3MV8D

Crystal structure of the tk3-gln55his tcr in complex with hla-b*3501/hpvg
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
200
structure length
200
Chain Sequence
QVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQDLGTSGSRLTFGEGTQLTVNPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
publication title Allelic polymorphism in the T cell receptor and its impact on immune responses
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2010-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mv8D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mv8D02
2VLJB 4KJYB 1RIHH 4DEPB 5JOPD 3KLHC 5D7JA 4M43L 2A6KB 4MVBC 2C3VB 4P3DA 4AIXA 5FOBB 1JHKL 2ERJC 3IFPB 2B1HH 2NTSP 2J6EH 4NQUA 5CEZL 4KQ4L 1FVEA 2F54D 3N1PC 3GSNB 5I6XB 5DURD 1EJOH 2NX5A 4ACPA 4AQOA 1QLFA 4H1LB 4OB5L 2DBJA 1YUHB 1FNLA 1RZKC 1S7RA 1BD2A 1H3VA 5B38A 1IARB 2V17L 4F7TA 3DV6A 1YEJH 5HYJE 5DO2D 4GMTL 1FORL 4R4FH 5J11C 5J1TC 1DLHB 1OAQL 5HD8D 2OK0L 1KNOB 2DL9A 1A6TB 3CJJA 4FMFA 4D0CB 4OCXH 4APQA 3FFCB 1TFHA 3VCLB 4XP6H 3STLB 3W81A 3GHEH 2X4SA 1N6UA 1EGJA 4GRMA 3L3DA 3LOWA 3TBSA 2IBGA 4Y88A 5F9OH 3OB0K 5DRNB 5FO7A 5IFJA 5JLZB 3WIFB 4LLWB 1J1XL 4KROD 5DUBB 4F9PC 5IG7A 3VFOB 1RZIA 2GHWB 3QI9C 5L2KB 4O9HH 4J23A 1X7QA 2EYRA 1BOGB 2AK1H 3W9DB 4HJJH 1W72H 2HH0H 2X2YA 2OS7A 3MBXL 4LQFH 4RCAA 1BJMA 1FVDA 5KSAB 4G7VL 5TQ2L 4I13B 4KHXH 4GG8B 1HHGB 4NRXA 5F1NA 2QEJA 3MXWL 4C58B 4MAUL 3N1QC 4J7RA 3KLAA 5FF6A 1UH4A 2IAMB 4IRSB 3O0RH 5LWYL 2NXZD 1N4XH 5KVFL 2M8XA 2HTLD 3VXQB 4G6AD 4NQCD 5JHDB 2CKBL 4YE4H 3IDGA 5ERWA 4BQ8A 3T0DA 2YN3A 3TVMD 3VWJA 4L4JA 1T5XB 5IBLD 4JANA 4LASL 4MQXD 1FPTH 1X4YA 1S78D 2VAJA 5JIHA 2OR7A 2D7MA 5T1DL 3DXAE 3V6ZA 1DUZB 4KK6D 2DLFH 2ZSWB 1T21A 1BQHG 1KJVA 4YPGA 4GRLB 4R7DB 1ZSDA 3UJIH 1VGKA 5TDNA 1VEMA 3G6AB 5JW3L 4FQ2L 3D6GA 3UTQB 4PJEA 4PPTA 4YNYB 3SDXF 5DGRA 3GSOA 4ONFH 4WV1A 5HVHC 1A5FH 3EYQC 4JFED 3TBWA 2OXHA 2H2SD 3L5XH 3ALPA 2L0DA 4FQHB 4Z7OE 4HUKB 3PIQA 4HUUB 3V95A 4YDKL 4D9QE 3GSQB 3QUYA 3UC0H 3MRFA 3O8XD 3SDDD 3PWNB 1TMCB 3GJEA 1KB5H 2ZKHH 4YHOH 3FOMA 2YS4A 3BUYB 3CXDL 4N8CH 5DVNA 4OFIA 3WE6B 3TESA 4G9FA 1T1ZA 3KYOA 3DMMB 2RQ8A 2R0KL 5F1IB 1E27A 4KROC 3QR2A 3TNNA 2JJSC 2XY1A 3G08A 3RTQD 1MCQA 1MCPL 3ROLB 2IANE 1I1AB 1H3UA 1OGAD 4AEIL 5KOVC 3GIZH 4CN1A 1Z0MA 2GK2A 5AUMA 2WMPA 2EE6A 4Z5RA 2ENYA 4JPWH 3VD3A 4GMSH 4R4NC 3HI6H 4F7PA 2NYYD 3O3BB 1MNUL 4P4KB 1I8LC 4M5YL 1PAMA 5FYKD 3NBNA 4LK4A 4OI9A 3CH8A 2XFXA 4YHPB 1ZT7A 3JTSA 2YWZA 1HE7A 4AEEA 4GH7B 4HXBH 3FOLB 3QJFA 5FDWA 4K07A 1LK2A 5DD0L 2DLGA 1YEHH 4P2RE 5TH2B 1D3CA 1H3XA 5F1KC 4LPTA 3TVMC 3QH3B 5D96B 3HAEG 3TC9A 1MQKH 1MPAL 3P9LA 5DJZB 1OWRM 3HRZA 4G80A 3VXRD 1C5CL 4XMPL 2FBJL 1A6UL 3RRQA 4U2ZA 3L5HA 4M1DL 2NY7L 2E8ZA 3MJ9A 4YDIL 2X1QA 3DRTA 5I8CA 5FUOL 1U42A 2P49B 1DEEB 2P5EE 3WNKA 3ZDYE 4L4VD 4WO4A 4JM4L 3LN5A 4GAJL 1ZTXL 3ZSSA 4ZDHA 1NGYB 4PJAE 1J12A 4HGKC 4RWYH 1JGEB 3EDKA 3QPQD 3U0WL 1FRGL 5EOQH 3RWGA 1UB6A 4TUJA 1IJ9A 3ELAT 3HMXL 5DMIL 4PJGB 4OCSH 1QO3A 2LU7A 3A6BL 2PF6A 2VZ1A 3UPRB 3SDDC 4ZFZA 1F90L 4JRYE 1Z9OA 4Q7DA 5MEND 4GW1A 5C6PB 4YZFE 1ADQA 3RWFB 4OGAD 2BNRE 3VMNA 2ZUUA 4FQXB 3ZLQC 2WZPD 2WIMA 3G5VB 4WI7A 2PKDA 1CDUA 1VFOA 4FHBD 2O5ZL 3SGDI 4KMTH 1HDMB 3RDTB 1B4JL 4F2MB 4X7TA 2ZUWA 4JY5H 4CN4A 1DZBA 4KVNH 3LKRA 4RAUB 2BVPB 2BRQA 4P2OA 5AYQA 3SDAB 2R0ZH 3QNXA 2KQNA 4KRNA 3I6GA 4U3HA 4FQJL 3NAAH 5BW7C 1UWEH 5I1GL 4JFXA 4MQSB 3P4NA 4S1SH 5BVJA 1E0OB 4YAQB 3KWWB 5I1KL 2CIKA 3O81A 3KPSB 1PDKA 5BRZA 4PRNB 4CADB 3UTTD 3W9EB 3RWJB 3HFMH 4XVJH 2VXUL 5EU6A 3C60D 4V1DD 4CL7A 1RUPH 4N0CC 4XCYA 5DFTA 2HJLA 5CINH 1A1NA 3MBEC 4RNRA 5JXAH 1MCNA 3IDMA 4NHUB 3VU2A 5D7IE 3CFBB 2VLKD 1KBGL 3RL1B 3WMSA 1A6VL 5K59F 4UIKH 2Z35B 2ZWLT 2YUWA 4YWGL 3IFLH 5KS9B 4PGDB 4XX1G 2D0FA 4ZUTB 3WHXB 2XA3A 3ARGB 2HN7A 4I0PC 5HHQB 3QPQC 3HPLA 3MNWB 2FLBT 4WWID 2VABA 1HKLH 1UJTA 2ZUTA 1II4E 4PG9A 5EZIL 4YHIB 2YXFA 3BEVB 4YBLC 1YY8A 1CIDA 4Y16D 1UB5B 2I5YH 4UZGA 4ZAKA 1H5BC 3CXHK 4KI5D 3RVUC 1MFBL 2QQLL 2VZUA 1U8PA 4HH9B 1GPOH 3LH2L 2BY0A 2VDKL 4DKEL 4M8VA 4ZPTB 4OGAC 2EDJA 2VISA 2IG2H 4ZPVA 4R96B 1JP5A 5B38G 3O4LA 3SY0A 1CFQA 5CP3A 1FAIL 3FN3A 5HGAB 5KOMC 3P4OB 2BDNH 3BN9D 4O5LL 4Q9BA 4X6CF 3S9DB 3VFPA 4Y5VC 1GGIH 1WC7A 2J8UF 4HJ0C 1QP1A 2A1WH 5I8OL 5JORA 6FABH 4EN3D 3CLEL 5EOCL 1H9VA 5HDQH 1V3JA 3ZL4H 3P0YH 2AK4B 1NFDB 3CFKA 3SKNB 4MA1B 1IEBA 2FHBA 4XCNA 4M7LL 4ODWA 3QNZB 3FHQA 5E9DE 3DVGB 5GHWH 1AFVL 4LCWB 2NY0D 3U2SA 2V5MA 3OJMB 4DKFH 1S7WB 3UO1H 1HINH 4NQDB 5MP6L 4X6BA 5HVFB 5EN2A 4I18C 4QRSB 3C6LC 4XP5H 3S88H 2NY3B 4OKVA 2UVEA 3BZFB 4JDTH 4WGWB 2PYFB 1AJ7L 4XI5D 1T2QL 1B0GB 1IM9D 2FYYB 2YR3A 4HS3B 4UQ2B 4H8WH 4X4YB 1JUFA 3MUGB 1SEBB 4BYHA 4XPGH 4HBCL 3RZCA 1ERNA 1HQ4B 4G3YH 1YZZA 1ZK9A 1KACB 1AGCA 1NEZA 5DJDB 2NXYC 4KDWA 4NC0B 4Y16C 4OGZA 2H32H 4K9EC 1Z0NA 3DVFA 1LP9F 3RA7L 4KI5C 3N9GL 1YJDC 4NKQB 4ZYKB 3QEQB 1OHQA 2J4WL 3ULVC 4C56A 4N5UA 3LY6A 2VAAB 5IUSA 4DVRL 2MFNA 1QFWL 5IFHH 5F72S 1NFIB 4LVNB 4HLZH 1QLRA 1WAAF 4JFDA 5C0GA 4Y5YA 1UCTA 2YA0A 5I9QC 3L7EA 3MRBA 3OHXB 4YHMH 5DLMH 5IMOA 3EHBD 1LE5B 2EKSB 3SDXE 3KXFD 5F3BB 1LO2L 3OAUH 3L95A 3N85H 5EC1A 5I1CL 1I7RB 4ESKA 1IL1B 1WV7T 3BN9C 1KTKE 1G7JA 1UVQB 3CGTA 3I6LD 1CICA 1YNKH 1FO0A 1Z9LA 2VLMD 4HWBH 2V5TA 4R4BB 1P4LA 3QDHA 1IC1A 2RR3A 3IGAB 3GSNH 3NCMA 3BSZL 3H0TB 3RNKB 4H1LH 1V8HA 4M6NH 2X4NA 4J1UA 2YBRA 5AG8A 1RJCA 4FNLH 2GY7B 4QOKD 1KLGA 5I1EL 4NUGH 3MRNB 4XNQA 4M93C 4CVXB 4OFKA 1D9KA 4LSDA 2BSED 3DTXA 3O3DA 1I3UA 4Z77B 5HHNB 4X98B 1IAOA 3LPWA 4I4WB 3QULA 4HMCA 4UMGA 1UZ8B 1QSVA 2QHRL 1NCDH 1QBMH 4OLYL 3KJ4C 4LU5L 1JNLL 4YPJA 3EYOA 1IGJB 3MRMA 4JM2B 3QIUC 4PBWD 4IMLB 1UZ6F 1R24B 3VDAA 1F4WH 5EO0B 4E41E 2MOVA 4ALAL 2GSGA 2R2EA 3SDCD 2D3VA 1CF8L 4BFBD 5J12B 4MJ5B 2GCYB 1QD0A 1GGBH 4ZNEA 5D1ZA 2W92A 4WY7H 1FL5B 3QHTC 5ANMB 4XI5C 1FIGL 1KB9J 1BVKB 2WIIA 1GGTA 5CIPB 2YD3A 2UZYB 5F9WB 2R9HC 4AIZB 1TQBC 3FAXA 4Y19E 2OMNA 3QI9A 4KQ3H 4U1SA 3QDJB 5JA8B 4QXGL 3AXLA 3OR7B 4N0RA 5CP7A 2OQJA 3E3QE 3EOBA 3H9SA 3N0PB 2EIDA 4J3VA 1V7MH 5BJTB 4DTGH 1NBZA 1HH9B 3O6KL 2XXMB 3SE9L 4U1MA 4LAJH 1EO8H 7FABH 2I26N 3EHBC 5J7CC 2Y7QA 4HXAL 1MFAL 4JHAH 3FJTA 4KTEL 4BUHA 5DZNA 4FQ1H 2FECI 5FGBA 3C9NA 4RDQF 1U58A 2VH5L 2GJ6B 3EDEA 2RBLA 2APXA 3FONB 1J1PH 5IEHB 1BAFL 2BSSB 3GRWH 3WFCL 3KPMB 4FFVC 1KC5L 1A9EB 2GFBA 2EXYC 3MLSH 3MLUL 5TGBA 4AT6B 2BK8A 4X6DB 5KS9F 3O6FC 1KPVA 2Z8SA 4PY7A 3HC0B 3LD8C 4HHAA 1CBVH 4K8RL 1QKZH 1SQ2N 2NZ9D 2FEDC 1QR1B 5BCAA 5C8JB 1M7IA 3PWJA 4YGAB 2CDFB 2OR9L 5I66A 3TT1H 4EDXA 1LDPH 3TO4C 2ADIA 3ALWA 2DKSA 1BGXH 2A6DA 4K94C 5JNYA 2XG4A 1X5AA 4LPXA 15C8L 4WI2A 3FO1B 3RIFK 5H2BB 3L3OA 4JGJA 4OFYD 5GS1A 2DQDL 2IADB 1RK0A 3LKQB 4OLWH 2R69H 3SDCC 4Z8FL 3P9WB 3VRLF 5CJBA 3GSRA 1U92B 2JCCE 1Y18B 4K7FB 4PJEF 2HG5B 4BQ9A 4O02L 3WLBB 2G75B 3M8OH 1R0AL 1S7SA 4WI4A 4Y2DA 5JPNB 2JJSA 3D39E 1U41A 3DETD 3HA0A 4HWNA 4U0RC 3HUJA 5FYLH 3SJVA 1CU4H 2DYPA 3KPRD 1Q0XH 5JQHC 4QRPA 1BLNB 5EO1A 1RVFH 3GI8H 4MAYB 1J5OH 1N59B 3S36H 1XCQB 4NT6A 4MX7A 2QBWA 2GTWA 2E27L 1BVZA 5CKAA 1KN4L 4NO0D 1MH5B 4R0LC 5K59E 2FGZA 3MX0A 1MEXL 2EEAA 5EU4B 2ZOLA 3GMRB 3NVQA 1U6AH 1D5MB 2MMXA 1L7IH 5C0NC 1JYWA 4KY1L 5IVZB 2NY4B 2PO6B 4NFBA 4M6OH 5DJCA 1C16B 2FIKA 5C0BB 5I0ZA 4PREA 1KIRA 4ZOAA 3W39B 3OWEA 1UQSB 1AXTH 2ORBL 4JCLA 2YZ8A 4NHCH 5CGMA 1NAML 2X44D 1EAJA 1FZOB 2ZPKH 2X4QB 1XGTB 3BPOB 3PWVA 4PJCE 2XTJB 1Z2KA 3RWHA 3JV4A 2ATPB 2VITA 1HN1A 1KFAL 2H1PH 2VLRE 3PWPE 3UMTA 3B9KB 3SQOL 4PS4H 5JTWA 1R5VA 2HKFH 5DJXB 1A2YA 1BP3B 2MSPA 4ELMB 1QVOB 1HHKA 5GS0L 1CE1L 3P9MA 1QSZA 3BXNB 1A9BA 4FFYL 2DLIA 1DP0A 2XTLA 1T2XA 12E8H 4KI1A 2DB8A 3IKCB 2E7CA 4HC1H 4DGIH 2DQHL 4X6CE 2H6PB 5HY9B 1B88A 1FGVL 1P7KB 5DJ8B 2DWEB 2J8UE 3IKKA 4QRRB 2GI7A 3FQXB 4Z0BL 1BECA 1OAKH 5F9JA 4X7FC 4Y4KC 2G5BB 1DQML 1MFNA 1U8JA 2FJGA 32C2A 4G43A 5ICXB 3E6HA 4LCYA 4Z7NF 3JSSA 3AY4A 4KVCH 3AS1A 4TSAH 5CUSL 1ZHKB 3S35X 3LN4B 4ZNCD 4NQTA 1S8DA 4FTVB 5C08E 1IAIM 4ONGL 3PQYE 2EDQA 4L8CA 5DVKA 1U2CA 1INDH 5D6DA 3MRDA 3DETC 2QSQA 3OB0H 3PGCB 5FO9A 4JHWL 4JO3L 1CFVL 43CAB 4LDOB 1GSMA 2F53E 3I9GL 1ORSB 3P0GB 1LHZA 4WFGD 4OCNC 3CSPA 1G9NL 2B1AL 4GS7B 1T7XA 3SEPA 3F5WA 3AM8C 4M4RA 5BW7A 4OBRA 4MMZC 5FOBA 5E24E 2H26B 4JN2B 2HFGH 3STZA 3BW9B 4MJ2A 4UU9A 5D5MA 1EEUA 3SGKC 1CG9A 4HKZA 3DRQA 5IESL 2G2RB 1KIPA 4NGHH 4OGXH 3QCVH 3F7YA 5FV2A 5IOPB 1NEZG 3NCFB 3NZ8B 4XNMA 2C7UA 2AJVH 3LRSA 1KLUA 2KH2B 2YPLB 1LP9E 3MBEA 3U83A 3IT8D 3K1KC 4DCQB 4ZUSB 3B3IA 1NGPL 3OV6A 3S5LA 3GUTA 1QSFE 2SEBA 2CLRA 1KNOA 1KGCE 3MRIB 2Z93A 1T20A 5I74C 4X9IA 2ED9A 3FT2A 4D0CA 1RFDH 2R29L 2XN9B 4XNXL 5GGRY 3FFCA 4AMKH 1MSPA 1WT5C 4FABH 1VGEL 2HT3C 4LSVH 3ZSTA 4OLEA 4X5XB 2OZ4A 2AKRA 4I0PA 1EAPA 2XKUA 3L1OL 4J3OC 4NUJA 5TF1H 5EUOF 5IBTL 2WM0A 3ESUF 2CJUH 3L5WA 4UBDD 3C5SB 1IGFL 1I3VA 3F58L 5JLZA 5KVDL 4YBQD 1MLBB 2PTTB 3LHPL 1A6PA 4BFIB 1GHFH 4NSKA 2IBBA 4JKPL 4GBXB 5JO5B 5L2KA 1XGQB 1XCTB 5HGGS 4DZBA 1BOGA 1LNUB 1H5BA 2EE9A 2XKNB 4MGXA 4PJXA 5B21A 3TYGL 1F6AA 4QEGA 3JV5A 2AEPH 2FX7H 1MRDL 3VFRB 1QSED 4NIKB 1T5WB 1MELA 1IC4L 1WCBA 4NM8L 1LO5B 2F54B 5E8DL 3GZKA 4JEGB 1DFBL 5DURB 4XPAL 1D6EA 3BESR 2DQGH 1OTTC 4NO3A 4NKIH 4HZLA 4R90L 4JG1H 2RB8A 2I07A 4W4NA 4R7NB 3MJ8A 1FJ1A 3SGDH 4XPTH 2J3SA 2OTUA 1UZ6E 5IK3B 5HVHB 4Y5VA 2HRPH 2NY5L 5DHVH 1AY1H 4NZTL 4BM7A 5SWQA 3O6MH 1HOCA 1NAKL 4P5MA 5GGUA 2R4RH 4PJ8D 2NX5E 3QUZC 3MJGX 4WCYL 1T0NA 5ID0B 1TIUA 2DKMA 4MXVE 3LMJH 1BD2E 3QUXD 2DQIH 3VRIB 4LSTL 3PHOA 5CFHA 1RJLA 5C07A 5DXWA 2ZSWA 5J8OA 1WISA 5C86A 4XP9H 5ALBL 2XY2A 4M6AA 2ZCLH 5C2UB 5M95B 1LO4L 3MMEB 4U1JA 3VH8B 1KELL 3ARFD 4YXLL 4WFFE 5C0DA 3O11A 4QHUB 5FKAA 4S1QH 1OTUC 1IKNC 3KPOB 1RJZB 4I18A 2W60B 3C6LA 4HF5H 1NANH 1G6RL 1S5IL 4LGPB 5INCB 5JUEH 5E8PB 2I9LA 1IC7H 4NKDB 1DBBL 2VE6A 1DBJL 4HIXL 2NXZB 4YEEA 5IJVA 4PJFB 4MJ6B 3OKLA 1DQQA 1DLFH 3O2WH 4UBDC 5MEQB 3ZDXF 1CGSH 3CC5B 3E8UH 4NQCB 5BO1H 3KVQA 3NIFF 2ZSVB 2EIBA 2BVQB 3DSFH 5FYJD 2X9YA 4L8BA 3U36A 4MNQD 3TVMB 3KYMB 4DFIA 2FR4A 3DHJA 3LRGA 3BWUC 5FK9A 1JYVA 4ZO8A 3MLTA 4NO5A 1LO0H 2WNGA 3TO2A 4G6ML 4WVRA 4P9MH 3QCUH 4PGCA 3EJYC 1OQXA 3O3BA 3WKMH 4JQIH 2P8PB 5IVXB 4UV7H 1GJIA 2FCBA 3TJHC 2V2WB 1AQDA 3ARDB 5E8EB 1JGUH 3LS4H 1KPRA 1I9JH 3T0VA 1EBAA 1K9TA 2CPCA 3RWIB 1CTOA 4JFEB 5D2LA 4BFGA 2XT1B 4ORZC 5ALCL 3V7MA 1KJMB 1CGUA 3VRLE 3SOBH 2DI8A 3QH3A 3WL9A 5C7XL 4WUUA 2VMFA 4L3CA 1FCGA 1J88A 3O8XB 4Z7QF 3SDDB 1I9EA 3L3GB 4PJEE 3P4MB 1N0XL 4HPOL 2GITB 1YQ2A 2VLLB 5FCUL 3MUJA 1OWWA 1QR4A 3S4SB 3HE7D 3DUHA 4UT6L 4UOJA 1B3JA 2ICES 4U7SA 1XGUB 3OTTA 1MCEA 1T1WA 3MO1B 3RTQB 2CRYA 2GUOB 1EERB 3ARFC 3PHQB 1OGAB 1CQKA 4WJ5B 1JGEA 1OLLA 3TZVD 4MD5A 3T04D 3T77B 3MYJB 5HHOA 4G8GA 4G9FE 3QP3A 3ZHDA 4Y5XC 5T3ZL 1R3HA 1BFSA 5SV4A 1OM3H 3U7WL 4U1IB 3QIWC 1DQLL 3KPLB 3Q3GB 3ULUL 4OAWA 1FYTD 4EQ3A 2X89D 5DEFB 3FRUB 1NLBL 4XCEB 4Q2ZA 4PTUA 3O41B 5JW4N 3NFSH 3GGWA 3RKPA 3RWFA 3MACL 2P8MB 2PETA 4JPVL 3OKOA 1N64H 1U8KB 4HGMA 4IHOB 4CU8A 1RIHL 1F3RB 3KPPB 4XVSL 3INUL 1IQDA 3VXRB 3BIKB 2A9MH 1CVSC 3MROA 4JFFA 1P84J 3A6OA 4F2MA 1A3RH 2B1HL 5F7LB 4PRHD 1MHHB 4XTRD 1BZQK 4LGRB 4OLXH 3WEXB 3U0PB 2NCMA 2X4OB 1JGDB 3QO1A 4RAVA 3KJ6H 5BS0D 1HXYB 1O7VA 3EDFA 2NPLX 4L4VB 4JAMA 3VE0B 4GQPH 2VL5A 2OI9C 4GAGH 4PP1D 4XXDA 4CW1B 3UPAA 1NLDH 4NQED 5HJ3B 1YEJL 3W9EA 1I3RB 5BZDA 4D0DB 2AXGA 3KHOA 3LEYH 3IF1A 1A64A 2XZCH 4NO2B 3O6FA 3T4YA 2WBJC 1BM3L 2GIYA 2CDGA 5D6CB 4KZEL 5FM5M 4OCXL 2LE9A 3QNYB 1BFOB 5D2NC 3WFDL 4GG6B 2PXYD 2HAZA 4BZ2L 2X1OA 3CFBA 1GOGA 4TRPH 2JF1A 4M48H 3TO4A 1BZ7A 4AL8H 4F57H 1KUMA 3PF2A 4ODSL 1ZANL 1JZ8A 1KLFA 1ND0A 4D9LL 2Z35A 3RWDA 3B5TA 4KDVA 4ZUTA 2R56H 3O2DH 4PJHB 4RMRA 4HLZG 5TE4H 5HHQA 3AS2A 3MNWA 3TZVC 3VMOA 5GS3A 3V6OA 2AK1L 3GIVB 4ZD3H 2ICEB 1W72L 3BH9B 4LQFL 1FL3A 4MNGB 3F6LA 3P77A 3T0XA 3QB7C 4QRTB 4B50A 4KJWD 1OB1B 1VACA 3CLFH 4XZUA 4NKOB 1UB5A 4YXKH 5GS2H 5IT2H 1CFNB 2AV7B 2CK2A 3BPLB 4BH8A 5EZLA 2WUBL 1AC6A 5FM8A 3O3UN 1OPGL 4H1LG 1N4XL 3MRRA 4ZPTA 4U6VH 4M61B 5FGCB 9CGTA 1IZJA 3UTTB 3FN0H 4ZFOA 2CK0L 1VFAB 5EZOL 3M1BA 4EVNA 3C60B 4MCZB 4V1DB 4YE4L 5D70H 2AERT 5ECJE 3V5DB 4PJ7B 5L7XH 4ETQB 2AGJL 2OP4L 5T1MA 1XAUA 3S5LG 1RUMH 3LPGA 4NZUL 1FPTL 2BRRH 4BSVB 4O51A 5C2BH 1KPUB 1CGTA 5I2IB 4R0LA 1CLCA 5BRZE 4YDJB 5C0EA 2VLKB 2X4TA 2DLFL 4WTWA 5EU6E 1AKJA 3JWDL 4OQTA 2GTZA 1JWUB 3HUJF 5DHVA 1GZPB 2AK4A 3V4PL 2VOTA 4JZJC 3QNZA 4M03A 35C8H 3QWOB 5T1LD 1A5FL 3FHAA 5C09B 2MQCA 5HYJD 1CGYA 2Q86A 1UM6L 4FFZH 4X80H 4LCWA 4DAGH 4P5KB 3CZJA 4JDZB 1NCCL 1YYMH 3VXTB 4RGNC 1LO3H 1JRHH 5JOFB 3E1F1 3SKOB 1KB5L 4QHNA 3CIQA 1EX0A 3QIBD 3DLQR 2E9IA 4XP1L 3NA9H 1CGVA 2BSRB 2OSLA 4YHOL 4LCUB 3NN8A 2BVOA 4N8CL 3BUTA 4TVPL 3FB8A 2H45A 1NMAL 3IAGC 3VGEA 3QDGA 3MA7A 3O9WD 2EDKA 2XPGB 4GFTB 4TNVF 1B0GA 4JFYB 4OZFH 1CLZL 1BFVH 1JNHA 4PGJA 1JF6A 3BVNB 5GJSL 4EOWL 1HHIB 1SEQH 1XT5A 4GMSL 5E4EC 4LRIC 5DJDA 1NJ9A 4EN3B 4HS6A 3O4LE 3RBGA 4ZYKA 1RURL 1TZGH 2VAAA 3MZGB 4HXBL 1JV5A 2QV2A 5C9KA 3KPNB 1P2CA 1YECH 2NTFB 2DOCA 4LOUD 2WK2A 4WIQA 2UY6A 1ZLSH 5I1DB 3CFDA 2NY0B 3CZFB 4XGZB 5F3BA 4OUUB 4WWKC 4NQXA 1MQKL 3QQ4A 5DQ9B 1IL1A 1NBYB 1R3IH 4Z7WB 3LEVH 5J1AB 5FKPA 4CDHA 1XMWA 1JGLH 1OAXL 3DXAD 4R4BA 3AM8A 4YHNA 2IPTH 3IGAA 1A21A 3QXTA 1XGYH 1VA9A 3R06B 1AQKH 4LP5A 4XMLL 5IW6A 4JJ5A 1IGMH 3SGKA 3MLYH 4YLQT 5D7KE 1EEZA 2P1YA 3HPJB 3UXFA 1IM9B 4YC2C 3UTOA 1CXHA 4RAHA 4Z77A 1FP5A 1BVLB 5LXGL 4KK9D 1RZGA 3G6JE 4I4WA 1W0VB 1TQBB 3OXRB 5E00B 5EPMA 3NACH 3W11C 4NDMB 1GVIA 1QRNA 1JF5A 3OX8A 3QUKB 3CVHH 1XZ0A 2BCKB 3QEHA 3QQ3A 1HNGA 1A4JB 4D9QD 5HXMA 5LBSH 3TYFB 1G7QB 4HFUH 4IMLA 1IM3A 3EO0B 3DI2B 5D5MF 5KSUB 5D1XD 5EORH 4HAFA 2PUQT 2OBGA 1RUQH 1F58H 1SBSL 5CGYD 3B6SA 4D2NA 3HZKA 3GBMH 4U1NA 4D0BB 3HMWH 4O2CB 4GRWF 1Q72H 3KXFB 4ZS7H 1BVKA 3TGXA 1VDGA 4HG4J 2IAND 4G8FB 4C56E 3ZZ1A 2OTWB 1FL6A 5ESQA 3BISA 3K0WA 4JFDE 4HMDA 5B3JF 1K5NB 1NFKA 1MCWW 3LD8B 1MCSA 3HR5B 4P48A 4GKNB 3MJ7B 3NAAL 4QOKB 3KPTA 2Q7YB 1JPFB 5B22A 2ADGA 1DSFL 3L7FB 4HUVB 2W38A 5KSBA 3PL6C 5C0AA 2ICCA 2C3HA 4MB4A 3O3EB 4HIHB 2DICA 2P43B 1QOKA 4P2RD 3UDWA 4X4XB 5F7NC 3PNWA 4WI6A 5IB4B 1U2HA 1OT2A 5E8OB 2FATH 2GJ6A 4N1CA 4TPRH 4LKXB 2HLAA 5CINL 5KW9H 2IFFH 3QUZA 2BSSA 4Z7VA 5JXAL 1LEKB 5EC2B 1G7PA 2FEEL 4X7SH 4WFEE 1AE6H 3SDCB 3BP6B 2A83A 2Y25A 5C71A 4M1GL 3LN9A 2P5ED 3EBAA 2ZCHL 1NGQL 3IJSA 3QRFM 4PJ5A 3HKFA 3OPZH 3IFNH 4NKMA 1EIBA 4KKNA 3UJTL 5SWZA 4ZTPL 1I7ZA 1CT8A 4NWTH 5IW1B 1VHPA 4L8DB 1CZ8L 2P47B 1DBKL 1V3KA 4LNRA 1K3IA 3O4OB 3NIDF 1HKLL 1DN2A 2D2OA 3CD4A 1I4FB 1QZ1A 4LEOB 4ZNEE 2EDLA 4LLVB 2J88H 4JZNA 4G9DB 2I5YL 1WBZB 3RWCA 4R97C 4H20H 4JRYD 4BH7B 3HG1A 3ZT7A 5DUPL 5EBWB 2IWGA 3WSQL 2AABH 4P23A 1KT2B 3SKMB 3DX8A 1U93B 2BNRD 1OF2B 4LARL 3HS0B 2V6HA 4OZ4A 4G6FD 3UYPA 5LQBH 1J0IA 4XB7A 3WO3B 3H9SE 4M5ZH 3WLBA 2G75A 1HQRB 1OTSD 1QFWI 3LKPA 4XBEL 5GGSB 4P5TC 4PGBB 3WXVL 4XXCA 5F7FA 3BYYA 4OLZH 5DA0B 4G8EB 5E2TL 5ESAA 1AXSB 4ODBD 6FABL 1AXIB 3MRKB 3SCMA 2V9TA 5FGRA 2C1PB 5IBUB 3V52L 1ITBB 4TVPD 1HYRC 4JB9H 2QSCL 3MRGB 4L4TA 4AK1A 3W0WA 1FFRA 3ZDZF 1FFNB 4M7JH 4U1KB 1WBXA 2VDQH 4MA8H 2F5BH 4RFNC 1M1SA 1A0QL 2BFVL 1I7UB 2E7LC 5IB2A 1JF1B 3KYNB 1U8LB 1ZA6B 5GHWL 5L9DH 3BGMB 4O00A 3MRHB 2JK5A 4KI5F 3ULVF 1FG2B 3VXSA 3OKKA 2EDWA 3QG7L 1PQZB 1W8OA 1P84K 3VFMA 3MRLB 5E2JA 2XWJA 4XT1C 1EZVX 4LIQL 4DKDC 1TITA 3DV4B 3VFUB 1TNMA 1BIIB 1DL7H 3CSYB 1CDGA 2QQKH 3SPVA 5JZ7D 5FYKU 5DZOA 5IQ7L 1VERA 1EFXB 3WFBH 3VMPA 5FECA 5CD3B 5IB1A 2R1WB 5DI8B 2ATPA 4EUPB 1JL8A 4JDTL 3EJJX 1WGOA 1IQWH 1ED3A 4ELMA 3MLVL 1NMBH 1UM5H 1FN4A 5L0QC 4M8QA 1KJ3H 5D2LF 4H8WL 1WIPA 3L3KB 4M00A 2P24B 1TTUA 3SBWC 2C3GA 4J12A 3KPRB 1A14H 1RIUH 2VKXA 5FEBA 4XCFL 1IGIH 4WW2C 5I76A 2RFXA 1F3DJ 4Y5XA 4DGYL 1A6ZB 3JWOL 1PLGH 4K7PX 4NO0B 1L0QA 1AP2A 2CQVA 5LGKA 3QIWA 4RFOL 3S3PA 5A2IH 2ARJA 3HUJE 4LSSH 3SJVE 4EJ1C 4OZFA 4NWUH 1YDPA 1ETZA 2FHFA 1GXEA 4QRPE 5DLML 5DRZB 3LN4A 4NCDA 3IDNA 3VXUA 4FTVA 2QQNL 3GSUA 4FXGB 3FQNB 4QGYA 4HK3J 3T1FB 4HWEH 1S7QB 2F5AL 4FQLH 2D4DA 4QHKJ 3FRPG 1IGYB 4HUXA 3MGTA 5HGBB 1YNKL 2QR0B 5KANG 4ZS6C 4YQXH 1BBJA 2NW2B 4HWBL 1X5XA 5CHNB 1MJUL 3ULSB 3D5OF 1SYVB 4NJAL 5IVOA 1YPZB 4HT1L 4RSVA 3S35L 5KSVB 3QFJA 4M43H 4EI5A 8FABA 1WICA 3CFIC 4UDTB 3BP4B 3O3AA 5CJ5A 5DK0A 5IFAL 4XRCA 1NC4D 2YD5A 1QTYT 4FZEL 1JHKH 2GJZA 1XGPB 4NQSB 5E9DD 5F7WC 3DVIA 5C0IB 1E4JA 2BOCB 4KQ4H 3UZQA 2K1MA 3CDYA 5ICYB 5B8CC 2GSIB 3U4EB 1HYSD 3D0LB 1CLOL 2ADJB 5C70A 4L8SC 3NZ8A 1EJ6A 1CDYA 2WBJA 4OB5H 3CPLB 1F4WL 4XNZC 2YPLA 2CH8A 5D2NA 4KPHH 5J6GA 1XR9B 3RUGB 3NTCL 4PJBB 1GGBL 4LLQB 4UILL 2FGWL 3ES6A 1FORH 3GSWA 4CN6A 1OAQH 3QFDA 2OK0H 3MREB 1ZHBB 3UZVB 5INDB 3CVHA 5DQDL 3F12B 3WHE1 3RHWK 3G5YB 2HT4D 1A1OA 1BWMA 2FHCA 4OF8A 4B7LA 1NL0L 2HRLA 2EE3A 1MJ8L 2FWOB 4I9WE 4NYLA 5E5MB 5JOEA 1CFTB 1FZMB 4JFZL 1MLBA 4JFQA 4GLRI 4BFIA 4DTGL 4OZHA 1J1XH 1Q9LB 4GBXA 5JO5A 5E8NB 1XGQA 3QZWA 4JRWA 1NH6A 1LNUA 5J13B 1YC7A 3ILPB 4RBPK 2DQUH 5DHYA 1KEMH 5MI0B 4ZXBC 2YEZB 3MBXH 4MA7L 5F1OB 2BXZA 1MHCB 2VERN 1QA9B 4G7VH 3Q1SL 5TQ2H 1A6AB 4LF3A 1Q38A 3GMMB 6CGTA 1G7IB 2YPKB 4MAUH 1KSRA 3GRWL 2QKIA 5CZXD 2EDHA 1DUYA 3MLSL 5LWYH 3SHSA 5D5ME 5CD5C 1QKZL 4PTTA 2PW1B 4LVOB 2CKBH 3MV9D 4N0YL 1QACA 3NIGE 5E1AA 4CMHB 4GRWE 2ZP0T 2F19L 2VR5A 4JZJA 5T1DH 3AS3A 2HTKD 3T65B 1JPGA 3CDGB 3LB6D 3MRQA 1NCNA 5T3XL 1HYSC 3SE3C 5IM7B 2MHAB 1FLRL 4WHDA 5KZCD 1EXUB 1N8ZB 2X4RB 3FFCE 3J8F7 5JW3H 4E41D 3VFSB 3X17A 4IS6B 5DJAA 4UI2A 2FD6L 5CS7A 4K3JL 4XBPA 5T33L 1C08A 3WHE0 1RJZA 2AEWA 2JJWA 2COQA 4LMQE 4WTXA 3BI9X 5C1MB 4PB0L 2IPKB 4LGSB 2JIXD 4OCWH 1NDMA 4YDKH 3CNKA 3BX7C 2HT4C 5L2KE 1EFQA 2YRPA 4PJXE 4Y19D 1CU4L 4URTB 3QEUB 3L6FB 3WFEH 3DIFB 4GAYB 1PG7X 1R5IB 1RVFL 1CGXA 1MFCL 4HJGA 3GI9L 5IEKB 4QO1A 5F3HA 4JO2L 2XYCA 3VDCA 2BVQA 1PSKH 4DK3A 1HH6A 1T1YB 1F4HA 4LRIA 1HXMB 2R0KH 4EXKA 4PJ8B 1ROWA 4UQ3B 1MCPH 3ECBB 4OCYL 1MY5A 3QUXB 4AEIH 2H3NB 4A6YA 3FCTA 2AEQH 1H15B 4Q9RH 5C6WH 3P30L 1U6AL 3LKSB 4HG4K 5HHME 4CJ0A 3S34L 4P2CG 5BZWA 4JFOB 3NIDE 3VG0L 1U8IB 4M5YH 2QTEA 5EBMB 2P8PA 4WWKA 4LLDB 5ELIA 4NHCL 3ARDA 3HZMB 3U7AA 2ZPKL 4F15B 3V6FB 1HKFA 5C07E 4C59B 3C2AH 4AIOA 5C3LD 1JHLH 4XVUD 4U31A 2ICWJ 1KJMA 2ZNWA 4QT5B 4PS4L 3GBNL 4JRXA 5BQ7A 2HKFL 4J3UA 5DRWB 3C09C 3TA3C 1CLYL 2AXHA 5DMKA 3H9ZA 1C5CH 4XMPH 2FBJH 1F4YH 1A6UH 1SJHB 2HTKC 3ZYIA 4YDLC 12E8L 2NY7H 3RKDC 1YEEH 3LB6C 2UUDK 3VXOB 4HC1L 5FUOH 2XWTA 3R8QA 2FZ3A 4Z78B 3ZE2E 2VDLH 1XGUA 2DM3A 1JHTB 2GT9B 4P46C 4MNQB 2IEPA 3R0MA 2F8XC 3FO9A 2FH6A 1IBGH 3RI5K 3DO7B 1OAKL 4GAJH 4WJ5A 3BKMH 1P7QA 4WU5B 4OFDA 1KN2L 1KTLB 3OG6B 1FRGH 2YSSB 3AU1B 4TSAL 4YHZH 3WIHL 3BRFA 3E0GA 1K4DB 3ZDZE 4XH2B 4M7ZC 1QFWM 3HMXH 4W70A 1XIWC 3A6BH 2EYTA 4YR6A 3PWUA 1F90H 1A7NL 3D39D 3FRUA 3FQRA 3R1GL 1G7HB 4GQ9H 3ULVE 2CGRH 4Z76A 3BKCL 2VJXA 2OI9B 1UADC 5DEGB 5EIIB 1JNNL 3BO8A 3DYMA 4FRWA 4GKSA 4FQIL 1W2KT 5FYLE 4TOYH 4P9HL 3JV6A 1Y0LB 2PYEA 2BNUB 4IHOA 4N0UA 1G7MB 4F33A 1JMXA 4G7YH 4OZGA 4PBXA 3P0VL 4PRBA 3LQZB 2O5ZH 2AJ3B 2FBOJ 4PJDB 5IROC 5HGHB 3OGCB 2HFGL 1CIUA 1UJ3C 1LEGB 1DVFD 2VZOA 4NNYB 3PL6A 5D2LE 5J57B 1U91A 5FCSH 3HE7B 4U2YA 4E5XB 4OGXL 2FSEB 5FDYA 4HD9A 4Q6IC 4WUUE 4FQJH 2UZIL 1Q94A 1HCFX 4R26L 5I1GH 5FGSA 2Y72A 3F7VB 4BZYA 4EDWH 5DDHA 5IMLA 4JQXC 3GMLB 3TZVB 1I3RA 1QFPA 2Y5TB 3JXAA 3V4VL 1DBAL 4NO2A 5D7LA 1K4CB 2VLRD 5ACZA 3PWPD 4OZFG 5KSBF 4U1HA 1P1ZA 1U3ZA 1YC8A 1BQSA 2L4OA 2OJEB 2AJYL 4CJ1A 2FO4B 2UWEB 1FYTB 4LSVL 4MHHI 4PRIA 3WNLA 5HYSB 2VQ1A 1GGCL 1HWHB 3EFFB 5HHOE 4G8GE 4ZOEA 4Y8AA 1V7NL 3BJ91 3WS3A 1A6VH 3BQUD 3TBYA 1RY7B 2E9JA 4YWGH 5E1HB 1RZ7H 1PZ5A 2BY1A 2BSTB 3TIDB 5IJKC 3TCLA 2WSKA 1LK3L 4PRHB 2FX7L 4H25B 1KIQB 3IETA 4GXVL 1F42A 5C08D 5GZNC 4IBLT 2BHYA 1XFPA 2K3TA 5BS0B 1U8MA 3LS5L 5GGRB 2J5LC 5EZIH 4ONHB 5C0CD 3C5ZA 3PQYD 1J8KA 5J6HB 3DGGB 3N1GC 3OBAA 1PYWB 5DK3A 5TFSL 4HFWA 4HH8A 1MFBH 4JFFE 2MQ3A 3NZHL 3UBXI 4EIGB 4NQEB 1MJJA 2VDKH 4XPTL 4DKEH 3NCBB 1T03L 1OY3B 4MCZA 4P5TA 4X99A 1YY9C 5EU3A 2R4RL 3D3VA 2HT2D 3PWLA 4Y4HC 1EDQA 1FAIH 3D48R 4JPIB 5EFIA 1BF8A 3Q2CA 1C1EL 4QTHA 4BSVA 3WDHA 2YD4A 4O5LH 2PXYB 3OF6A 1DVFC 3QWQB 3GJFK 3FQTA 5A16A 5I8OH 1ES0A 4Y89A 3CLEH 5EOCH 3U46B 2ZCLL 2GJJA 4H26B 4NN7B 4KRLB 1XF4B 2EO1A 3K74B 2WLYA 1IILE 1L4IA 5DJ0A 4LHQB 2CKBA 4MCYB 1NGXB 4EUPH 3REVA 4M7LH 3S97C 2R1YB 5C09A 2OL3B 2YN5A 3BZ4B 1TZIA 4RGMB 3OJDA 2KBGA 1QSFD 2AQ1A 5A3ID 1AFVH 1KGCD 1NDGA 2VR9A 4X6FA 1Q8MA 3SE4C 1DN0B 5J0BA 4J3TA 3BT2H 3V6OE 5MP6H 1O5DT 3ALXA 4LNVA 3H7BB 3O2WL 3SBWA 2HVJA 3OKNA 2FJHB 3BQUC 4ZUUB 5BO1L 1DE4B 2DM4A 1EHNA 3DSFL 2XPGA 3K8LA 2BJMH 2IQ9L 4GUPB 4LSUL 1T22B 4JLRB 5BOPA 1RIVH 4X9GA 1AJ7H 4WW2A 1G6RB 2YPVL 1RHHB 3WJJA 1LO0L 3BVNA 4PJ9D 1W0WA 4HBCH 1DJSA 3QCUL 5E2VL 2EDDA 3GBLA 3M17A 4PV9A 3IU4L 1QEWB 3QHZL 3UX9B 2KZWA 1QHPA 4HV8A 2J2ZA 5D7JD 5EH1A 3WKML 3BP7B 1YMHA 4JQIL 3PP3K 4P2QA 3RA7H 2J4WH 3TPUA 4I3SL 5K9KB 1JGUL 3KPNA 2NTFA 4YX2L 3TT3H 5ETUB 3QUMB 3ARSA 4DVRH 5F7UA 1QFWH 1IAIL 3KPQA 5T1LB 2B4CC 3JTTB 4L5FH 5HYJB 4XBGB 4Q58C 2FX8L 5HHVL 2Y36H 1AGEA 1ZWIB 3AAZB 1A7RL 3SOBL 4ZQKB 2NX5D 1LO2H 1NBYA 1NGWA 5I1CH 3DX6A 3LDBC 2AK4E 4Z7WA 3RFZC 2W0FA 3QIBB 1BD2D 4PV8B 4QYOB 5MEPB 4PGEA 4LBEB 1TQCC 4X6EB 5F6IC 4LCWE 1T7VA 3BSZH 1ZVYA 3O9WB 3V5KB 2YD1A 4UDUA 4P57B 4M7LT 5DFWH 2X4PA 3I75A 5CBAA 1ONQB 5J1SC 4APQD 2E9WA 4JKMA 1A47A 4ODUA 4XWOC 4PRPA 4WFFD 4X5WB 5JXEA 1D5XB 2EH7L 3TBVB 2BOBA 2QHRH 3LSOB 4BSWA 3QDGE 4OLYH 4LU5H 2YUVA 3BOVA 1JNLH 1PD6A 1OM3L 1A4JA 2XQYG 4O4YH 5I1IL 2B5IB 4A2LA 2ILLA 4O58H 3ZKXC 2G9HB 1MCFA 4ALAH 5JMRA 1U3JA 1CF8H 2X4UA 4LVHB 3QWRA 4LEXH 5GRYA 3PDOB 3X11A 5I73C 2CDEA 2AP2A 3HMXA 1HILB 3V2AR 1HEZB 5AAMA 3D25A 2AQ3A 4ODTH 3BAEL 3DUSA 4PJ9C 4HPYL 3DXAB 1JPSH 2V7NA 4HK0B 1S5HB 5JDJA 4OLXL 1HI6B 1F6FB 3QDMA 3QO0B 3MFFA 5FHAH 4GKNA 4YDVB 4QHMA 5D7JC 1KG0B 5B4MD 5H35B 3VWKA 3VWJD 2Q7YA 2BY2A 1S9WB 1JPFA 4Q9QH 1YMMA 5E6ZA 2ARWA 5JW4M 1TETL 2IH1A 2MKLC 2EXWC 1C12A 1NLDL 3L5JA 1JN6B 5AZ2L 2ESVA 5DJYB 4MB5A 5A40E 1X5JA 1GZQB 4OZHF 3LEYL 4HIHA 4YH6A 4HXAH 5FA3A 4MLIA 4X4XA 1KCKA 5FOJA 4KTEH 2Y07L 1F8TL 4MA3A 3TIEA 1FV1B 1E6OL 3L3IA 5IB5A 2UZXB 3FTGA 1CD1A 2CXGA 3VD5A 5JW4Q 2CLVA 4N8VB 2VH5H 2Y5EA 1OAYL 1OT1A 1CQYA 2H2PD 3SDYL 1FNHA 5D1XB 1BAFH 2IJ0C 2Z92A 5I1LB 4MD0A 4TRPL 3WFCH 1K2DA 4K2UH 4JVUA 4AL8L 3MLUH 4F57L 1MCCA 1QRNE 1K6QL 3V5HA 1Q1JL 2APWA 4K8RH 2R1XB 2R56L 3UYRL 3O2DL 5D4QA 2DLHA 3BHBB 3QUYD 4APQC 2OR9H 2IANB 5TE4L 3I02B 4N5ED 3KR3L 3K81A 5IW1A 4PJIB 4PLOB 4ZD3L 2HFFB 1FFOB 3CFEA 1I4FA 3PG2A 4IRJC 1IT9L 3BN3B 3LQAL 4G9FD 4L9LB 3BH8B 15C8H 4NC1E 4LRNH 4HKXB 5HI4C 1R3LB 3RY5A 5FB8B 4MSWB 2ITDA 3AREC 3RWEA 3EDDA 4EXPX 2WWMC 4Z8FH 1M7DB 2V7HB 4U6VL 1G84A 3FN0L 1WTGT 2CD0A 1SVCP 1OF2A 3U82B 3KYKL 5L7XL 1EV2E 1JPST 3D18A 4O02H 1RU9H 3OKMA 4OIIH 2IALB 2BRRL 1EVUA 4OV5A 1B6UA 5CSZB 5IKCA 1OSPL 5GGSA 5KSBE 1I8IA 4GLRH 5C0AE 5DSCB 3NGBB 2UYLA 4JO1H 1R5WB 3HNTL 2P5EB 5ESVB 2A77L 3EJZD 4KC3B 1NKRA 3EFDL 2GJ6E 1NBVL 2XWBB 4FXKA 3QXWA 2E27H 3F8UB 4LAQL 4UNTA 4PJAB 4Z7VE 5L0QB 5FYJU 1IKFL 2DQCL 35C8L 1I7UA 2E6QA 1N7ML 3VD7A 3KYNA 1WIUA 1XGRA 2VL4A 2F58L 4DAGL 2B7DT 1WWWX 3ESVF 3RQ3A 2NY5C 5LGJB 4PJ5E 4OTXH 4KY1H 1YYML 3MCLL 2ZUXA 2R2HA 3QA3A 1JRHL 5SWZE 2H2PC 3CSYA 1BIIA 4YHKL 3FFDB 5CZVH 3TA3A 4OFPA 5I75C 4WV1C 1TLKA 1EFXA 2APVA 2ORBH 2DL2A 3V0VB 5FYJH 1RK1A 3L3HA 2R1WA 4EUPA 1CR9H 2BNRB 2DMKA 2Z8WC 4OF6A 4NN6C 1RJYA 1ACYL 4G6FB 3MLPA 3UTSA 2V2XA 4HZAA 3QXAB 2CO6B 1WZLA 2JELL 5B3NA 4LLMB 4P46A 3HG1E 3D0VA 3L3KA 5ITFA 3MJ6A 5GS0H 1CE1H 4UNVA 4FFYH 4PUBL 1MI5A 1WBYB 3BE1L 2NW3A 3RX8A 4OGYL 2ID5A 2DQHH 1OAUH 1S7VB 1FVCB 1FGVH 3CFJB 1RZKL 4NO0A 3MR9B 1PX3A 2FLRT 1XIWA 1Z5LB 1T04B 5HTSA 4Z0BH 3LV3A 3WNNA 3WD5L 1MCOH 1DQMH 1QPXA 3F7RA 3HZYB 3IJHB 4WU7A 1ZLSL 1R3KB 4P2OD 4OCLC 5CUSH 3FQNA 4JVWA 2O93L 3U0TA 2ZOKB 4NQVB 5C0JA 4E42A 4ONGH 1GC1C 1R3IL 4OLUL 4L4TE 4L8SB 3W0WE 4K7PL 2W65B 1NC2A 1AHWB 5HYEA 2IPTL 4XNZB 5D7IB 4NPYA 5CHNA 5BRZD 4ERSL 3Q6FB 5IHZA 4JO3H 5HPMA 1CFVH 3BIAX 1UENA 3C08H 5IROA 3EJZC 5EU6D 3X14B 4RBPH 5CEYB 3VFNA 3I9GH 4H0HB 3VXSE 1PY4A 4H5SA 4U3CA 1ZAGA 3O2VL 2FEEI 1G9NH 2PCPB 2B1AH 4Q6IA 5F89A 4NNXB 3TN0A 1WZMA 3IDIB 4PYHA 3CFCH 4OZGF 4YGVB 4F8QA 5HYQA 5ICYA 4WO4C 2GSIA 5IESH 1G9MH 4ELME 4HFUL 4O2FB 4TTDC 4WHTB 3W5NA 2NY6D 1OGTB 4HCRH 3X3GH 1XF2A 3VG9C 3ZYZA 3UPCA 4EI6A 1XR9A 3EKCA 2YXMA 3PGDB 4PJBA 3IXTB 1NGPH 3GBML 4FP8L 5E6IA 2DIJA 3RBSA 1ZLWK 5SX4I 2ED7A 4J2XA 2HWZL 4JHZA 4ZAKD 3FO2B 3EGSA 4CMMB 2NY2C 4POYA 2R29H 5DVMA 3VGAB 1VGEH 1FFPB 3WLWD 3ZTJH 5MERB 4Q9CA 3D2UB 4MDJA 2DM7A 3L1OH 2FWOA 1ZT4B 2XRAL 4U1LB 3E2HB 3VXUE 4FTVE 3HZVB 3BWAA 2XA8H 5IBTH 1BPVA 3O4LD 1CFTA 3MGOB 2D7TL 1IGFH 5I17B 2V2TB 4S2SB 5KVDH 2ICWB 4C54A 2EIZB 2FL5B 4JKPH 4DVBB 5I1JL 3ULUC 1NC4B 2EC9T 3T0EC 3I50H 3TYGH 5GRXG 5E7BA 1G7LB 4P2OC 2YEZA 5E9DB 5CSBA 1MRDH 5FAAA 5ISZD 2L7JA 1IC4H 1MJ7H 4NM8H 2ZG3A 2QADD 5D72L 5E8DH 5JPMB 3EO1A 4TPRL 3EOTH 4J8RB 1MLCA 2VXQH 4XPAH 3QFJE 4S11A 1SYSB 2A74B 4Y4HA 3AC0A 5IF0B 1KCSH 2FNBA 4R90H 1TTGA 3DBXB 4IJ3C 3WN5C 2Z8RA 5BVPH 1I1YB 1X5ZA 1NMCC 1BOYA 3QBTB 1UXSB 1XR8B 4D3CL 4NZTH 1U8OB 1NAKH 5F9DC 5EWIL 4QF1A 1TJIL 4YHYC 3A6CL 4YEFA 2A6JB 3NPZB 4WCYH 4NWTL 2OL3H 3V0WL 3BEWB 3DURA 2YPLE 3L5IA 5D2NE 3SGEI 1P6AB 4LSTH 1ZHNA 5EBLB 2XZAH 2DQFB 3TM6A 4ODXB 2CSPA 5CEXA 2AXFA 4JE4B 3MNVA 3U9UB 4ELKA 4F7MA 5KG9A 5ALBH 4R2GC 5FO8B 3T2PA 1TVHB 3FB6B 2VKWA 4L29A 1LO4H 3RGVC 4U7MA 3VFSA 3SE4A 2P8LB 1KELH 4YXLH 3RZCD 1M6OB 3LCYA 4MWFA 5DJ6A 3MNZB 4AH2B 3QXDA 3HAEA 4KUCD 2Q6WB 3B9VA 1AIFA 2CXKA 3SDXB 3P73B 3S96B 2UUDH 2OYPA 5I1AA 1G6RH 1NUNB 1S5IH 4ZMAT 2NY1C 4OZHE 4C56D 3WLWC 5EZJB 4HBQA 1UFUA 1DBBH 1WQVT 1F5WA 1IGTA 4HUMB 3G5ZB 4JFDD 1LWRA 4HIXH 3ZDYF 1OOAA 4JHBA 2XV6B 3PGFL 2CIIA 3KDMB 1U3HD 3OKEB 3WNOA 3KLDA 1KENH 2GK0B 3DROA 3GKWL 3MV9B 2XNAA 4I1NB 4UQ3A 1UA6L 3QUMH 4GKZA 1CICD 1J9CT 1I3GH 2H3NA 3UZEA 3MRPB 3WBDA 1EH9A 2Y23A 4MVBD 4IIQB 3L3JB 5CBEB 1FNEB 4G6MH 1F11B 3U1SL 3KHQA 2F53A 4WW2F 1PG7L 3RL2B 4HX1B 1BX2A 3IB4A 3HE6A 1BQLL 4AENA 2H41A 1D9KD 3JV0A 1DL7L 2BNQA 2QQKL 4E41B 3FQWA 4WFED 3CDFA 3TV3H 1JWMA 5FHBL 4MQ7A 3GMQA 4CNIA 2BHUA 4WI8A 5ALCH 2KDGA 4M7ZB 5CJQL 1IQWL 5DRWA 5KN5A 4PRDB 2JIXB 5C7XH 1YNTA 4LHUA 4QCIA 1KJ3L 3TNMB 5JQ6L 2Q3AA 3WFHA 5IVNA 3QAZC 3QEGL 4RGNE 1FQ9C 2W0KA 4Y19B 1N0XH 2PR4L 4HPOH 3VXOA 3I6KA 5FYKL 4G8IB 4OI7A 1DBML 2IQAB 3VDBA 1NAMA 4K3DL 4YO0A 4XVTL 3IAPA 3UYOD 4UT6H 3S8WA 1MIML 5TDOB 1PLGL 1EHLH 4NFDA 4D9RE 4Y4FA 2YD9A 1E28A 5IBUG 1VFBB 3RZCC 1C5DA 3QI9D 4PJFE 4NWUL 1U8HA 1C8PA 3VRJB 2BX5A 5IMKA 3ARUA 1RPQA 3CH1A 1IEAB 3H9SD 4Z0XA 3C8HA 3T09A 4LPCA 1J8HA 2W1NA 2X6MA 5GSRB 1DQLH 1F3JB 1G7HA 1J1OH 4Y5YC 4E9LA 2ED8A 1JK8A 1NCAL 1A4KA 4POUB 1JZ3A 4JY4B 5AD0A 4HGWA 4K71C 4JPVH 4U6YB 1S9YA 2G5RA 1U8QA 4O2EB 1AGBB 1CICC 2NNAB 2HFEA 4U6XA 3INUH 1QRKA 2QL1A 4XVSH 3U48A 4EUPG 3NMEA 3GSXA 1QQDB 3NFPA 1JVKA 1N2RA 3H9YA 3OGCA 2F9BT 5KBNC 1H8OA 3GMNB 1JGVL 4NNYA 4BKLA 1AO7A 4E5XA 4MMXC 5BV7B 1NBQA 3U6RA 4JRXE 1D9KC 1MWAB 2XG5A 4EBQL 1FAKT 3S37H 1T6WA 1TVDA 2WBWB 4Z7UA 3K8KA 3B2UC 5IR1A 1BQHB 1C7SA 3TFKD 4KPHL 1Z3GL 4ODVH 5AYUL 1CN4A 1N5AA 2W9DL 4UUJA 2JCCB 4AM0A 4E0RB 4P4RA 5GGQH 4G6JL 3EYQD 3GJFH 4LLUA 2C1OA 2VDOH 1JIBA 5D1QC 1BM3H 4ODHL 4KZEH 4HULB 3D39B 2HKHL 5ICZA 4RMSA 1A7PL 3WFDH 3MCKA 4QHLB 3D69A 4BZ2H 3HCVA 3OKDB 4UTBH 4MB3A 5D1ZC 5CWSB 4ODSH 1ZANH 1Q9WB 2BMKB 4IRJA 4D9LH 4NRZA 1KTDA 4NN5B 3T2QA 4Y2DD 4F7CA 2R2BA 4M1CC 1JTPA 2E9BA 4LCCA 4UINH 3DVNB 5IV2B 5AAWA 3SJVD 3NCJH 3BMVA 2DQUL 2DYPD 1KEML 3DX7A 4H25A 3AREA 4QRPD 1KIQA 5HI5D 1DVFB 4Y1AA 1PZUB 5BS0A 2PYEE 4GOSA 4N0UE 4GO6B 1P6FA 4R4ND 5JDSB 4OZGE 2NLJB 3AB0C 3DGGA 3MLWL 2EIEA 3VI4F 4RIRA 1WZ1H 2WUBH 1LEIB 3IXAB 1OPGH 3UTZA 2W0PA 1MHPL 1UH3A 4PJCB 5FGBC 4F37F 2CK0H 2VLRB 2BC4B 3PWPB 5EZOH 3WV0A 1HWGB 3VA2C 3OXSA 5DD1H 3NFNB 1UYWL 4JZOB 2AV1A 4N9GB 3WKNA 2AGJH 1T1XB 2OP4H 1QYGH 1WK0A 4NZUH 5MEOA 2Q76B 5SX5K 3PP3H 2VDRH 5LAXA 4XMKL 4JDVA 2EH8L 3OZ9H 4X6CB 4PR5B 4K9EL 5D7LE 4NP4L 2DBLH 5HGDA 3VXNA 5DS8B 4UNUA 1YJDL 3ULVL 3BQUB 4PP2B 1AD0A 2BXYA 1QFOA 2J8UB 3JWDH 4H26A 1XF4A 2Z4QA 5CEZE 4M9PA 3VFTA 3HLAB 4MCYA 4JGMA 2ATKA 4PRIE 3V4PH 3EIFA 3TFKC 2Z91A 1H0DB 5E2UL 1OCWL 1Q9KB 3HR6A 3BZ4A 1MAML 1ORQA 1RMFH 2B2XL 1FZJB 1I7TA 5C08B 1UM6H 3C6SB 1DDHA 2CLZB 5GS1C 4CDGC 5C0CB 3GMOB 1CXEA 4OCWL 3CCHA 4OD2A 4GW4A 4XB8A 1NCCH 5C9JB 1T3FB 2XI9A 5F71A 2X7LB 3CUPB 2CUHA 3QQ9D 4BFEA 1DQJB 2ADFL 2DTML 1E4KC 4XP1H 3WFEL 5DTFA 1WZKA 3LVEA 3B9DA 4I9WD 5DWUL 4ZUUA 4TVPH 1DE4A 1NMAH 4HIEA 4ORGA 1FDLL 1PSKL 1WVZA 5TDPB 4Y2DC 4PY8I 4IOIA 5TE7L 1CD9B 1G6RA 2GAZB 4WI3A 1CLZH 1UKSA 3SGJA 2AEQL 4L3EA 5HI5C 3PABB 2A73B 1JWSB 1WEJL 4U6HB 4ENED 5EOTA 4Q9RL 1VSCA 1I9RH 5GJSH 4EOWH 4KJQC 5F6IB 4JO4H 1CDCA 3D3VE 1C7TA 3HI1B 4D8PB 5EA0H 4RFEA 5CAYB 5E94A 3FKUS 4EIZC 1U8NB 3IVKB 1RURH 2P48B 1YEDA 1K8DB 1JFQL 1I8MB 2K9UA 1FZKB 1LP9B 1SMOA 1OAZL 3C2AL 5FA4A 1JHLL 4R3SB 1ZWIA 4WNQA 1QSFB 3FT3A 1H8SA 1U36A 1G0DA 1BQUA 3ZO0A 4HDIB 3GMPB 4N0CD 3UBXA 3LPFA 1XF3B 5T5FL 2E7MA 4I5BB 4ZODA 1F4YL 4BZ1H 2WINB 1FH5L 3ARTA 1I1FB 1OAXH 3MBED 4QYOA 1YEEL 5C09E 3V6BR 4DQOL 4YJZL 5EIVA 5IHBA 4WEMB 4QLRA 5GPRA 3UROR 4UTAL 5ID1B 1MRFL 2VDLL 4XHJD 1KEGL 5C92A 4XMLH 3BP5A 4JREC 1S7UB 3ARBA 1IBGL 1FNSL 8CGTA 3BKML 5M94B 4DOHE 4QRUA 4I0PD 5LXGH 4PJ9B 4X0KB 4YHZL 4U33A 1J0KA 3RVTC 3UTPE 2X1WL 4MNHB 1LGVA 5D7JB 5EU7C 4F9LA 5GIRA 3PJSA 3QQ9C 5L2KD 1QFUL 4GQ9L 2CGRL 2Q7NA 3EYUL 3GHBL 3T4AA 3RVUD 4H8WC 3AY4C 1MVUB 2G9HA 3KNBA 3T3PF 5DJ2B 1EBPA 4TOYL 1NUDA 4YFEA 1FVEB 4ISVA 1ZGLP 4KKCD 1SBSH 4KK5C 3T0WA 3S37X 3MV7A 3V8OA 4G7YL 3MXVH 4U1GC 2NX5B 4M62L 5D6DC 1QLFB 4P2QE 2FRGP 5DRXA 3I3BA 1YEKH 3RX5A 4YIQA 1S7RB 3JWOC 1RQ5A 5F6HI 1BD2B 3BPCA 4K94L 5B38B 4HK0A 4ENEC 1S5HA 4F7TB 3DV6B 1BJ1J 5SWSB 4LHUG 3QO0A 3T0EA 5KAQG 5HHMD 4DEPC 2GKIA 3FB7A 4HJ0D 4YDVA 4HKJA 3FQUB 3MSPA 4PRAA 1I8KA 4LP4A 4HIJA 1H8NA 4Y0GA 4Z7WE 4P49A 1AR2A 4EDWL 5KANI 2JCCF 1DSFH 1JN6A 4F3FA 1D5BA 2X4SB 5C07D 2EDXA 2CMRL 3WN5A 4S1DC 2LVEA 3L3DB 5E99H 3TBSB 5IFJB 2J6EA 3F65A 1ZA3A 5IG7B 1SY6L 1FSKC 4ZUVA 3WDIA 5I71B 3NA4A 1X7QB 5I1HH 2EYRB 3C5JA 5I1LA 5ILTL 4PRPE 1NANI 5BMFH 4DN3L 1FVDB 3T0AA 3BD3A 3C6LD 4XHJC 4XC1L 4M1GH 5HYIA 4JPKH 2ZCHH 2R1XA 1ZT1A 1NGQH 1RZ7L 5F1NB 2X70A 3K46A 1AD9A 3DSNA 4U05A 3UJTH 3MUZ1 1HHJA 2A6IA 3GO1L 3KLAB 3GJFA 4ZTPH 5FF6B 4PJIA 1FFOA 4LKCA 3RGVA 1NQBA 1CZ8H 1ZKAA 5D71L 1DBKH 1NCBL 4LPWA 2JJVA 4HKXA 3I85A 3IDGB 5ERWB 2CUIA 1R3LA 4X4MA 3VWJB 2NXYD 1E4XH 4JANB 4PJCF 5SX4H 3ULVD 5IB3A 3A0OA 5DUPH 5GISL 3WSQH 1M7DA 5KSAC 3CU7A 2VTFA 3QDME 4KKCC 5FYLD 1DTUA 1EMTL 1TPXB 1T21B 1CCZA 1KJVB 4YPGB 1W72A 3SE8L 4LARH 1ZSDB 1VGKB 5TDNB 3IFOA 3BKYL 1YMME 2IAMC 3EYVA 1IAII 4PJEB 5H94A 3WUWA 3L9RA 3GSOB 1ITCA 4XBEH 3O45A 4WUKL 4KKAD 5DSCA 4OF3A 2DLEA 4WV1B 2ESVE 4I48A 3TBWB 3WXVH 4OM0L 5E2TH 5ENWA 3PIQB 4NN6B 2H8PB 4WUUD 3V52H 3QUYB 3MRFB 2DWDB 2O5XH 3GJEB 2QSCH 5JW5B 4TUOA 1F02I 4JKLA 2NQCA 4NRYA 3FOMB 1A1MA 1IZKA 4RQQB 1A0QH 2BFVH 4QXTA 4G9FB 1T1ZB 4GRLC 3KYOB 4Y2OA 1E27B 5HSFA 3WXWL 3TNNB 2F74A 3G08B 3QG7H 1CFSA 5F7DA 3D9AH 3X12A 1Q9OB 3ZTJG 3BT2L 3U9PL 4LIQH 4FQQA 3QIUD 5AUMB 1T4KA 3G6JA 2AJSL 5EUKA 5IQ7H 1A6WL 4Z5RB 4GW5A 4FN0A 3VI4E 5HHOD 4G8GD 3X13A 2P5WA 3U79A 4W6YB 4F7PB 4M3JA 3SGEH 1GCFA 2BJML 2XFXB 5I0DA 1RIVL 1ZHLA 3I3DA 3QXAA 3JTSB 5E95B 5IQ9A 1VEOA 4BELD 1GRWA 3MLVH 2E6JA 1OQOA 1MUJA 2R9HD 1X3DA 1KB5A 4KRPD 2O61A 1BF2A 5KAQF 3BPNC 5K33A 1G1YA 4UT7L 4XCFH 3P9LB 3HRZB 4G80B 2D31A 4DGYH 1T04A 3JWOH 1ZLWH 4JFFD 4OM1L 3TT3L 1IVLA 4RFOH 3KS0H 1UXWA 3DRTB 1S9XB 5I8CB 1K3ZA 1LVEA 4L5FL 5HBBA 1QLEL 1YEIL 2I27N 3MRJA 5C0FA 2Y36L 1ZGLB 2CR6A 4PLJD 2VR4A 5F7EL 25C8L 4HKBA 3P11H 2QQNH 3WO4B 5DMGC 3VXMB 3LN5B 2F5AH 5LCVL 4ZDHB 3T3MF 2JB5L 2DRUA 4KKAC 1FNGA 2YD2A 4KFZC 5D9SA 1TVBA 1U95B 3RWGB 4OIAA 5BV7H 3AS0A 4FFVD 1OARH 1MJUH 2EXYD 4XNYL 2YD6A 3VFWB 5D96C 1QO3B 3O6FD 4NJAH 1PVHA 4HT1H 4MJIA 3S35H 4ZFZB 3RVWC 2FEDD 2PCPA 4XAWL 5MHSE 4NNXA 4W6XB 4MHHG 4KJPC 3CVIH 4JN1H 5IFAH 4OFVA 4GW1B 3TO4D 4FZEH 4ZFGL 1HSAA 1T0MA 3EOAA 3U30B 5JIIA 3UTSE 2YC1A 4O4YL 5DD5L 4MXQC 2OLDA 1CLOH 1X4ZA 4O58L 2Z31A 5D1QA 3MV8A 3RIAF 3RU8L 2W91A 4X7TB 1MI5E 4F7EA 2JB6A 3IDJA 4CVZA 3LKRB 1VKXB 3NTCH 2EECA 4Z7UF 4LEXL 3I6GB 3DWTA 1B9ZA 4UILH 2EDTA 2YA1A 3FT4A 2FGWH 3LKOA 4MXVF 2IGFL 5EIQA 4JFXB 3P4NB 2X40A 1TZHA 1IRAY 3G04A 4KU1A 5DQDH 4ODTL 4K3EL 1FFPA 4XAKE 2CIKB 3B83A 5GQBA 1JPSL 4HLJA 5MERA 3D2UA 5BRZB 4LPYA 3UBXG 4KRPC 3RVXC 1TXKA 3G5XB 1YN6A 1NL0H 3JUYA 5EU6B 5FHAL 2IH3A 5GZOD 1MJ8H 1NMCB 3MLXL 5F88A 2VDNH 3GB7B 3LZFH 4NNPH 3ME0A 3MUHL 3RZWA 4DN4L 4JFZH 4Q9QL 5EUOB 2HJLB 4GAFB 3RDTC 3EYSH 4RNRB 2FL5A 3QHFH 5F8QC 3ZKQD 1DQTA 4JY6A 7CGTA 3IDMB 3LEXA 2I24N 3D85A 1G7LA 3SDAC 2RCSL 1F2XK 4PLJC 5T1KD 1WF5A 1AKJD 4OZIA 4MA7H 3VXPB 4KUZL 3UJJH 3ZMRA 1YEFL 4MS8C 1PKOA 3Q1SH 5C0ND 3GM8A 2AK4D 1YN7A 1T66C 5HDOA 2HN7B 2NY6B 1UCBL 3ARZA 4AJ0A 2HJKA 4XPBH 3HB3D 4K2UL 2VABB 2EZ0D 4DFHA 4UIMA 2Y9RT 3A67L 4LCWD 3CMGA 4PG9B 3U7YH 4N0FA 1JRHI 2C3XA 3T3PE 3ZKNC 3EYFA 2WWKO 4N0YH 4ZAKB 3HI5L 2A6JA 4JR9L 1U8PB 3BEWA 4K23L 2A9NL 2F19H 2NY3D 2VISB 4PJBE 4ZPVB 3QDGD 3U9UA 1REIA 2IFGA 3O4LB 1CFQB 3ARGC 4LRNL 5FO8A 5T3XH 2FJFB 5F9AC 1FLRH 1NEUA 2CRIA 3V6OC 3RPIA 1AI1L 3VFPB 2P8LA 5EB9A 1SJEA 1WC7B 2I60L 5TE6L 4CGTA 2FD6H 1A22B 4Y4KD 1E4KA 4K3JH 5ISZB 2BY3A 5GSVA 5JORB 4WDIA 5T33H 1NGZA 2VQTA 4JCMA 1CE6A 1DR9A 2QADB 2OX5A 1UKQA 1RU9L 4F58L 4OIIL 1OD9A 4PB0H 3LKNA 1ACZA 3CFKB 2EEDA 1S7TA 3JUZA 3G5ZA 2AI0H 4ODWB 5HHPA 2DD8L 3OKEA 4DK6A 5GZOC 4JO1L 2LU4A 5ADPH 3JVGC 1MFCH 3U2SB 3GI9H 5F93C 3MV9A 4JO2H 1AGFB 5DQJA 3C8DA 3WNMA 1CDBA 1PKQA 3B8YA 4WW1A 4X6BB 3MRPA 3GDBA 2B20A 4OCYH 5EN2B 1J05A 5FFLA 5I16A 5JW4R 3P30H 2FB4H 1EZVY 4OTXL 4CBPA 5IHUH 3S34H 1FGNL 4MA1C 3VG0H 4NC2B 4HWZA 5DYOA 1KCUH 4WTZA 5CZVL 3RX7A 2R23A 3HB3C 1JUFB 4KWUA 2EZ0C 3K4AA 4N90E 5GXBB 5FYJL 4MDIA 1AGCB 1NEZB 1QRND 1CR9L 4Z9KB 4I2XA 1HSBA 3GBNH 1S3KH 4WFHE 3H9HA 4TQEL 4C56B 1CLYH 3RY6A 3B2VH 4G42B 3Q5OA 5HI3C 2NY3C 1QLRB 2HT3D 5C0GB 1S9VB 4JKKA 4MZ2A 3L7EB 4C55A 5IMOB 1U3HB 4DZ8A 3WUWG 1SM3H 4M02A 1ZGLM 1OAUL 4KXZI 4TNVK 5EC1B 5TDOA 1G7JB 3SO3C 2AS5M 1FO0B 4LHJB 1NCUA 1MCOL 1P4LB 3U4AA 2H9GA 1KN2H 1E4WH 2ERJB 3TH2T 3WIHH 3CDCA 1JTOA 4PLKC 4J1UB 2YBRB 3R4DA 1K8IA 2B0SL 4XNQB 1D9KB 1FCCA 3HC3L 1F3JA 4LLYA 3DTXB 4Q0XL 4RZCA 4X8XA 3O3DB 2H32A 1OTTD 1A7NH 3G6DL 1IAOB 1P4BH 3R1GH 5C0AD 2BHZA 3BKCH 3HNVH 1JNNH 1IC5H 3C08L 4FQIH 4MXWL 4TNWF 3EYOB 4P9HH 3M45A 3MRMB 4HUNB 2VLJA 4KJYA 1AGBA 1Z9SA 4O2EA 3CK0L 5J11B 5IMMB 2RHEA 1F45A 3P0VH 3WS6C 3QUZD 1QQDA 2BNQE 2A6KA 3B5GA 1EGJH 4OSUL 2C3VA 4WHYH 2GSGB 2R2EB 5ITBH 3IFPA 3CFCL 4WGVB 5GRUL 4X9HA 4HWBA 2ZG2A 4PJ5D 3GSNA 2WIIB 4H88L 1G9ML 4AZ8A 4H1LA 5SWZD 3ULUF 4HCRL 3X3GL 2UZIH 4R26H 1YUHA 1U0QA 3QISA 1IMHC 3QI9B 4U1SB 3HTLX 3AXLB 5CP7B 3HC4L 5SX5H 3K3QA 3V4VH 1DBAH 1EPFA 3EOBB 1OTUD 1DLHA 4JM2C 4D94A 3H9SB 4Q6YA 2X1XR 4P59H 1A6TA 5TF0A 1NBZB 3K4ZA 3T8XB 3HG1D 2AJYH 3VCLA 4NFCA 4P23D 3STLA 1GGCH 4LSRL 2DQEL 3T3ME 4WEBL 2X10A 5C0RL 2XA8L 4NC1C 2D7PA 1JI1A 5J3HC 5L2JB 4UB0L 3C9NB 1U58B 1V7NH 5DRNA 2BVYA 3GSVB 2XIDA 3ARWA 3QT2A 3WIFA 4LLWA 5F9WC 5DUBA 2APFA 1J8HE 3VFOA 4R8WL 5GS2D 2GFBB 3I50L 4NCC2 1LK3H 5TGBB 43C9B 3QRGL 3W9DA 5HPOA 1KPVB 4PY7B 4XX1E 1CD0A 4HHAB 4NJ9L 5HVGB 4GXVH 1MJ7L 3SCMD 5KSAA 4TULH 2AJUH 4V2BA 1M7IB 3EJYD 3LS5H 1HHGA 3EOTL 4GG8A 1OD7A 2VXQL 3VGBA 4L4TD 3TF7C 4EDXB 1MRCH 3W0WD 2VXTH 1KCSL 2ADIB 2IAMA 3AUVA 4IRSA 5GGVL 3NZHH 5BVPL 1FG9C 1R3JB 2A6DB 3FAWA 3MOAL 3TJHD 2MCPL 5JNYB 1AO7E 3UDWC 3VXQA 3BZEB 1T03H 1IAMA 5JHDA 4TTGA 3VXSD 1H3GA 3L3OB 5GS1B 2ZUVA 1JPTH 1RK0B 3Q0HA 1DEDA 1UC6A 1T5XA 2OL3L 4JKWA 4Z7UE 1G1CA 1C1EH 5HYFA 3GSRB 1DUZA 2XZAL 3GRWA 2VRAA 4PP2A 3QYCA 4GRLA 4R7DA 1S7SB 4KROB 3G6AA 3GEWB 4MLSA 3QDAA 3UTQA 1I1RA 1OL0A 3MRCB 4YNYA 3HUJB 3SJVB 1PBYA 2DYPB 4QTIL 2WWKT 1F4XH 4QRPB 5EO1B 2WV3A 3S98A 2OM5A 5C0CA 4NT6B 4FQHA 4MX7B 4HUUA 2GTWB 1INEL 3GSQA 3PWNA 3QIWD 4P23C 2DIBA 1DQJA 2QSTA 3NPSC 3DGCR 3BUYA 1KENL 4Y1AE 3VXUD 4FTVD 3WE6A 5BS0E 1C5BH 3DMMA 5F1IA 4Z18A 3G6JF 5CZKA 2X9XA 3MJ9H 3QUML 2FIKB 2IQ9H 4LSUH 4KKBC 4PREB 1KIRB 3ROLA 1I1AA 1I3GL 2G60L 4XPFH 4X7DC 4X83A 2R8SL 5F7HA 4JQVA 3B9EA 3O6LH 1MQ8A 3WDJA 4XXCC 2YPVH 2A73A 5E56A 5J89A 1RULL 3PWVB 4MAYC 3SCMC 3JZ7A 3EO9H 1KB9K 1UEMA 3RWHB 3JV4B 2VITB 5E2VH 3J7HA 3BRGC 3IU4H 3HI1A 1R5VB 3QHZH 4P4KA 1A2YB 1F6LL 3QFJD 4YHPA 4EI5D 1HHKB 1K8DA 3P9MB 3ARRA 4KUCF 3FOLA 4I3SH 4YX2H 3TV3L 1IAIH 2N7AA 2NZIA 2VZVA 2FX8H 5HHVH 1WAAA 5TH2A 1A7RH 4AY0A 2R0WL 5L8JB 3GMPA 1KYOJ 5DJZA 3Q6GL 2WBJD 1UWXK 5F9JB 4AEHL 5J9PB 2WINA 4G43B 2FJGB 1I1FA 1U8JB 32C2B 3BPOC 3E6HB 4LCYB 2V5SA 2XTJC 4W68A 1JZ2A 3T1WA 1S8DB 1UEYA 5ID1A 1IGCL 1DEEA 4RWHA 3REWB 1FNFA 5DC4B 4L8CB 2ZJSL 3P40A 4LCIH 1EHLL 4U1GB 3MRDB 4OIBA 4GSDH 2VDPL 5FO9B 1NGYA 2OJZL 2KUTA 1A7OL 2EH7H 4PJGA 4CU7A 5IGXH 4MNHA 4IM8A 5CIPH 3VJ6B 4HC1A 3UPRA 3F5WB 4GBXD 5I1IH 1P53A 2F8OA 1V3LA 1J1OL 2EICA 5AWNL 1NSNH 1MVUA 4L3EE 5DJ2A 1MHEB 3N50A 3STZB 2CRMA 4WTZG 4UU9B 5D5MB 1Y6MR 1JNJA 2Q1EA 4JGUA 1CG9B 4HKZB 3DRQB 5CGTA 4BQBA 4FQXA 1KIPB 3WIHA 3F7YB 1X5YA 3G5VA 4XNMB 1FSKB 4GRWB 2C7UB 3LRSB 1HDMA 1KLUB 3RDTA 1U9KA 5DHXB 3MBEB 3BAEH 5SWSA 4HPYH 3RAJL 3B3IB 4IRZH 1GOHA 2J8HA 3S5LB 3GUTB 4RAUA 2BVPA 3SDAA 3FQUA 2SEBB 2CLRB 4GS7C 2Z93B 1T20B 3FT2B 4EI5C 3S37L 2VNCA 1TNNA 3EAKA 4YAQA 3KWWA 1EEYB 2VXSH 1TETH 2AKRB 4I0PB 3ZE1F 4ODVL 1EAPB 3KPSA 4NUJB 4PRNA 4CADA 5AZ2H 4HAGA 5DR5L 3RWJA 3FZUC 3L5WB 5GGQL 4FOMA 4QGTA 2Y07H 3V4UH 1F8TH 3QPXL 2VDOL 1E6OH 4NSKB 4NBYB 4YBLB 2X09A 4LPVA 1D6VL 4RGND 4DZBB 1OAYH 4OZIF 1H5BB 2X5PA 4PJXB 1F6AB 4NHUA 3SDYH 5MENB 4RGOH 4UTBL 1NKOA 5CP3H 2M26A 3RL1A 1WCBB 2Y6SD 1K6QH 1Q1JH 5KS9A 5FM5O 1D6EB 4PGDA 3WHXA 3UYRH 4NO3B 4D9RD 3ARGA 4HZLB 4XPHL 3CSGA 4UINL 2I07B 3KR3H 3NCJL 4IMKC 3KG5A 3MJ8B 1FJ1B 4RX4A 5CILL 2OTUB 4Y5VB 4KV5E 5HHMB 5SWQB 1IT9H 1HOCB 4P5MB 3LQAH 5GGUB 4YHIA 3BJLA 3MV7E 2JLLA 3BEVA 3V9FA 4GBXC 1T0NB 1WZ1L 2VZ3A 4HH9A 5T3ZE 1RUKL 1P69B 3PHOB 3BIBX 1RJLB 5C07B 3ULUE 5CMAB 5DMJB 4CUCA 1IEHA 3T0EE 1Q0YH 4R96A 1NCWL 3OMZA 5DD3H 5L8KB 3KYKH 1OP3K 5DD1L 2KKQA 2VYRE 3JVGA 5HGAA 4WWKD 1QYGL 2CKNA 3P4OA 3TH4T 3I2CL 4U1JB 2W9EH 3ARDD 4CKVX 1OSPH 2VDRL 5C0DB 3O11B 5DO2C 5FKAB 2D7OA 5IP4A 3OZ9L 1UH2A 4I18B 5HD8C 2DBLL 3C6LB 2FH8A 3HNTH 3OKYA 2C9AA 2H8PA 2A77H 4JRXD 2I9LB 2DWDA 1B2WL 3EFDH 1NBVH 1NFDA 3SKNA 5JW5A 4POZD 2VE6B 1S7XB 4LAQH 5IJVB 4MQTB 3OKLB 1DQQB 4RQQA 1IKFH 2DQCH 2DQTH 3C8KB 5AG9A 1RMFL 1N7MH 5AZEH 3DVGA 3VGDA 1YEGL 3W11D 2F58H 3FRPA 4GKOA 4L8BB 1HNFA 3U36B 3QG6B 3BPNB 2NXYB 4Y16B 5GRWA 1Q9OA 3HRPA 1S7WA 3MCLH 5I15H 2FR4B 4NQDA 1P7QD 5FK9B 4PJIE 4YHKH 3MLTB 4NO5B 3TO2B 3H3KA 4QRSA 1P5VA 3C2SA 2DQJH 1UKTA 1RZJL 2Y6SC 1WWBX 4PGCB 5DUML 4C57C 5I9QB 3BZFA 5E08H 2RIKA 1FO0H 1ACYH 4X4ME 2AVGA 2PYFA 2FYYA 2NXZC 4YHLL 4HS3A 4UQ2A 2JELH 4X4YA 1AQDB 1T89C 1KPRB 2HTLC 3MUGA 1SEBA 1GGUA 4G6AC 1I9RL 4PUBH 1HQ4A 3BE1H 5D2LB 1P9MA 4OGYH 5TJWK 2Q8BL 2PYED 4JO4L 2X9WA 4NOBA 3WL9B 4WUUB 5IBLC 4MQXC 4L3CB 5EA0L 5JHLL 1S78C 1RZKH 3QEQA 2AW2A 4JG0H 1Z9MA 1KJ2L 5KVEL 4JFHE 4M93B 2E7BA 4PIRF 4KK6C 1NFIA 1S9XA 1O0VA 3WD5H 3P4LA 3PL6D 2LTQC 3OHXA 4UV4L 1ZGLA 1J0ZA 1LE5A 2EKSA 2DJ4A 3KJ4B 1KOAA 1T1WB 3VXMA 1CK0L 1T0PB 1I7RA 2VQUA 2DDQH 3ARDC 3WUZA 1UVQA 5EDXA 3UAJD 4BA8A 4OLUH 1HCVA 3QIUB 4BZ1L 1IAKB 2BP3A 4K7PH 5D93C 3WS6A 1U95A 5K9QI 4MD5B 5JMOC 2H2SC 2DAVA 4ERSH 4TN9A 5HHOB 4G8GB 4NM4L 5D7LD 3H0TA 3RNKA 3VFWA 3ROOB 2FX9H 1ZVSB 1R3HB 3O8XC 3GK8L 5CEZD 3MRNA 3O2VH 4POZC 2DI9A 4OAWB 4CVXA 4PRID 1HZHH 4Q2ZB 4PTUB 5HHNA 4X98A 1A3QA 3GGWB 1UZ8A 1VENA 3OR6B 1MFDL 4KRPB 2P5WE 3OKOB 4J4PA 3RTQC 1IGJA 1T7WA 1T83C 3N06B 5GGTL 1IQDB 4JM2A 4YUEH 3MROB 3H6JA 4JFFB 1R24A 5EO0A 5BXFB 1CYGA 4B7IA 2NYYC 1TJGL 1VKXA 4MJ5A 2GCYA 3QO1B 4QY8B 4RAVB 3IDXL 3NIGF 3ZT6A 4FP8H 2HVKB 1FL5A 3C5ZD 3MXVL 5KJRH 5ANMA 4JAMB 4TVPE 4ZTOL 1XEDA 2HWZH 4MD4B 1YEKL 5CIPA 2VL5B 4KXZH 2K7QA 4FZ8L 4XXDB 4QNPF 1FIEA 4AIZA 4YXHL 4HK3N 3GM0A 4G5ZL 3G5XA 3QDJA 4IDJL 5BZDB 2AXGB 3OR7A 3IF1B 4P5TD 2XRAH 3O6FB 3T4YB 3D3VD 3GB7A 2D7TH 2CDGB 5EUOA 5BJTA 3P3YA 2IBZY 3N1FC 1HH9A 5C3TA 1VPOL 3BZDA 5I1JH 3OF6D 5CKGA 1MF2H 3TO4B 1BZ7B 3MOBL 3BD4A 3VXPA 1ND0B 5E99L 3RWDB 4MJIE 5D72H 4PJXF 3UAJC 4W81A 5DK2B 5C6TL 2MJWA 3FONA 5IEHA 1W0YT 5I1HL 3KPMA 1A9EA 4KMQA 1YQVL 5C09D 1FL3B 5BMFL 2JKXA 2R4SH 4HWUA 3P77B 2DM2A 4X6DA 5GGSY 4AT6A 3MODH 3HC0A 1VACB 3IS0X 1OW0C 4XZUB 4JPKL 2E8YA 2MKWA 1QR1A 5C8JA 4D3CH 2CDFA 4BH8B 5EZLB 5EWIH 2XZQH 1TJIH 3A6CH 2Q87A 3MV8E 3V0WH 3IYLW 3MRRB 1BJ1H 4U0RB 4ZFOB 1N0LA 3M1BB 4EVNB 1KYOK 1K85A 3UTPD 3FO1A 3I84A 1L7TL 2OTPA 1E4XL 2FJFA 3QCTL 5H37H 5H2BA 5T1MB 5E5UB 2IADA 3MLRL 3G9AB 3LKQA 4O51B 4R0LB 3O2DA 5C0EB 5I30H 3OAZK 2X4TB 4OV6F 1U92A 5ISZA 3W2DL 5T1KB 1Y18A 1AKJB 3C5ZC 4K7FA 3ZE1E 2HG5A 3BPLC 2GTZB 5DHVB 3K4DA 4WHYG 4P2QD 3VFGH 4TUKH 5A2LH 4HS8H 5JPNA 1QUNA 4ZS6D 5DD6B 3ZE2F 3C60C 3TP4A 5L8LB 3DI3B 3PGFH 2Q86B 1BLNA 1CI5A 4RDQG 4OZIE 4MAYA 1N59A 1XCQA 1AGFA