TPKA 5EBGA 1JV5B 2DWDA 5EUOF 3ARGB 1BZ7B 1IAIL 1KNOB 1P53A 2BFVL 3SJVD 1FYTE 1OARL 4WFED 4OKVA 3KXFB 4FQCL 3V6ZA 2F5AL 3U0TB 4G8FA 3T8XA 5CGMA 4NZRL 3QQ9D 3L3GB 5BZDB 1TPXB 3GMQA 3FO9A 4G8GB 4Z77B 5CWSB 2BVUA 3H2WA 2P7TA 3QDMB 2F54D 1MFAH 5D93B 4IHOA 4U1GB 1DANU 5GS1C 2IH3B 3DVNB 2NY0D 4MNGE 5IHUL 2ZCHH 2QHRL 1S9XB 4HUMB 4H88H 3REVA 2FBJL 3KPMB 4J7RA 1N59B 3Q6GH 4P2QE 3GK8L 1V3MA 2R9HC 3MCLL 4Y2DB 4ZS6C 5AAMA 5SX5H 2R15A 3ARXA 3G6JB 4X6EA 5KOMC 5SWSA 1IGYA 5BXFB 3WUWA 4XH2B 2ERJC 4P5KA 2Y5EA 3SDCA 4I2XB 4KUZH 1S5HB 5DJ0A 1ZEAL 4PJHF 4JFYA 4MJ4A 4X5LA 4GAFB 2WAHA 4ZAKD 3VFGL 3WFCH 5IB4B 5LBSH 5DO2D 3IFLL 4DN3L 4UTAL 4HUWB 4QT5A 3GMPB 1SY6A 5C0CB 1ES0B 3KPPA 3BPCB 4BFIB 3QEHB 1G6RA 2AXFA 1A14L 1CLZL 4CADA 1VKXA 1R3JA 3U9PL 1QSEB 1WT5C 5HHOB 3ZTNL 3D39A 1FZJB 3TA3B 1KNOA 4JQXA 3H7BA 4PGBA 3TBTB 3N06B 4FP8L 3F58H 5KVFL 3U0TA 4XCCL 2HFGH 5TDPA 4PJ7E 4NFBA 3L3GA 1RIUH 5BZDA 1T1XB 2EZ0D 4ODHL 3UC0L 4Z77A 4YLQT 1EPFA 4OCXH 1S7QA 3QDMA 2X4QA 1KCSH 3RVTC 5DK0B 2IH3A 3HC3H 4LIQH 3DVNA 4LPWA 5FF6B 5JW4Q 2XG5A 3BD4A 2ZSVB 4P46C 1EO5A 1JN6A 4XCFH 1S9XA 1UFUA 1UQSA 1A4KB 3TWCH 3U9UB 3KPMA 1JGLH 2OJZH 3JWOH 1I1AA 5E03A 4PLNC 5D6DC 3M17A 2D7NA 4Y4KD 1UM5L 3FZUC 3OX8B 5IHZB 1BP3B 3BKJL 4GRWB 3G6JA 3SKMB 4JM4H 2XYCA 4PRAA 1ZLWH 2O5YL 1V7ML 2CMRH 3VFSB 5AD0B 3GMLA 3BDYL 3VXSA 1S5HA 1MFDL 4LNRA 3FQNB 4AENB 5IB4A 5GGVL 1NAMB 4HUWA 5FYJD 5LXGL 1QLRB 2A6KA 3GMPA 4G6FD 5C0CA 1ZE3C 1ES0A 2FHCA 3UTTE 3BPCA 4BFIA 3CC5B 2ZG1A 3QEHA 1OTUC 4EZMA 5IW6B 3ARRA 4LBEB 3LEYH 5H35B 2FZ3B 4YGVA 3T09A 1NQBA 1QSEA 2VDPL 4PP1C 3QBTB 1EJOL 2ADIA 1FZJA 1NCDL 2OK0L 3TA3A 4PJXE 2JCCE 5I15H 5CD5D 1CICD 3TBTA 5C08D 1KG0B 4PLOB 3GNML 2DLFH 4KDWA 3V7MA 3KR3L 4XBGB 1A6UH 1HCVA 3BEWB 4S0TD 3WLBB 3HMXH 1T1XA 3U4BL 4N5ED 5C6TL 5GRXG 1X4XA 1D5BB 1NFKA 4LKCB 2BNRA 1XGQB 2Z8RA 4S1RH 1ZT1A 2F53D 4QGTA 3QQ9C 5DK0A 5DK3A 3WDHA 5BV7C 2V2WB 4X6CE 4JN1H 2ZSVA 2O5ZL 1A4KA 1RHFA 1T2QL 3U9UA 3T4YB 3BXNB 2DQIH 1C5CL 2NY0C 3DRTB 3OX8A 3ULVC 1R3HB 5IHZA 2R69L 4J3XA 4O02H 1OM3L 3SKMA 4NZTH 5C6PB 4JFEB 4P23C 5JO5B 4ZUSB 5AD0A 1S7TA 4LLUA 1B4JL 4FQ2H 3FQNA 1IGCH 4MHHG 4AENA 3DXAD 1NAMA 4BSWB 4LKXB 3SBWA 4N9GB 5HY9B 2WBWB 1YMMD 3AROA 4UNVA 3O2DA 3LQZB 3BD5A 1QSVA 1YEEH 1VEOA 1J0HA 4AT6A 4S1QH 5IW6A 4DVBB 4LBEA 5DO2C 1E4XL 5H35A 1EBAA 4WNQB 2FYYA 4JFPA 3L7EB 2QHLA 2YUWA 3OPZL 3WSQL 3K8MA 1NCWH 4Y5XA 5CEZL 4NBXB 3CFJB 1UM4L 1F4YL 4CBPA 1HZHL 5C0JB 1SVZA 5DK2A 1K4DB 1MI5B 1KG0A 1GOGA 3I75B 4NQED 3LV3B 1XZ0B 3CLFH 4ZUTB 1RUMH 4W4OC 4CJ1A 1EHLH 4P2QB 5E2VL 4HLJA 1N5YH 3W9EA 1A6VL 2NXYC 1S7UB 4L1HA 2LAGB 2VSCA 1OSPH 4FMKA 4XB7A 1R3IH 3FRUB 1WWCA 4LKCA 3JV6B 5F8QC 5DT1L 1I8LC 1MWAB 1D5ZA 4ZQKA 2EC8A 1DFBH 3ZTJH 3QQNA 3I3BA 2DD8L 1K8DB 3MV11 3S5LB 5B38G 1P6AB 2RGSA 2ZCLH 5L6YH 1VFMA 3DRTA 1RSFA 1CVSC 5I1CL 5C07B 4ORGA 5C7XH 5CEXB 4FMFA 1GGBL 4YX2L 1MCDA 5E4EB 1ACYL 3WE6B 5JO5A 2A9NL 2QQKH 3L3OA 2NW3B 4Y4KC 4ZUSA 1R3LA 1FVDB 3BN9D 1EUUA 3P4LA 4R3SB 1OAXL 1PFCA 3ARGD 5HYQA 1F02I 3WS6A 1U91B 4K3DH 1MIML 3ETBF 3MLXH 4ONGH 5K9JH 4OJFL 4LKXA 3U83A 4XX1E 1TJHH 3KXFD 4L8SB 2D7OA 3C6LB 1OTTD 3LQZA 3QUKB 1AFVL 4WHTA 4PJHE 2FEDD 3T0BA 4GKOA 1DVFB 1REIA 2DKSA 4WU5A 4NQCB 3K2UH 4G8GD 4WNQA 3QXTA 3KPSE 5KSBF 1RZFH 2APTA 5JXEA 3CFJA 5FGBA 43CAB 4F15B 1JRHI 4HQQH 5JZ7D 1M6OA 5C0JA 2KDGA 1TVHA 1K4DA 4OQTH 5FKAA 1G7HA 1NKOA 3ARPA 3I75A 1XZ0A 2RCSL 4RMRA 3DLQR 1V7NL 1MCWW 4HIXH 5LGHH 5TQ2L 5CD5C 4A6YB 1RU9H 1S7UA 4U1NB 1BGXL 1HHIA 4Y2DD 4ZO8A 5IFAL 3OKDB 3SO3C 3FRUA 2OI9C 3BYYA 5I75C 3ARYA 4JRXE 1MWAA 4QOKE 1FNHA 3V0WL 4F3FB 2CRMA 4BH7B 1MLCB 3ULVH 3PIQA 3S5LA 1GYAA 5IB2B 1HSBB 4ENED 1I8MA 3JWDL 3VGFA 3F6IA 4WRLA 1QFUH 4WTZG 4M02A 5C0CD 1H3PH 4BELD 3NCYP 5C07A 1DANT 2RFXB 3VXUE 4V1DE 5CEXA 5HYSG 5KN5B 3CFKB 4YHIB 2J8UF 2XXMB 3HG1B 4X9BA 1A7NL 2WINB 2NW3A 5I30H 3DECA 4PJXB 1QSED 5HHOD 4H26A 1FVDA 5JIKA 2CK0H 4R3SA 5ILTH 3TA3D 1RZKL 2VWEC 2NNAA 2NY3B 1TCRA 1SMAA 2YN5A 2RB8A 3DV6A 3C8KB 3QAZB 5CP7A 5EU3B 5GS0L 4L8SA 3C6LA 2VR4A 1DQDH 3QUKA 5SWQB 1RJLB 4NNYB 3BP7A 2J8HA 3NFSH 3FHAA 3CLEH 4N68A 3FAWA 3VFMB 4NQXB 2ENYA 2EDWA 1YNTA 4KVNH 4ONHA 4D9LH 5HD8D 2UWEB 1FSKC 4NGHH 1MFNA 1YEDB 4XMPL 5CEYA 5BS0E 1EEZB 4A6YA 2XZAH 4XC3H 1E4JA 4U1NA 2VERN 3GBMH 5J1SC 1MFAL 5GRYA 1ZSDB 3CFBB 1J0KA 2X7LB 4QF1B 4LSUH 3OHXB 1N6UA 5CSGA 2BHZA 1I3GH 4PLJC 2ZCHL 3BQUB 3HI6H 3FCTB 4F3FA 2E6QA 2AABH 1FL6B 1RUKH 4WI8A 4H88L 3B4NA 5IB2A 1IRAY 3Q6GL 3WKNA 1RHHB 3QDGB 3MPCA 2P44B 1JBJA 4NNPH 1R6VA 2AJYH 3CFDB 3NFPA 1QP1A 4JKPL 2RFXA 1ERNA 2ENSA 4I9WD 1FL5A 3CFKA 3J8F7 4WI2A 4KUZL 2GT9B 4YPGB 5ESVA 3BP5B 3HG1A 4MJ2A 2WINA 4Z7WA 3MV8B 4XAKD 3WFCL 4FFYL 5LBSL 1F3JB 2X70B 2K7PA 1AXSB 4DKFH 4P57B 2MQ3A 3E2HC 5TE7H 5EU3A 4NQDA 1OT2A 4YHNB 3ARGC 1RJLA 2ESVE 4NNYA 5E9DE 3JV5A 4UI2A 5ITBH 3VFMA 4XP1H 4AIOA 4WGWB 4NQXA 1S78C 1OGTB 1KB5B 3WYRA 2GCYB 1CGTA 3F58L 4X4ZA 5JR1H 4FRWA 1YEDA 2HFGL 3C09B 3KLDA 4ZFZB 1RVFH 1RIUL 3QZWG 4XNMB 2C3VB 1EEZA 2VDLH 1PSKH 3O6LH 4KRPB 1KPRB 4OCXL 4XWGH 3VGGA 4NBYB 1ZSDA 4FN0A 1KCSL 4YHYB 3MRNB 1NUFA 1FVCA 3U1SL 4QF1A 3HC3L 4G8IB 4LIQL 1BQSA 4JFED 4HZAA 2BY0A 5BVPL 5D2LF 2HVJB 3LAFA 2NTFB 4XCFL 4Y2DC 3TWCL 1FL6A 1LO0H 1PZUB 3RL1B 1U2CA 5C9KA 5IFJB 2OJZL 2YXMA 3JWOL 4YIQB 3QDGA 5F9OH 3U36B 5GS2D 4KK6D 2MTPA 1FFRA 2R2BB 3ZYJA 4MB5A 2XZZA 1KJMA 2VN4A 4JM4L 4WW2B 2BERA 3BESR 5E2WH 2CMRL 4ENEC 1MCNA 2GT9A 4YPGA 2Z8SA 4KFZC 2QQNL 2YUXA 3UPAA 3QJHB 3MV8A 4K23H 1JIBA 3L5WA 2R2HA 3DYPA 1G0DA 4Q74A 3LD8B 3MLVH 2X70A 2ZCKL 1AXSA 1FGVH 5D1QD 2VR9A 1MI5D 2AVGA 1FH5H 3MRIB 4M93B 4PG2A 1EAPB 1OGAE 4UILH 4MSWA 2YRLA 1LWRA 3LEYL 4P2QD 1A9BA 3OKMA 5IK3B 2DM4A 2J2ZA 3V6OE 5CP3H 1BQHB 3LN5A 2DBJA 1QFWL 3O8XC 4FS0A 4UOW0 5I15L 1JGDB 5I71C 1R0AH 1T21B 5J56B 1E4KC 4NZDA 1A6UL 1T20B 2GY7B 5KSBE 4RAHA 1AGFB 3DUSB 4OFVA 3GUTB 2Y4SA 1QACA 4XNMA 5JW4M 4F9LC 4LHUD 2IBZY 5JOFA 1X5FA 5DRNB 1ZLSH 3CZFB 4S1RL 4J3TA 3STZB 4PJ8B 5C07D 4EUPB 2APXA 5IEHB 1FLTX 3S3PA 4G8IA 5IBTH 1DSFH 4IIQA 4K8RD 3MRQB 4JN1L 2HVJA 1B6DA 3EUUA 1K85A 4PG9B 3RL1A 1NL0H 5IFJA 3WUWG 1WAAF 2M1KA 5DC0A 3HC0A 4Q97A 3U36A 1YEJL 2VZOA 4O02L 2R2BA 4ODUA 5A2FA 5F6IC 5FYKH 4NZTL 5IBLD 3PGCB 3C6LD 3T0EB 1DVFD 3VXRB 1RJYB 4P59H 2I60H 1HE7A 1UA6L 4NQCD 3HMXA 5DD0H 5C0IB 3ZKQD 3MRFB 1IARB 4XVUD 3QJHA 1Q1JH 3QULA 3PXJA 1IGCL 1FRGH 3PV6B 1F97A 2ARJQ 5FHAH 4WWKC 4XNXH 1MQKH 5EN2B 2J8UE 1FNFA 4GXUM 1YEEL 5JQ6H 3MRIA 3TYGH 1EAPA 4S1QL 2JJWA 4HULB 1FFQA 2EH8H 4ZFOB 2D0HA 1ETZB 5IK3A 2IG2L 4BFEA 5TDOB 5D7IB 5GIRA 1NCWL 4MQTB 3FN0L 3EYVA 4G5ZL 2EE9A 4JAMB 1T21A 4RRPA 5GS0D 3FB8B 2WMPA 1E0OB 3VG0H 3CLFL 1T20A 3FTGB 1RUML 1EHLL 3GUTA 1T7XA 1N5YL 1PY4A 1NUGA 5IVOA 1T1WB 3JTTB 1SJXA 3H6JA 4NO5B 1OSPL 3CUPB 2X4OB 1R3IL 3VJ6B 5DRNA 3ZKXB 5IT2H 3CZFA 4CVZA 1I3VA 4PGJA 4PJ8A 4HMDA 4PRIB 4KK5D 1ZVYA 2OSLB 1DFBL 1OTSD 2AK1H 2UY6A 3HG1D 3LPFA 4JFFA 4J3OC 4PG9A 2ZCLL 1ROWA 5L6YL 1LILA 3T4AB 2NY3D 3PWNB 4CMHB 4WV1B 3WNOA 5C7XL 1Y6KR 2W65A 4U7MA 5A40E 2C7UA 3PGCA 2QADB 3E6FA 4JVPA 2FIKA 3T0EA 3QFJB 1RJYA 1HH9B 2H41A 3WJJA 5C0IA 3QQ4A 3MRFA 4N5UA 4POZD 1IBGH 5FO8A 4CNIB 4HEME 4K3DL 3MLXL 4ONGL 5FYKU 4FXLA 4HEPG 1TJHL 2FSEB 2DM3A 5D96B 5IVXB 5DMJB 3K2UL 1OB1B 3MGTB 1RUAH 1ETZA 3B2UD 5D1QC 5TDOA 4CMMB 4QCIA 5D7IA 1RZFL 5KOVC 3ILQD 1OP9A 1RIHH 1KIPB 4JY5H 2XQYK 3EHBD 4HQQL 5A16B 4KRMB 2Q20A 5E0QA 4R4BB 4JAMA 5CMAA 3KJ4B 1KXTB 4FQPA 2PYFA 4OQTL 3TO2B 3FB8A 3P0YH 2DJSA 2H1PH 1AR2A 3BQUD 1HNGA 4WY7H 5CFHA 5J0BA 3MLZH 3U7WH 4P2RB 4PJGB 3IF1B 5F7MC 5LGHL 3DWTA 5GSVB 1T1WA 2ADGB 1RU9L 3H8NA 1JRHH 4KDTC 4NO5A 3QDGD 3RZCA 1I4FB 3CUPA 3IAGC 1KYOJ 2IFGA 2EIEA 3I2CH 1GZQB 3EO9H 2FB4H 2VLKA 2YPLE 3ULVL 3TVMB 2OXHA 1J5OH 2EO1A 4CDGC 1XAUA 1PKQE 3MV8D 4R0LB 4ZXBA 5I8KH 5TDNA 1M05B 4YBQD 1ACZA 1OQOA 1QFUL 2PW2B 5D2LE 4R6UA 3PWNA 4MNQE 3RKDD 1LP9A 1DQLH 3HE7B 2HFEA 1DUZA 3QA3A 3RWHB 3WNNA 5I30L 2AW2A 2ZNXA 1HH9A 1HKFA 3OF6A 3OXSB 1Z3GH 3KLHD 1I9EA 4HDIB 1A6PA 2CK0L 5ILTL 5IBLC 1FNAA 3UZQA 2XQBL 4JDZB 5AYUH 4CNIA 4UOW1 1DVFC 2DLHA 4B0MM 1DQQA 5K9QI 2FSEA 1DQDL 4XVUC 1JPGB 4H25B 5IVXA 1ZGLB 3QWQB 3NFSL 3CLEL 1YEIH 4CU6A 5I8OH 2QTEA 2E8YA 1OB1A 3MGTA 3MQIA 3B9KC 4NWUH 4L4TB 4KRPD 2VLRE 3V5KB 1KIPA 1PG7W 5MENA 5IP4A 1J8HE 4KVNL 4D9LL 3TO2A 2BOBB 4NGHL 1WFTA 5J11B 3BGMB 3QUYA 1OAKH 4JANB 4P2RA 1W0WA 3IF1A 1C8PA 3QCVH 5GSVA 2XZAL 4YR6A 3ULUH 4XC3L 1JUFA 3GBML 3NPZB 5DJ8B 4NZJA 3N9GH 4WCYH 2FX9H 3NIFE 2XWJB 1HYSD 4LSUL 1I3GL 1UZ8A 3MOBH 4XP5H 3HI6L 4XPFH 5GGRB 2AABL 3QFDB 3TVMA 1RUKL 2IPKB 3MRDA 4LPCA 4L3EE 4E41B 4R0LA 3OJ2C 1R3KB 3VFRB 4KK5C 4NNPL 1M05A 1VFAB 1OTSC 2PW2A 3H3KA 3PHQB 4QRUB 2AJYL 2VSDA 5DS8A 4ZD3H 3L9RB 3QIUB 3BKMH 4ZOEA 1YY9D 4LLAA 3HTLX 1WAAE 3BIAX 4ZPTB 2QBWA 3SCMB 4NQVB 1MNUH 3OXSA 3QAZC 5DFVD 4HDIA 4U33A 3WS3B 5I0ZA 4X4MA 2QR0A 4YXKL 4KAQH 1HEZB 1JGUH 4DKFL 2BSRA 5TE7L 4R90H 1WFNA 5IMMA 4Y1AB 3L5IA 1JPGA 4POZC 4H25A 1GAFH 5JORB 2NY2B 1BPVA 5ADPH 2AV7B 1Z0NA 4TUKH 5ITBL 1Q94B 1V3KA 4JJ5B 2AV1A 4MJ6B 4MDIB 4XP1L 2D03H 1CS6A 4PV8B 3UEZA 3U4EB 4PJ8D 2B20A 5JW3H 3KPRE 4PJCF 4OF0A 5JR1L 3R0NA 5EPMB 1H15B 3O4LE 3B2UC 5B3NA 3BGMA 4ZODA 2HJFA 1RVFL 4P2YA 4JANA 3EHBC 3HR6A 3GIZH 3RHWK 1JZ4A 4D9QE 2VDLL 5BZWB 1PSKL 3O6LL 4XWGL 5E5MB 1A4JB 3BQUC 4Z7NF 5CSZA 1J86A 1P4IH 2XWJA 4WHYG 1ZK9A 4K7PX 4OCRH 4WUUA 4Z7VA 4NNXB 4YNYB 4PY7B 5GGRA 4P5TA 3T0ED 3VXRD 3QFDA 4D94A 1LO0L 3L95A 1CTNA 4FQXB 4NJ9L 2DKUA 2AEQH 4E41A 3P2TA 1CD0A 1A6TA 1QSFE 2HT3D 1WTGT 2ITCB 2X9XA 4C56B 1R3KA 5AYQA 3DROA 5DEFA 3PHQA 3LS5H 4QRUA 4JM2B 3HE6B 1AKJA 3DETD 4X80H 5E2WL 3QIUA 2RBLA 3MUY1 4L3AA 5BS0D 5EUKB 5C3LD 5C8JA 1BZ9B 1YA5A 3BW9A 2DM7A 2L0DA 4YBQC 4MA1C 2FL5B 4O00A 3SCMA 4K23L 4NQVA 5HHQA 4LLYA 3WS3A 3MLVL 4LEXH 3R8BB 5MHSD 1FGVL 2B8OT 2CR6A 4M6AA 5E4IA 1FH5L 3WXWH 3UROR 1MHEB 2BRRL 3IJYB 4Y1AA 2CO7B 4UILL 5ISZE 4E0RB 5MI0C 4M43H 5JORA 2XRAH 4OLUH 2I5YL 5J1AB 5FA3B 4JJ5A 4MJ6A 1TETL 4QNPE 1EEQA 4M1CD 3TH4T 1NAKH 1UJ3B 1GIGH 4PV8A 3QEQE 3U4EA 4PRID 2GTZB 5JLZA 3JSSA 3BH9B 1KPVB 5EPMA 2K7QA 2RR3A 1H15A 4XBPB 4MLIA 4KRPC 4PS4H 4CU7A 5MEPA 1A9EA 1ZLUH 3WFHA 4YHYC 5BZWA 3MJ9H 3CH1A 1ZLSL 5FHBH 5EOCH 2APBA 1VFBB 5L2KB 5KSAB 3NCJH 1N26A 3LKPA 4LCCB 5HXMA 1UWGH 1FJ1B 5LGKA 3MCKA 1Q9LA 2QADD 5F21B 4LF3B 5IBTL 3AMLA 1JP5A 5DSCB 4NQSB 4NWTH 4YNYA 4PY7A 3QFJD 1F4WH 3PHOB 2AEPH 4FQXA 4LVOB 1U8OB 1NL0L 2X4TA 5CP3A 1HYSC 4Y19E 5GSRA 1UM6H 3ZZ1A 2ITCA 1N64L 3FQWB 4WW2C 3FT2B 4KJYB 3GMRB 5EH1A 3TEUA 3ZKND 3VGAC 2NR6D 2XPGB 1LE5A 4PBVC 1BECA 5ANME 4G9FE 4L3CB 5L7XH 1S7VB 4JM2A 5HGBB 2OXGA 3IU4H 5F6HI 2BVQB 4P59L 2I60L 4CRPA 4LCWB 4OZIB 1LMKA 2VDNH 5DD0L 4PJEA 1Q1JL 1I8KB 1X9QA 3X17A 3MV7B 1FRGL 4MQXD 4M93C 2QQLL 5FHAL 4XNXL 1MQKL 4EBQH 2ARJB 4NO2B 3WKML 3RL2B 2DTMH 3VA6A 5JQ6L 1AP2B 5DFVC 3TYGL 2DQTH 4YEFA 3OJDB 1VENA 5FCUH 4E0RA 2EH8L 1OOAA 4DKDC 1M7DB 2ZZUT 3CCHA 5J1AA 5FA3A 4QLRA 2B5IC 2VTFA 4NP4H 4YBHA 1S5IL 5MEQA 4I0KA 4PV9B 2EIBA 2DI9A 3UPRB 2GTZA 4I18C 3UTSB 1ZAGA 1CGWA 3BH9A 3VG0L 3TVMD 4G3YH 4XBPA 5LCVH 3GJFK 3QQ3B 2IBGA 1P2CB 5C0AB 5IV2A 4H8WH 3IFPA 2PXYB 5KTEH 5IT2L 1BHGA 3LKSB 5KS9F 1VFBA 1Z0MA 1K5NB 4F58H 5KSAA 3MRHA 4LCCA 4BM7A 1FJ1A 5GGSB 3HE7D 3UO1H 2AK1L 5DSCA 3OV6A 4NQSA 4OZHF 3S4SB 5A3IC 4JB9H 1U8OA 1R5IA 4M7LT 5DEGB 1NCNA 3FO0H 4RGMB 1IEHA 3FT2A 1CFBA 3GMRA 1A2YB 2XPGA 3LKQA 3S37L 3LZFH 2X09A 4C55A 1S7VA 4LL9A 5HGBA 3P11H 3GFUA 4FFZH 2RIKA 2HT3C 2VOTA 1CGVA 4P5MB 2BVQA 3MMEA 4ODSH 2JJTA 5E8PA 4LCWA 2ZG3A 4OZIA 5GZOC 1NFDA 3UJTH 4GKZB 4L4TD 1I8KA 3MV7A 3DETC 2P8MA 2E7LC 2FJHA 3KPLA 4WI4A 5GGTH 3W2DH 2ARJA 1RMFL 3DX9B 3RL2A 3C08H 1AP2A 1SEQL 2SEBB 4P4KA 4QEGA 4Z5RB 2OR9H 5T1MB 1RUAL 4LVNC 1M7DA 1I85A 5JIHA 4ZNEA 1FP5A 1RIHL 2YBRB 3LDBB 4JY5L 4MAUH 4OD2A 5F1SA 4JZJB 4X4YB 4QRTB 4PV9A 1QHOA 3VXQB 3UPRA 4X98A 3D18B 3P0YL 2H1PL 3BJLA 3MSPA 4PRHE 1NFIA 1KJVB 2DIJA 4WY7L 3MLZL 4M1CC 4B7LA 3U7WL 4FZEH 3FQRB 1KTDB 3QQ3A 4HJGB 5F1OB 3ZKXC 4FQIH 4EI5B 1P2CA 4E41D 2B7DT 4YC2B 5C0AA 1JRHL 1EA9C 4RMSA 4KROB 3KS0H 4PJCE 1Q9WA 5HI3D 3LKNA 2PXYA 4N1EA 2ZUXA 5FUOH 1K5NA 1BJ8A 3I2CL 3ILPB 5E8NB 3EO9L 2FB4L 5GGSA 3RY6C 4PJ5E 5BOPA 3QXWA 4PYHA 2ZUVA 3OGOE 1J5OL 4O4YH 3S4SA 1GGCL 3SCMD 5F70A 4Z7NE 1OAUH 4CMHC 4WV1C 5DEGA 1GC1H 3MA9H 1CE6A 4TUOA 5I8KL 3SE4C 3CVHH 2QADC 4NN5B 5C0GB 1XMWA 4LK4A 5F7FA 4HG4J 1DQLL 3BPLC 1T4KB 2OX5A 4Y1AD 5BMFH 4LMQE 2NY2D 4IDJH 4P5MA 2GUOA 1JYNA 2NR6C 3F7RA 4PRPE 4XHQA 4X5XB 4H20H 4OZGB 1Z3GL 1NCBH 2P49B 3PQYE 2YD6A 5T5NG 4N1HB 5SV3A 5AYUL 2GTWA 4D9RE 1P5UA 4N8PA 5EBLA 4KTDH 2SEBA 5EG6C 1HWGB 3D87B 4Z5RA 4MQXC 1QR4A 3R1GH 1YEIL 1TVBB 2HMID 4LLDA 5I8OL 2IF7A 5T1MA 4RRPG 2OS7A 3AXLA 4NWUL 1NMAH 4GMTH 5I1LB 3LIZH 2YBRA 3QWOB 3BP4B 3SO5A 1OHQA 3LRSA 3VXQA 4ZS7H 3D18A 1HHGB 3DVFA 5T33H 4LQ1A 2HLAB 1KJVA 1G9NH 5F44A 1OAKL 3FQRA 5CJBA 1N0LA 3QCVL 4WDIB 3ULUL 2Z8WC 2R4RH 3AAZB 3AB0B 3S35H 5ID1A 3UJIL 4RSVA 4UDUB 4C56D 2PYEE 1ZS8B 5DURB 3N9GL 4WEMB 4WCYL 5FFLA 3HLAA 4UOJA 2V17H 3TBVB 1CQYA 4UT9H 3HE6D 3P0GB 4XP5L 1C7SA 1MRDH 4R0LC 4XPFL 3CFEA 1CQKA 2APWA 1DP0A 1BQUA 1S7RB 4HS6A 2G2RA 3IDGB 4DEPB 3VXPB 4BQ6A 5J57B 3HE7C 3MX0A 1CU4H 5C0GA 3V6OC 2BVOB 4HAFA 1YEFH 5ELIA 3PP3K 1T7VA 2JJSC 4ZD3L 3BKML 1V3JA 5TF0A 4Y0GA 5JNYB 1T0PB 3RRQA 4DVRH 1MNUL 2CIIA 4OZGA 5FV1L 3IB4A 1KTRL 2CDEA 3MRPB 3AY4A 1WBZB 2ZSWB 4XI5D 3RVVC 4KAQL 3ZTJG 4HF5H 1U8IB 3BMWA 4J1UB 1QLEH 4AIZA 5FYKD 4HFWB 3C6SB 3BSZH 4R90L 3TZVB 5E6IB 5HYJE 1CFVH 1N2RB 5ADPL 2VISB 4TUKL 4KK9D 5IGXH 2HH0H 2D03L 1YQVH 5I1LA 3RQ3A 3QWOA 2CJUH 1A02N 5L2KD 5KSAD 5JW3L 5D8JH 3CDYA 4XPGH 1LO4H 4Y4FB 2LFGA 5DD1H 4DAGH 1HHGA 1CTOA 2HLAA 3EDKA 4R7NB 5JDSB 1CF8H 3DJ9A 5J1TC 3AAZA 3MUHL 4UDUA 1YEKL 4YFLF 3EOBA 4JY6B 1ZS8A 2F15A 2E9JA 1P4IL 1MRCH 4FQQA 3I84A 4I3GA 1U8KA 1T7ZA 1XGYL 4OCRL 1CD9B 1IILE 2ATKB 3CXHJ 2B4CH 5HI3C 3PWVB 4JRYB 4LCWD 2AEQL 5KS9E 3FRPG 4M6NL 4AL8H 1H3WM 3IDGA 1J8HD 2ZJSH 3MV7D 3VXPA 2X4RB 2BVOA 3LS5L 3TP4A 1AGEA 1NLDH 1NBZB 1XF5A 3RWJB 4X80L 4XP4H 1IKFH 3OR6B 4RA0C 2E7BA 4MXQD 4MXWH 1G0XA 1EGJA 4JKLA 1P4LB 5KVGH 5ALBH 3MRPA 1WBZA 1FG9C 4LEXL 1BFOA 1U8IA 4J1UA 3K4AA 1HN1A 4L4JA 2NY2C 4HFWA 3C6SA 5EORH 3TYFB 3UTSD 5HI4D 2F9BT 3KYNB 5E6IA 1XR8B 4HIEB 4M43L 1N2RA 4U1SB 4JO4H 1P7QB 4G80B 4MX7A 2VISA 4OLUL 5C0AD 2RQ8A 1RUPL 4UUJA 4YHZH 1MOEA 2PXYD 4JQVC 4U1LA 1DBKH 1JTOA 5CJ8A 3SKUD 4XVSH 4MGXA 5DJCA 2HMIC 4Y4FA 4BH8A 4YK4C 4OZ4B 3C60B 1H3GA 4PS4L 4R7NA 3V8CA 2YA1A 4QHNB 5JDSA 1N5AB 4X0KB 5FHBL 4RAUB 5CIPB 3TFKD 4JY6A 1X5XA 1YEGH 3NCJL 3MC0A 1UWGL 5KVMC 4OZFH 3MBEB 1JPTH 4NWTL 1HHHA 3MYZA 1F4WL 2ATKA 5I1HH 1SVCP 2AEPL 2OQJB 3PWVA 2KH2B 4QY8B 4WI9A 1UM6L 2BNUA 3HE6C 1S7WB 2BX5A 1C16A 1RJCA 2X4RA 4P3WA 3RVXD 3OKNA 1KACB 5K33A 1NBZA 3RWJA 4JQIH 3IU4L 4HK3N 3UBXI 5B3JF 4AK1A 4DZ8B 1M4KA 3PDOB 2VDNL 3MJ9A 3HR5B 2X6MA 5EOQH 1NJ9B 4MAYA 1XF4B 1CFTB 2H45A 4EBQL 3QUXB 3L5XH 3SY0B 2DTML 2DQJL 3TYFA 4NKQB 1YC7A 2DQTL 3WNKA 1NEZA 4IBLT 5FCUL 3G9VA 3DSFH 4XI5C 1UJ3C 2PYEB 4N9OB 4U1SA 1P7QA 4EI5D 3Q5OA 3IAPA 2MFNA 4KROD 4PJIF 2DAVA 1ZHLB 1UH2A 5CKGA 1MCQA 3A67H 4XTRC 2L7JA 3RNQB 1A7RL 5F1KC 2HTLD 4N0UB 3VFVB 3VXMB 1UKSA 5T3XE 1WF5A 2BY3A 1RIVH 4OZ4A 4JREB 4QRPB 3C60A 4G3YL 5LCVL 1HH6B 3TGXA 5EULV 3NIGE 1TTFA 1Z2KA 4QHNA 1S9KC 5BRZE 1N5AA 1D5MB 4X0KA 3C5SA 5KTEL 4RAUA 1NKRA 3PWJB 4S1DD 1L4IA 5D5ME 1O0VA 4GRLC 1W72B 4Y16C 5TJWK 3UO1L 4HPOH 4RGNE 4U4BA 3UYOD 1YPZF 1BBJB 1QBMH 5FXCH 4JB9L 1MIEH 3DNKA 4QY8A 3PUCA 1OP5K 5T3ZD 1XH3B 3FO0L 1P4BH 4TSBH 4J4PA 3KHQA 3LZFL 1E4WL 3VXTA 3P11L 3GMOB 5AEAA 4ODSL 1L6XA 5B8CC 5GQBA 4F9PC 2Z92B 4GW5B 3UJTL 4ACPA 3EO0A 5B39G 1GGTA 4GG6E 3VDCA 1NJ9A 4XXCC 5GGTL 4FQLL 1XF4A 1CFTA 3W2DL 3QUXA 3SY0A 3C08L 2V5TA 4KJPD 2VZ1A 4WUKH 4MMZC 2OR9L 4O2EB 3WMSA 3LKOB 1ZT4A 2Y9RT 3NN8B 3RX5A 3MV01 4UV7H 5E08H 1K4CB 3STBA 3GKWH 4MAUL 5HI4C 5DURD 1ZHLA 2WUCH 3RNQA 1U93A 4N0UA 3VXMA 1JWSB 2PCPA 3KYKH 4WFHD 5ABDE 5EUOA 1H3VA 4KDVA 3QWRA 4F8TA 1PW3A 4ZPVA 4FZEL 1HH6A 3KPOA 4ONFH 1KN2H 1VSCA 2P46B 4FQIL 3RGVB 1IQWH 3TNNA 3CFIC 2GI7A 1HYRC 3A0OA 3CIQA 3PWJA 5GGTA 1P7KB 4YHOH 1YC8A 2XZQH 4XRCB 3X12B 1KC5H 1ITCA 3RJQB 3ZE2F 3V4UH 4O4YL 4ZTOH 3DO7B 4RGMC 3RUGB 1BBJA 4E42B 4OM1H 4BA8A 1GC1L 3MA9L 2O61B 3QUMH 1XH3A 3CVHL 2DKMA 1AO7B 5AG8A 1CL7I 1J11A 1P6FA 5EU6E 1FCGA 1FIGH 2YHGA 4M62H 3H7LA 3TZVD 2CLZA 5E6ID 5BMFL 2CRZA 3ARDC 1A7BA 4IDJL 2NW2B 4M7KH 1UXWB 5D6CB 1NCBL 2Z92A 4NQTA 3RVXC 5E00B 5BJTB 1XF2B 3S9DB 4S10A 2Y36H 4R96B 1I7UB 1F58H 1QRNB 4PJHA 4HIHB 4OFIA 3BZDA 1NGZB 3FOMA 3REWB 4YZFF 3ARSA 3M1BA 1IE5A 3LDBC 1AD0A 3KPSA 3R1GL 3VMNA