3MV8D

Crystal structure of the tk3-gln55his tcr in complex with hla-b*3501/hpvg
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
200
structure length
200
Chain Sequence
QVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQDLGTSGSRLTFGEGTQLTVNPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
publication title Allelic polymorphism in the T cell receptor and its impact on immune responses
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2010-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mv8D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mv8D02
2VDNH 3EGSA 3UC0L 4R2GD 2DLGA 1DQQA 3C08L 4L8DA 1BQLH 4ENED 2J8UF 4J4PD 3EDDA 4NDMA 4OGAC 2JIXD 4UZGA 1BQUA 5C0AD 2V2WA 3SCMD 1W72B 1KCSL 4QWWC 3D3VE 5ICYB 4NKDB 3MLSL 5TF1L 1G9NC 4UIKH 4PJHB 5E8DH 4KKLC 4LCIH 4W4OA 1Z6JT 1YUHB 2H2PC 4X0KA 4F7CB 4XXCA 1UGNA 4JFPB 1AXIB 5BZWA 3P4OB 4OGXH 1QR4A 1QRKA 4WEBH 3U0WL 3U4AA 3AB0C 3CVHH 5J11B 4ZS6C 3CFBB 4G9DB 1OQXA 4AK1A 5F7HA 3HB3D 3QJFB 5J89A 3C8DA 1G9MH 2DM4A 3HKFA 4HC1H 5FM8A 3DGGB 5MI0B 1RV6X 3C2AH 3W39A 5E8PB 2JK5A 4LU5L 4N0UA 4YDVA 4PJ9A 3IU4H 4WTZA 2BNUA 1CDGA 3CXHK 3BT2L 5HGDB 2CRIA 1NCDH 3KPNA 4HJGB 5TDOB 4A6YB 1C5BH 1NGWA 2XN9A 1A6AB 1X5YA 2IANA 1XGYL 2VE6A 3MLVH 5DJZB 3LRSA 3MRLA 3QXAB 4FQXB 4JDVB 2BSTA 1CT8B 32C2A 5HI5C 1HKLH 5B39B 3HPLB 2HA1A 4NJAL 2CJUL 5F3HA 1OCWL 2VLME 4OD2B 4P5TA 4ZUSB 1HI6B 1DUYB 4RMUA 4AMKL 1ZT7B 2PKDA 3BFOA 1FO0B 5CAYB 2GY5A 5I1LA 1A1OB 3F6IA 1I1AD 5LGHH 2HT4C 1AXTL 4PJFB 3MV9D 2V2TB 2AJYL 1KPVA 4H8WC 2FX7L 4K3HA 4ELKB 3WHXA 1PLGL 3E8UL 1I9RH 3KLSA 3I75A 1WTLA 5EBGA 2X9YA 3SKOA 3ZMRA 1JF5A 5MEPB 1YEKH 1IL1B 5HHOA 4K3JL 1HHKB 4Q9RL 4M7JL 4U6VH 1JZ5A 1OTTD 1C5DA 4EUPG 1OGAA 5IVOA 3MLRL 4DEPB 3DO3A 1UWGH 4X8XA 3VD9A 3EGSB 3F6LA 2FX8L 3KS0H 3HCVA 4OLUH 4YZFE 3QG6A 5DRWA 1I1FA 3BPOC 1A9BA 4L8DB 2B2XH 4S1DC 4OLEA 1EZVY 4NDMB 1E4XH 3LKPA 5FUOL 5CCKL 2R0WL 5FYKL 1U9KA 1EEQA 5ID0A 2V2WB 1E4KA 1GL4B 5E2TH 5KS9E 4OLYL 5JA9A 1DBJL 3GK8H 4QXTA 4HCRL 2X1XR 2EDTA 3IXAA 4G3YH 3VFPA 4JGUA 2VDRH 1KTKE 4X0KB 2X89A 4IMKC 1GSMA 1A6WH 1O0VA 5BZWB 2VDQL 1KUMA 5FV2A 1UH4A 2COQA 3CVIL 2D03L 4K8RD 3LMJH 1FNFA 1LILA 1H15A 1HINL 4NNYA 3ME0A 4NGHH 3W39B 3BIAX 2JK5B 1T2XA 4N0UB 4YDVB 3H9SA 4PJ9B 4PRIE 5C0CD 2BNUB 2OMNA 4W6XB 4D0CA 2E27L 4X9FA 4H26A 1NJ9B 2DLIA 4CW1A 1JZ3A 3HMWL 1X5GA 3KPNB 4YE4H 2E7CA 1NGWB 2XN9B 3S35H 3LH2L 3F62A 4Y1AA 2IANB 3D39E 4PGJA 1RJCA 2VE6B 3AS2A 3CZFA 2XQYK 3DTXA 5IBTL 4LSVH 2NR6D 3G9VA 4NCC1 3LRSB 3MRLB 2NY5C 5DQ9A 2BSTB 32C2B 3BN9C 4XNZB 3VXOA 2FO1A 2J12B 5AG8A 3ET9F 5F7DA 4POYA 5F3HB 4Z7QF 4I0PC 4NQEA 4P5TB 1QPPA 1XH3A 5HHXL 2F8XC 3GMOA 2NX5A 5F96L 2NY0B 5KSBF 5I1LB 2R2EB 2FGWH 3OJVC 3ZSTA 2DL2A 3CVHA 4JGJA 4FP8H 3IDYC 2YD1A 3C6LA 3HE6C 1KPVB 3WHXB 5B39G 3R8BB 4UT9L 3T4YA 1ZVYA 3CMOL 3FO9A 1JGVH 1RZGA 4O58H 3I75B 2BFVL 4PRPE 3SKOB 1GYAA 1OPGH 5ADPL 4P2OA 1KTRL 2YA0A 5HHOB 3CSBA 2PYFB 3OAUL 4AEHH 2A6JA 1C5DB 1OGAB 3FQRA 2ZUSA 3HS0A 4WGVB 3QDJE 3F12A 3QEGH 3FAWA 4XC3H 3HCVB 4IRSD 3OKNA 3QG6B 5DRWB 1I1FB 5E6YA 3KPSD 1A9BB 3FTGB 4XNUL 1A1NB 4RX4D 1TZGL 1YYLL 3R4DA 4X7CC 4JPWH 1CXLA 3LKPB 4ORZC 4WI4A 4M7ZB 4Z6AT 3J8F7 5ID0B 4HGWA 5IW1A 4Z7UA 1H3UA 5FHBH 4N90E 3S37X 4NRXA 1N7MH 2IPKA 1LMKA 3JSSA 1ZK9A 4MDIA 4QXTB 2EC9T 3GB7A 3IXAB 5GRWA 1DJSA 3VFPB 5D1XA 1OP3H 4OFKA 4YO0A 4WV1C 5JTWA 3H7BA 4YHKH 4JFFA 5DEFA 1N0LA 2ORBH 2UY7A 1EUTA 4QRPD 3E6FA 3EJJX 4PJIE 5HHNA 1EEUA 2WBWB 1GC1C 3ZO0A 2WBKA 5J1AA 3T3PF 2HYMA 4JQIH 5JNYB 1H15B 3DOSA 4NNYB 1SM3L 1UWXH 3B2VH 2CD0A 2NY2D 2ESVD 5C0EA 3H9SB 4LDLB 4D9LL 2KZ1B 1IAOA 5E2UH 4V1DA 1MRCL 4JHWL 4D0CB 5DSCA 5C0RH 1WGOA 4P57A 4H26B 4CW1B 3CUPA 1MRFL 1OP3K 1QRNA 4F57H 4FQLL 4Y1AB 1VPOL 5F7EL 3DTXB 3CZFB 3VXRE 2H9GA 5KVDL 5C07D 2QADB 4XNQA 5B38A 3UJJL 2ZSWB 5DQ9B 1CD8A 3OKLA 4PV9B 3VXOB 4NUGL 4WTZG 5F7DB 1WFUA 4YHPA 4NQEB 3VD4A 2ICCA 5T1KA 1XH3B 3UCRA 1P7QA 3GMOB 3FO0H 2NX5B 3L5XL 3MCKA 2XI9A 1UWXK 4TN9A 2P45B 3NIFE 3MXWH 3NAAH 5HI4C 3CVHB 1A3RH 1OLZA 1AIFA 4TSCH 4CN4A 4TPRL 3MXVH 3C6LB 4LCYA 1IGMH 3VFOA 5F7FA 3MROA 3T4YB 5SX4H 4WUUE 2VOTA 2QV2A 1RZGB 3TZVC 5M95B 5EUOE 3DSFH 4E0RA 1A4KA 1LK3H 3MRFA 1ORSA 2A6JB 2HKHL 3FQRB 4LPUA 3HS0B 5KSAD 1YQVH 5CJOH 5T5FL 3S6CA 3F12B 1PG7W 3VMNA 3OKNB 5DK2A 5GRXG 3EOYG 1EERB 3ARPA 4Y2DD 4KI5F 1FSKB 4TULL 2WANA 4G6FD 1ZEAL 1E6JH 4K3DH 5L2KE 5HDLA 4DGVL 1H3WM 2K3TA 1D3CA 3B9KD 4PJXF 4HGWB 1HWGB 4P46D 4Z7UB 5IW1B 5MENA 4X5LA 3GJFA 2NYYC 4NRXB 4EN3C 4OKVA 5IJKA 2IPKB 2EDRA 3O3AA 4CADA 1X5IA 2WV3A 4MDIB 3FB7A 4N5UA 3B9VA 4DZ8A 3GB7B 3OB0H 5IESH 3M17A 2WK2A 5D1XB 4YO0B 1YMME 3K8MA 4K8RH 1NLDL 3RUGA 3H7BB 4BH8A 1LP9F 4Y19E 4JFFB 5C6WH 3FOLA 1JMXA 1T7YA 5DEFB 2DQUH 5FOBA 2D31A 1MHCA 2X4OA 3V6ZA 1F4XH 1MAML 3V8OA 5JW4M 3ARYA 1HDMA 3E6FB 4OJFL 2V5TA 3CMGA 5HHNB 2HFFA 4HT1H 3BJLA 4K2UL 5J1AB 4UTBL 2EE9A 3T3MF 2UYLA 3ULUE 1PVHA 5TFSH 4LP4A 1IAIH 1BEYL 4X5WA 4J4PA 4AIZA 5C0EB 4RIRA 2Z93A 1IAOB 3QBTB 3C09C 2JIXA 1UACH 4RBPH 1HNGA 4P57B 3ZT7A 5DSCB 5C0AA 2ZKHH 3KLHC 3OB0K 3SCMA 3CUPB 1GGIL 1EFQA 3ULUC 1QRNB 1OWWA 2DQHL 1RURH 3QUYD 4JR9L 2IFFH 5I8KH 2H9GB 3MA9L 4OZIA 2CK2A 5DT1L 5B38B 4HXAH 4NZTH 1RJZA 4KKAD 4TNVK 3OKLB 4JVUA 4U0QB 1QFHA 4YHPB 1HH6A 3OSKA 4D3CL 2AEQL 3RL1A 5T1KB 4PJAF 3N0PB 1P7QB 1CGSH 3KPPA 2VDNL 3MCKB 4YLQT 1GAFH 3QFJD 3ARFD 1MI5D 2ED9A 5K59E 2QQNH 1JGEA 3W9EA 1AIFB 4YDLC 1BQLL 3ZE0E 5IG7B 4GRLC 4D9RD 3VFOB 1F5WA 4RBPK 3MROB 5DRZA 2UWEF 3WIIL 3FL7A 1KOAA 4E41D 2A6DA 3Q5TA 1JYNA 3NFSL 4E0RB 1A4KB 1J1XH 3LN5A 2APVA 35C8H 3MRFB 4XC1H 1ORSB 4QKXB 4WI8A 5E8DL 4LCIL 4PLOB 4C56D 4RFEA 4LCUA 2ZSVA 2DTMH 1SMOA 4OGXL 4WEBL 1YJDH 5DVLA 1FYHB 5DK2B 1DUZA 4O5LH 3FT4A 4LLMA 3VH8A 1XCQA 2PUQT 5D4QA 1OSZA 1G9ML 4HC1L 4M5YH 4Y4HD 5DA4A 1TJGH 4DCQA 2EDHA 1I1AA 3EYSL 3C2AL 1I7RA 3MV9A 5HVGB 4QO1A 5MENB 2A2QT 3GJFB 3HZVB 1TLKA 4OKVB 4GKOA 3O3AB 4U6TA 4CADB 3FB7B 5ISZE 2RAMA 4DZ8B 3IU4L 5KVMC 3M17B 4KRLB 4NFDA 2OR9H 4GLRH 4U33A 3BISA 4G6JH 3RUGB 4BH8B 1C5BL 3FOLB 1E6OL 5FOBB 3AM8A 2X4OB 2D31B 1MHCB 1VGEH 4LRIA 3V6ZB 1U6AH 2DDQL 4ELMF 3MLVL 3IYLW 3C6SA 1ZKAA 3VJ6A 3NCFB 2HFFB 4BSVA 2BRRH 3L3IA 1HNFA 4NZUH 2Q3AA 4R2GB 2UYLB 1RU9H 3UDWC 1DL7H 3V6FA 5DJAA 1K9TA 3MRPA 3PXJA 1J1PH 5TE7H 2JCCE 3QIWC 4X5WB 2VISA 4AIZB 4RIRB 2Z93B 5KW9H 5LGHL 4MNGA 1L6ZA 2Q76A 1QP1A 3KHOA 2JIXB 3ILQC 4BZYA 5C0AB 3MOBH 5K9QI 5B8CA 2ZUXA 1XR8A 3CD4A 3SCMB 4AEIH 5F7UA 2LTQC 4GAJH 4UQ3A 2EH8H 3MRQA 4L8BA 1I9RL 2ZP0T 3N50A 4OZIB 3SE3A 1YEKL 3MZTA 1RJZB 4IIQA 4MQXC 5C09E 3OV6A 4H20H 1QTYT 1X4YA 3DMMC 1HH6B 1XF2A 3RL1B 3WFBH 2FD6H 3PDGA 2MQ0A 3KPPB 5FGRA 4B7LA 3K46A 4OLUL 2CK0H 5I17A 1CZ8L 3W9EB 3BX7C 4NHCH 3U9PH 5B38G 2W0PA 5DQJA 1WK0A 2B2XL 3QQ9C 3T2PA 4OIAA 3CK0H 4BJLA 2DQTH 2ZPKH 1E4XL 4Y4KC 5C0CA 4CNIA 5DRZB 1MCIA 1UADC 1AQKH 3LAFA 4A2MA 2ZUYA 5E2TL 2A6DB 2P5WE 2IH1A 3LN5B 2ZNWA 4LMQI 1Q72H 5CINH 3GRWL 2VDRL 4RFEB 4MB5A 3CX2A 4LCUB 4RMTA 2ZSVB 1MWAA 1A6WL 3MBXH 3ZHLA 4NKOA 4QTIL 5ILTL 1FFRA 3FT4B 2UY6A 5IMOA 4LLMB 5GGRY 3VH8B 3HG1D 4PJGF 1XCQB 3B9EA 4HWZA 1OSZB 4DCQB 1NGXA 3EYFA 4PJAA 1I1AB 2EKSB 2APBA 2Z4QA 1I7RB 4NGHL 5JLZA 3MV9B 2R1XA 5GRZA 5IVZA 1YEFH 4FXGA 2BSRA 4YE4L 4LLYA 3S35L 1FNLA 1JWSA 3PIQA 1TZIA 3C6SB 4LSVL 4QYOA 5FGCB 3VJ6B 5TQ2H 2LAAA 5E08H 5HYJE 5F6IC 4I18A 3GSUA 4BSVB 5I9QB 1MCQA 3L3IB 3C87A 1OAZH 4Z0XA 2Y6SC 2O5ZH 4IRSA 4FTVE 5C0BD 3KPSA 3TJHD 3VFUA 3V6FB 5DJAB 3MRPB 2VNCA 5J1SC 2FATH 4RX4A 2VISB 5FYKU 5IVXA 2FGWL 4MNGB 5DRXA 2Q76B 1CR9H 1DP0A 5CEYA 4FP8L 4KKCD 1GGBH 1IKNA 1XR8B 5B8CB 1IC4H 3ZTNH 4UQ3B 3MRQB 4L8BB 1KBGH 1JPTH 5ANME 4O58L 2VKXA 1K85A 1OPGL 3VWJD 3VXUE 1P4BH 2PN5A 4IIQB 3SPVA 4R3SA 4AEHL 4W4NA 1GPOH 4HWNA 4W6YB 5GZND 4QRPA 2R8SH 2ERJB 1HZHH 4WI9A 5FDYA 3QEGL 2DLHA 2FEDC 2MJWA 4XC3L 1I3GH 5I17B 3EW3B 3BRDA 1HYRC 2FHBA 4AZ8A 5C9JA 3PQYE 1PD6A 2O5XH 1NMCC 3F58H 5DQJB 1IM9D 3GEWB 5FYJD 4JPWL 1DTUA 1I1YA 2ESVA 3K7UA 5C0CB 4CNIB 3PHSA 3VWKD 3ZYIA 4R4FH 4YHOH 4NRYA 4IRJD 1N7ML 4NOFA 1IEHA 2IH1B 2EDNA 4TOYH 2DM7A 2W59A 4J3SA 1QFWH 1K8DA 4Y89A 2XZZA 4D8PA 5ENWA 5C07A 4YHKL 1MFCL 3WL9A 5E99H 2VZOA 3QWRD 1MWAB 2ORBL 2W0KA 2DTSA 4NKOB 1T66D 5EIIA 5GS0C 2VWEE 1LWRA 5IMOB 3RX5A 2AERT 4MVBC 3QQ4A 4HWZB 5GS2D 4M1DH 3T0EE 4JQIL 1NGXB 3EYFB 3T0WA 4QY8A 2HRPH 2Z4QB 5IBUB 3K74B 4Z7NF 5JLZB 3B2VL 4JQXC 3DRTA 2E6QA 4TSAH 5F88A 2R1XB 1WEJH 5IVZB 5E2UL 2X42A 4EQ3A 5J11C 2VWEC 4FXGB 5C0RL 2BSRB 2HT3D 3FQWA 3VH8G 3T0EC 3NCMA 2WSKA 4LLYB 3O8XD 4F57L 2P8MA 4I9WD 4UI2A 1JWSB 5MI0C 4L4VE 4L29A 4NT6A 3PIQB 1TZIB 4QYOB 3BO8A 5I1KH 5KSAA 4I18B 3GSUB 3GJEB 3P3YA 4Z0XB 1FVCA 4IRSB 1JPSH 4KUCF 1J12A 3KPSB 5BXFA 3SDAC 4P9HC 3VFUB 4K7PX 4GRWF 4ONGH 4Y2DA 3FO0L 1E28A 2VIRA 3MJ9H 2YEZA 5IVXB 3ZDYF 1S9KC 3C5JB 3NAAL 3RVTD 4G8EA 1DVFD 1WWCA 5DRXB 4OIIH 1A3RL 5E6ZA 1CDJA 4QXWA 5CEYB 4TSCL 3B9KA 4DKAA 3MXVL 4PJFE 5TE6H 3OBAA 2XRAH 1IGML 5D5MF 2E5EA 1BMGA 4XPGL 1CL7I 1SQ2N 4HGMA 3RIAF 3HAEH 4HUMB 1QFPA 3SDDC 4KHTH 2FR4A 3P40A 3HUJE 1L4IA 3DSFL 3CXDH 3SPVB 4R3SB 4XPBH 3KNBA 4HAGA 4XX1E 5IMKA 3B83A 4QRPB 5HDOA 1N26A 2R69L 4QOKE 1YQVL 5CJOL 2CIIA 1F45A 1IC5H 3T04D 1EBPA 2QJDA 3QXDA 4ZOEA 5C9JB 3VGHA 2NY2B 1PSKH 4K3DL 3MLWH 3O6KH 2ESVB 1I1YB 2Z8SA 2JTDA 4NRYB 3QA3A 1F4WH 2AXJA 1N6UA 5MP6H 4U6YA 2P8PA 1PZ5A 5AWNH 5F9WB 2IWGA 1QQDA 2G75A 4OFIA 5IESL 3QUYA 1K8DB 4P59H 5D7IE 4D8PB 4K8RL 5ENWB 3VFWA 3TC9A 3VA2C 2HN7A 2DQUL 1NPUA 3L95A 2A77H 1F4XL 4UOW1 1FVEA 3FHAA 5EIIB 3FB5A 4JY6A 1WC7A 1MHEA 4HT1L 2NPLX 3QQ4B 3MZGB 1B4RA 3G5VA 3QFJA 4RDQG 3ARFA 1MI5A 5GRJH 5TFSL 3DETC 3QP3A 1IAIL 4QY8B 3MJ6A 4PJ8D 1BZ9A 5KJRL 1ZT1A 2D7TL 5F88B 5GRVK 1NMBH 5HTSA 4GMTL 3DUHA 4QRRD 4Z7VE 3FQWB 2ZKHL 2D7NA 4XAKD 4YK4B 4E41A 2APWA 2BDNH 1UXSA 4L4TE 3WCYA 2P8MB 2XN9E 3QCUH 1RURL 1I9JL 2IANE 5IBUG 4L29B 2IFFL 4NT6B 5EH1A 5I8KL 4JVWA 3BO8B 4C56A 5DDHA 4HXAL 5KSAB 2FGZA 2Z9TA 3VG9B 1F8TH 1XGUA 1P69B 4LGSB 4PJ9C 4LPVA 5KANI 1FVCB 2YN5A 4YFEA 3O4LD 5BXFB 3AU1A 1CGSL 4Y2DB 4FQIL 3PXHA 1E28B 2VIRB 2YEZB 4G6FB 4I0KA 1NC2D 4Y4HA 4G8EB 2QQNL 3RVVD 1U8KA 4R4ND 3HN3A 2PW2A 3IGAB 4KUZH 3B9KB 2EXYD 3MFFA 1QHOA 4XNZC 3V0WH 1IEBA 4QXGL 2ZG1A 4P5TC 2JF1A 4WGWB 2FR4B 1HKFA 1A7BA 2DBLH 3FQNA 2NY0C 1J1XL 1CTNA 4RMSA 35C8L 4XC1L 5HHOE 3KNBB 5IMKB 3GSVA 5EA0H 2RIKA 1JL8A 3ZYJA 4PJEF 2CIIB 1RJYA 1YJDL 1VEPA 4WI7A 5HDBF 3AMLA 3QXDB 3VI3F 3NFNA 4LBEA 2E9JA 3EJZC 4M5YL 4HEPG 5I71C 5LXGL 5D2LF 3VU2A 5F6HJ 3K80A 3QA3B 5F7KC 1RHFA 4U6YB 2P8PB 1PZ5B 3ULVE 1QQDB 2G75B 2OR9L 3F7RA 3QUYB 5L2JA 5M7QA 4G6JL 4WFHE 3VFWB 1NGYB 2C5DC 2HN7B 2IFGA 3CAFA 4GKSA 4ZSOE 3VD5A 3L95B 1VGEL 4K7PY 1U6AL 4FMKA 4M7ZC 1FVEB 3BWAA 3FB5B 4JY6B 1E4KC 1WC7B 2VUOA 1NUGA 3O41A 1MHEB 2XG5A 3ULVC 2BRRL 3G5VB 2BSSA 3QFJB 4NZUL 3PHOA 3ARFB 4DGYH 2FBOJ 1MI5B 1RU9L 4JZNA 2MCPH 1DL7L 1Q9WA 1BZ9B 1ZT1B 1J1PL 5TE7L 1U92A 4H88H 5CZKA 5I16A 4UMGA 2D0GA 3V0AC 3MOBL 1T1ZA 4E41B 2HJKA 2J8UE 4AEIL 4GAJL 3K0WA 1UXSB 1CGVA 4ODBD 5F21B 2Y9RT 4GXUN 4C56B 4HJ0C 2VXTH 1VFMA 5DDHB 4JHBA 5D1QB 1XGUB 3GNMH 3OJMB 2D7PA 1INQA 4H20L 5EC2A 2VH5H 2ZOLA 1R3LB 3CGTA 3WFBL 2FD6L 4Z7WA 5J06A 3AU1B 4OZGF 3HG1A 5D1ZC 4QXUH 3KYNA 3QUKA 4Y4HB 2CK0L 3BKCH 5I8EA 1U8KB 1BFVH 3I3EA 4NHCL 3U9PL 2PW2B 1V7MH 2QADC 1G9EA 1I3VA 3MFFB 3WNMA 2DQTL 2ZPKL 4WFFE 4X6CF 3RAJL 3F5WA 1IEBB 1U8LA 1AQKL 3RKDD 3IDXL 1MCHA 4PY8J 2YHGA 3D9AH 2BY0A 5FCUH 3FQNB 1MHHB 1V3LA 2BOCA 3RHWK 3OB8A 4LEXL 5E7FA 5F44A 1U95A 3GSVB 3N85L 4X7SH 3TH2T 3SDCC 5CINL 4YXKH 4I77L 3PWLB 3C6LC 1RJYB 5ETUA 4ZFGH 1FP5A 2AK4B 3MBXL 1J8KA 4XPAH 4JCMA 3A67H 3UX9B 1T83A 1T7WA 5CGYD 5C0BA 3NFNB 4LBEB 4ODXA 5IW6A 4P2OC 4JE4B 4ZFFA 4JCLA 3QWQB 5IW3A 3UJIH 3BDBA 3MACH 1CGYA 5L6YH 4XB8A 5MERA 1H5BC 1X4ZA 1AI1H 1T6VN 1A6PA 4I2XA 5A2LH 3RA7L 1YEFL 1X6NA 2A0LC 5L2JB 1S7UA 3HE7C 3VWJA 2OL3H 4OF8A 2BSED 1XZ0A 5FYLD 4GKSB 1WJ3A 4KK8D 4KRMB 1JHKH 1CBVH 2MQ3A 4ODUA 5TQ2L 3O41B 5E08L 5E4EB 2BSSB 3PHOB 1CIDA 3IDNA 2O5ZL 5IFAH 5D1XC 2YUVA 5CJQL 4F9LC 3LVEA 5JW4Q 2EEAA 1Q9WB 1IM9A 2ZWLT 2FATL 5IROA 2KH2B 1B2WH 1U92B 3MUJA 3UEZA 3VWKA 5I16B 1CR9L 1BWMA 4G6AD 4V1DE 4LL9A 1T1ZB 1GGBL 4NWTH 4IRJA 1IC4L 2HJKB 1I8LA 4JM2F 4Q58C 4NFBA 1KBGL 1JPTL 5GGTH 3ILPA 3K4AA 1Y6KR 3O2DL 2DI9A 1P4BL 5CEZE 2IQAA 4BKLA 4JG1H 3QWRA 1JYVA 1INQB 4HPYH 4WTXA 1GPOL 5BOZG 4WY7H 5EC2B 4Q9QH 2ZOLB 3QUXC 2AKRA 1HZHL 5BS0D 4Z7WB 2F58H 4HXBH 3HG1B 1MVFA 3KYNB 2NY3C 1U91A 3QUKB 1JHLH 1G7PA 1AGCA 2HJLA 4DGIH 1Q8MA 5I8EB 3HNSH 4UNUA 2O5XL 3F58L 1T0PB 1CXEA 2FX9H 4PB0L 1AR2A 4U31A 4X4MA 3F5WB 4LP5A 1U8LB 3T4AA 4OD3H 1JPGA 4NYLA 4FHBD 1M4KA 3BEWA 4U0RB 3RY4A 3F7QA 3JTTA 2NXZC 3KR3H 3CPLA 5D7LD 4JZOA 3Q5OA 2FLRT 4K9EH 5F9OH 2BOCB 3O8XA 4TOYL 1RUQH 2VAAA 1QFWL 1U95B 1V3KA 1JZ4A 4R7NA 5D72H 5E99L 3DRQA 5ETUB 4RWHA 3E2HB 5FUZH 3QUMA 5C0BB 3DI3B 4FFYH 2FJGA 4ODXB 1SEBA 3DGCR 5IW6B 4I5BA 1H0DA 2VQUA 1AY1H 4ZFFB 4XPTH 5F3BA 2Z31D 1CFSA 3QCTH 4Z7QE 1DVFA 3RBSA 4F7PB 1FORL 2HRPL 4DWHA 5MERB 3PJSA 4TSAL 2H2SC 5MENE 1OSPH 5KSBE 2ZUUA 3LPFA 2ZUTA 1WEJL 4I2XB 2CH8A 5I1JH 5DUBB 4U3XA 4ORGA 4FFVD 5I1HH 1S7UB 3VWJB 1XZ0B 1WBZA 1DFBH 1WZ1H 4W70A 4YDIL 1ZTXH 5CBAA 5J4MA 5IF0A 1VESA 5I1KL 4OGAD 4ODUB 1GOFA 5IJKC 2EDWA 4WDIA 1CYGA 1EAPA 5HI3C 5BCAA 1JNJA 1TENA 1JPSL 4YGVA 3PP3H 3MSPA 4HK3N 1F6FB 3WFDH 4PD4J 1IM9B 2IPUG 2QR0A 3MJ9L 3O4OB 3HAEG 4OIIL 4CJ1A 3MLXH 3VWKB 5AYQA 2D0HA 4OI8A 5K93A 4J23A 3GZKA 1CLYH 2N1KA 2P47B 3K2UH 5TE6L 2XRAL 4IRJB 5C0AE 3D3VD 4ZO8A 1HEZA 4R2GC 3ILPB 1CE6A 4LKCA 2IMMA 4Z0BH 1KLUA 4KHTL 4KXZI 4M4PA 1CTOA 2IQAB 3CXDL 1PFCA 3P0GB 4LAJH 4J4PC 1KJ3H 9CGTA 1MOEA 3RJQB 2DJ4A 2X4TA 2AKRB 4I13B 3QNXA 1U41A 2OL3A 1ZLSH 5LBSL 5EU3A 3SCMC 4U2YA 5I30H 3PP3K 4KMLB 1U91B 5SX5H 1G7PB 1AGCB 1FZJA 2G2RA 2HJLB 3ELAT 3VFSA 5JUEH 1VADA 2GQHA 4PJ8A 3B8SA 4P2RD 3SGEH 3T3PE 3MLWL 1E4JA 1T1YA 1OY3B 1LO0L 1MNUL 3JV4A 3T4AB 3W0WE 1U8QA 2R4SH 1JPGB 3LD8B 4NYLB 4QRRA 3BEWB 3JTTB 5JHDD 5GRVL 3PNWA 3SGJA 1F4WL 3HB3C 5MP6L 3CPLB 4JZOB 5AWNL 3O8XB 3V8CA 1TJIH 1ZSDA 3LQMA 1Z2KA 4U1SA 2VAAB 2JJTA 4XPHH 1YEJH 4P59L 2AXGA 2DS4A 4KJQD 3DLQR 3A6OA 3DRQB 4XVUC 2A77L 5GGTA 4MAUH 1JZ7A 3L7EA 2OZ4H 3I6LE 5DMKA 2VLMD 3ARZA 3QUMB 1RIHL 3QCVH 5GISH 3O4LA 2FJGB 1SEBB 4I5BB 1H0DB 1OAKH 4K71C 5F3BB 1CFSB 1U42A 2C26A 1NC2A 1K5NA 5GRJL 1DVFB 2VN7A 4G6KH 1Y18A 3DUUA 3PJSB 1R3HA 3MV9E 1CD0A 5FYLH 1NMBL 4PGDA 2FLBT 2PTTA 4ORGB 2AEPH 4IHOA 1F3DJ 2D3VA 1JIBA 3ESVF 3B8YA 2BDNL 5FF6A 2YMXH 2MCG1 1WBZB 5DMIH 4S1DD 4TQEH 3QCUL 4Y8AA 1I1AC 4N8PA 4I1NB 4N1EA 2EDLA 5CBAB 5C9KA 5C0DA 5FUCE 1F8TL 2BERA 3WBDA 5IUSA 5AAWA 4WDIB 1RZKC 4YGVB 5TF0A 1YMHA 4YWGH 5C2UB 2QR0B 4PB9H 5BOPA 3AM8C 4LRIC 4B5EA 1Z9LA 1OTTC 4DJMA 2Z91A 1MIEH 3JXAA 3LQAH 4KI5E 5TGBA 1LNUA 3FN9A 4WU5B 3S35X 5I9QC 1MH5A 1RSFA 3V0WL 1HEZB 4TNVF 1AHWC 2YRLA 1KCVH 1CE6B 1T7ZA 4LKCB 1JVKA 4PJXE 1KLUB 5ECJE 1VFBA 2MTPA 1E0OB 2DBLL 1PGRB 5DHVH 4F8TA 4L8CA 3H9ZA 4GG6F 2OTPA 5EA0L 2X4TB 4KI5C 3QNXB 2OL3B 1LP9E 3SKMA 5B8CC 5EU3B 5LCVH 1CLZH 5I74C 3UBXA 4M61A 3CCHA 1HOCA 4HDIA 2Y36H 4RDQF 4QHLA 1FZJB 2ZUQC 2G2RB 4HW6A 3VFSB 3SE3C 1VADB 1UJ3C 4PJ8B 4HIJA 4UU9A 3AREC 1T1YB 3T3ME 4JKLA 4PRID 3BN9D 3JV4B 1U8QB 4QRRB 1ETZA 3PNWB 2GSGA 4NN5B 3EJYC 1BIHA 1MJ8H 1UKSA 1ZSDB 4U1SB 2LABA 3JBG7 3K1DA 4QRTA 5J6GB 5FXCH 3L5WA 2AXGB 1VENA 3V7AG 1CDYA 5I75B 3SGDI 1LO3H 3L7EB 5DMKB 3BESR 5HJ3A 3R0MA 3O4LB 1GGYA 4KQ3H 4OCSH 1S7RA 2MNUA 3CSPA 4DN3H 4RCAA 1SJEA 1NC2B 4DGYL 1K5NB 5E94A 2MCPL 3UMTA 4P99A 4PJAE 1Y18B 4LPXA 3LPGA 5IHBA 1R3HB 2G60H 3IDJA 3B2UD 3BP5A 2W1NA 2P7TA 4CVZA 4H88L 4PGDB 2PTTB 4OUUA 4IHOB 1UQSA 4JQVA 2HG5A 4Z77A 4RA0C 3EOTH 2H8PA 3ARWA 5FF6B 3LIZH 2UWEE 5LGKA 3BZDA 3LY6A 4C4KO 1TETH 1IQDA 2VXTL 5CIPH 4MNHA 3RVUC 2AJXH 1G9NH 5C0DB 3SDXF 3GNML 4ZNEA 2VH5L 3PL6D 1YMHB 1T21A 3ZKNC 1NQBA 3ES6A 3RTQC 3KPSE 4YEEA 3S96A 1L7TH 4QXUL 5DMJB 3MQIA 2YD6A 3BKCL 2Z91B 1BFVL 4OI9A 1V7ML 2R0ZH 4R9HA 1T89C 1T5WA 3TBWA 2HRLA 5D8JH 3RY6A 3TT3H 5TGBB 1LNUB 4I18C 3U36A 1MH5B 4IRSC 3VXNA 2APTA 5IB2A 2HTLD 1VFBB 2QSCH 3D9AL 5KG9A 4L8CB 5DGQA 2WBJC 4X7SL 1I8KA 4YXKL 2MOVA 3SKMB 1IKNC 4O4YH 4YFDB 3UBXB 4M61B 3CCHB 1CF8H 1HOCB 3EIFA 5L0QC 1BP3B 3QULA 4RZCA 4QHLB 4PRDA 4XPAL 3A67L 4UBDD 4G8GE 1CICD 3J7HA 4HIJB 3VW3H 4UU9B 3MRJA 3GSNH 3MACL 4FA8A 3KPQB 4XAWH 1FNHA 2QQKH 5L6YL 3A6CH 4LLQA 1AGFA 1H3TA 1ETZB 3O6FD 2GSGB 2EYTA 5ESAA 3H6JA 1AI1L 1WZMA 5INCA 3S37H 2FWOA 1VACA 2DQIL 4WW2F 4H8WH 4QRTB 1J7VR 1L6XA 1NCNA 5JIKA 3OKKA 1ZA6A 3VXRD 4PJBF 5JMOC 5HI4D 2OL3L 3GBNL 4M7KH 1SBSH 4PJDB 2NY2C 5C07E 4DUVA 5IWLA 1PG7X 4CVUA 4WU7B 1JHKL 1KCKA 5GPRA 5HJ3B 2GTZA 4HWBA 5CSBA 4MMXC 2N7BA 5BS0A 4GG6A 1S7RB 2A9MH 1BBDH 3TZVD 3FQTA 5F9WC 1KCUL 1SJEB 3SGKC 5IFAL 1RD6A 4UV4H 3HI5H 1N8ZA 3FCTA 1RQ5A 3H9HA 3IDJB 3BP5B 4YBLB 2PTVA 1WISA 2P7TB 4CVZB 5F71A 4TVPD 4WUUD 1HN1A 2RHEA 3H42H 1UA6H 4OUUB 3BPLB 1UQSB 3NPSC 2HG5B 4PY7A 4Z77B 1JRHH 2H8PB 5D7LA 4FQPA 2CIKA 1SYSA 3BGFC 3BH8A 4O02H 4LARH 4LOUC 2P4AB 1IQDB 1I85A 4MNHB 1N0XH 1I9IH 4JG1L 4HMEA 1XEDA 4EDWH 4HPYL 5E9DD 2NYYD 3M07A 1JNNL 4OCXH 4EN3D 4WY7L 2VLLA 1T21B 4MA7H 3ES6B 1NDGA 3O0RH 4YK4C 2F58L 3S96B 3RL2B 4HXBL 5HYSA 4I3RH 1MEXH 3GKZA 2Z31A 3AXLB 3MMEA 3V6OA 1JHLL 5L2KD 4DGIL 2WMPA 3HNSL 4YXHH 3Q1SH 5CGMA 1T5WB 3TBWB 1XMWA 3VG9C 2FX9L 1NGZB 4WNQA 2WW8A 3U36B 1V8HA 3OJDA 1KB5H 4XCFH 1D5XA 4OD3L 2V9RA 3HI1A 3VXNB 1XF5A 3K81A 5IB2B 1CGUA 1YMMD 4Y2DC 1AGEA 3JWOC 3KR3L 3BAEL 5KG9B 4K9EL 5F9OL 1K4DA 2MHAA 1RUQL 1DLHA 4XP6L 4HHAA 1I8KB 2EDDA 4P46C 1T03H 4JY4A 1EBAA 5D72L 1UYWL 5T3XH 1BM3H 3H7LA 5EZLA 5B22A 4M93B 3KLHD 3QULB 4RZCB 4B7IA 1LO2H 4X6DF 4PRDB 5FUZL 3ULUD 3U79A 1G7MA 4FFYL 1WWBX 2B5IB 5DD5L 1AY1L 4XPTL 1TIUA 3QDHA 3OKEA 3MRJB 2EIDA 4F8QA 3BDXA 1F4HA 4LLQB 4OGZA 1AGFB 3S3SA 4MS8D 2EYTB 5ESAB 1OSPL 3D3VA 4U3CA 1BF8A 5INCB 5I1JL 2FWOB 1VACB 2WINA 3T8XA 2WP3O 1Z9MA 2RQ8A 1ZA6B 3OKKB 3P0VH 3REWA 3IFOA 3QT2A 1J87A 1DFBL 1KIQB 4LQ1A 1WZ1L 2DLTA 3S36H 2GTZB 4MAYC 1ZTXL 1X5JA 5BS0B 4GG6B 2CQVA 3ZE1F 1SBBA 3FQTB 3QFJE 2D4DA 3QUYC 1N8ZB 1MI5E 3FCTB 4PGCA 5FGBA 3WFDL 2Q7NA 1OM3H 4OLZH 3H9HB 4DVRH 4KKAC 4P2RA 2XACC 3KJ4B 1HCFX 5AZ2L 2DJSA 3MLUH 4QHUA 5ITBH 3MLXL 2DWEA 3NPZB 1CLYL 3K1KC 2HT2D 1CD1A 5JHDA 3K2UL 4PY7B 1MIMH 2F5BH 3TN0D 2E7BA 3ARRA 5D7LB 3GSNA 4E41E 4MGXA 3ARFC 1ITCA 2CIKB 2HFTA 4XMKH 1SYSB 3BH8B 4G8FA 3TCXA 3WLWD 4Z0BL 3VA6A 1RMFH 2YWYA 3K2MC 5F1SA 3HI6H 3WKNA 4C56E 1QLEH 4UOW0 1KJ3L 1ODAA 1UC6A 2VLLB 2FJFA 1FJ1A 4DFHA 2NY7H 1NDGB 1ZLSL 3MYZA 1MCRA 5HYSB 4KROB 3MMEB 2Z31B 3N9GH 3ZYZA 3EKCA 4X7DC 3TA3C 1OHQA 1XFPA 1GC1H 4PRBA 4WENB 1KEMH 5JUEL 4GMSH 1G84A 3NGBB 4WNQB 4CRPA 1U2CA 1CDIA 3OJDB 5ISZD 3T65A 2E3VA 1D5XB 3O11A 2R4SL 3HI1B 5DVOA 1XF5B 4Z7NE 2IMNA 2R2CA 4D94A 1AGEB 3OXRA 3AROA 1T0NA 1EVTC 2G5RA 1K4DB 4HLZG 4Y4HC 2MHAB 1TDQA 1HHHA 1DLHB 2ICWI 4XPHL 1ZGLM 1YEJL 4HHAB 3PWPD 3FB8A 3N1FC 4P3CH 4JY4B 1F90H 1QNZH 5EZLB 1RK0A 1S7TA 2OZ4L 4NZRL 1G7MB 1FAIH 1Q0XH 5GISL 4PP2A 5I0ZA 4FQ1H 1OAKL 2OCFD 4N5EC 4NJ9H 3OKEB 4PLNC 4BH7A 2FBJL 4MQXD 4X4YA 1TQCB 4G6KL 4LDOB 5H35A 4GRWE 12E8H 4OLXH 3D3VB 5FYLL 3ZDYE 3WIHH 2B39A 2OJEA 1R3KA 5ESQA 3PWUA 2WINB 1B88A 3DBXA 3HNVL 1RZ7H 3T8XB 2AEPL 3REWB 5JMRA 3IFOB 4YHZH 4N9OB 3HZMA 2HLFD 5D5ME 2YMXL 1SHMA 1I8MA 5DMIL 3QQ9D 4TQEL 3HA0A 4M8QA 1HQRA 2Q8AH 1DBMH 4Y4KD 4XBEH 2ENYA 3H3PL 5DLMH 5DJCA 4KDWA 2R29H 3L7FA 2DB8A 4G43A 4JFEE 4PGCB 1A7QH 1Q1JH 3CH1A 1C7SA 4Z76A 1I7TA 4YWGL 4PB9L 3NH7H 4P2RB 3UTSE 4JHZA 5DC4B 3SQOH 3QRGH 1D7FA 4PRIA 4QHUB 2DWEB 1MVUA 1MIEL 1FE8L 1CD1B 3LQAL 5JHDB 2P5WD 4NKIL 5E4EC 1A0QH 3GSNB 3LEYH 1KCVL 4G8FB 1Q0YH 4PRHE 4OCWH 4ZNCD 4TRPL 2GJ6D 4OLWH 2AQ1A 1MFAH 2J2ZA 1RIVH 5CSZA 3WKMH 1FJ1B 3C5ZD 3ZKXC 4KWUA 4RGOH 4BQBA 5CP7A 1CLZL 1XCTA 3RIFK 2Y36L 3BGAA 3HG1E 4KK5C 1ACZA 1RI8A 5A2JH 4PRBB 4GBXD 5IB4A 4NN7B 4Q0XH 3K8LA 5IK3A 1KCLA 2BVYA 2WUCH 3ZHDA 3T65B 3WNPA 5A1AA 3O11B 4YGAB 4HUUA 2Y6SD 4XCCH 1ND0A 3MREA 2ICES 2KPNA 5BV7C 1YY9C 3OXRB 5EN2A 1OB1A 1T0NB 4OBRA 1MJ8L 4J3UA 1HHHB 3TO2A 4K7FA 3ULUH 3FB8B 4LVOB 1R6VA 3FT3A 5DGRA 2EIZA 1F58H 4NCDA 5HYJD 4PREA 1UEYA 1LO3L 1RK0B 1S7TB 4MB3A 2Z8WC 3PL6A 3RJDA 4FTVD 1OGTA 2F74A 4KQ3L 4OCSL 4PP2B 3REVA 1JGDA 3RNQA 3WNNA 3W5MA 1E4XI 2X7LA 4WV1A 2PXYC 5D2NA 3OAYK 2C3VA 3UROR 4F37F 4BH7B 4E5XA 4X4YB 5H35B 3TH3T 2G60L 1U3ZA 1KENH 2Z8VC 4Q74A 1UKQA 5ESQB 2OJEB 1R3KB 3PWUB 5FCSH 3DBXB 1KC5H 1T83C 3IFLH 1TPXB 3HZMB 2GAZA 3EOTL 1UCTA 3LIZL 1PAMA 1I8MB 5I6XB 4M8QB 1HQRB 4IM8A 4MHHI 1JUFA 3PWVA 1A9EA 3VXQA 3VDAA 4M1GH 3D18A 5AD0A 3BEVA 2AJXL 1G9NL 1U3HD 4KKCC 1CWVA 4PJIA 4ZTOH 3IAPA 3KXFD 5DJCB 3U7WH 3G6DH 4NN6C 3G9AB 4PJCA 3L7FB 3ARDD 4G43B 4MB4A 1CICA 4OF0A 3VWJC 3PQYD 3CH1B 1L7TL 4PJEE 4Z76B 4M1CD 1I7TB 4MWFA 4D2NA 2YZ8A 4PRIB 5FYJE 5HDBE 5GZNC 1MVUB 5E00A 3VI3E 4K94C 1H8SA 2R0ZL 3TT3L 5D8JL 2D9QB 3O6FA 5FHAH 1NEZG 2GJJA 4NC1E 4HBCH 1U8JA 5D2LE 3VXRA 2QSCL 5I1CH 4QF1A 2EC8A 2YR3A 2HP4A 4NFCA 5IROC 4U49A 3IDYB 3WIHA 3O4OC 3OPZH 4G8IA 4JFHD 5J1TC 1OD9A 5CSZB 3V52H 3EZJB 1EX0A 4O4YL 4RQQA 5CP7B 2F19L 4IRJC 1I8LC 2WWMC 4IBLT 1XCTB 1INDH 1CF8L 3TZVA 2YC1A 1KV3A 3QRFM 1FGNH 1X5ZA 2QKIA 5IB4B 2NTFA 5IK3B 3VW3L 7FABH 4YBQD 3ULSA 1HIMH 4X4ME 1ROWA 4WUUA 4XAWL 2QQKL 1T66C 3A6CL 4IRZH 4HUUB 3JUZA 1OL0A 3JV6A 1ND0B 3MREB 1EO8L 3UTPE 5EN2B 1OB1B 3SDAD 5CSGA 1B90A 3S37L 3BIBX 3TO2B 4FQCH 1S5IL 2XQBH 4K7FB 2J4WH 4I9WE 3EYVA 1KF9B 1AO7D 3KLDA 3GI8H 1JPFA 3FT3B 1SBSL 4LKXB 2H3NA 3UYOD 2CR6A 2DWDB 3QDJB 2L7JA 1C08A 3RWIA 2R0KH 4PREB 1EJ6A 1MLCA 5E9DA 4EN3A 3RP1A 4L5FH 5J7CC 3LD8C 1BVZA 3PL6B 2HT3C 2NTSP 1T3FA 1OGTB 2VLRE 1ZHLA 3REVB 1JGDB 2A9ML 3RNQB 3EOBA 3WNKA 3SDDD 1BBDL 4BELD 2X7LB 4WV1B 3O8XC 5D2NB 1ZE3C 2D7OA 5L2KA 4GJTB 1R24A 4U2ZA 4UV4L 4E5XB 3V6BR 3QO1A 1ZLVH 5DD6A 4FQJH 4OZGE 1AH1A 7CGTA 2K1MA 5E5MA 3H42L 4Q2ZA 1HXMA 1UA6L 3U9UB 2VC2L 1YMMA 2I60H 5I0DA 2GAZB 1JRHL 4X6CE 4O02L 3U7YH 1JUFB 1PQZA 3PWVB 3RVTC 1A9EB 3VG0H 3VXQB 4LARL 1AJ7H 3BVNA 5AD0B 3BEVB 4QOKD 4ZD3H 2EIEA 1I9IL 1TNNA 1KJ2A 3OGCA 4PJIB 1X4XA 4EDWL 4OCXL 4U7SA 3D6GA 2X4SA 3S9DB 4PJCB 4MA7L 4AG4H 1ORQA 4KMTL 1CICB 3O0RL 1W0WA 2CGRH 5HGGS 4I3RL 1MEXL 2HWZL 4KDVA 4MWFB 1T6WA 1C1EH 1MCCA 3LRGA 4UAOC 1KIRA 1IFHL 5JHLH 1H3PL 4F58L 5E00B 4YXHL 5I66A 3Q1SL 3O6FB 1RUPH 3QAZB 1I1CA 4CVWA 1N5YH 1KB5L 4XCFL 1U8JB 4GXUM 1JGLL 1EK3A 5KN5A 3VXRB 3LKSA 3S3JA 2WZPD 4QF1B 1WFOA 3BOVA 4JGMA 4BQ8A 2BY1A 4Z7OF 1T03L 4RISL 1FC1A 4OCRH 2LQRA 5T3XL 1BM3L 1EJOH 2PF6A 3H3KA 4RQQB 3GUTA 1FV1A 2R1WA 2FL5A 1QSEE 3TZVB 2YC1B 3GSRA 3PGCA 2NY5L 4MXVF 1LO2L 1S9WA 3QI9D 1FFPA 4DK3A 1YQ2A 2QKIB 4P5MA 2NTFB 4OZHF 5SX4I 1FVDA 4JFZH 5SWQA 3ULSB 1F11A 4WUUB 1BVKA 1AFVH 2DKUA 3JV6B 3D69A 3TN0A 1JN6A 3WDIA 4L4TD 1B6DA 3EDKA 4EIZC 3P0VL 2EKJA 1JPFB 4H1LA 1J0HA 4PJ8C 2VITA 1XF3A 2H3NB 3LS5H 5H94A 3RWIB 1MLCB 4EN3B 3LN9A 4U05A 1T3FB 2XICA 1ZHLB 3SGJC 3JVGA 3O4LE 4EUPH 1FCCA 3P9MA 1QEWA 1SVCP 3PP4H 5L2KB 1DQJA 1R24B 3QO1B 4JM2C 4OM1H 2YN3A 5DD6B 3O2VL 5F7YC 1OM3L 3TVMD 4DVRL 1FIGH 4K07A 5DO2C 5I75C 4PG2C 4FMFA 2BVQA 3CFDA 3MLUL 2FHFA 5ISZA 5ITBL 3FB6A 5E5MB 2EDBA 4Q2ZB 1HXMB 1I3UA 5AYUH 5KVFH 2I26N 4XNMA 1YMMB 2F5BL 3UDWA 1QR1A 1DQTA 2I07A 2VABA 2XKUA 1CVRA 4YC2B 1P2CA 4XMKL 3QNZA 4ZOBA 1PQZB 1RVFL 3RVVC 4UDTA 1RMFL 1WICA 3BVNB 4R4NC 3PWPA 5EU5A 3HI6L 1R3IL 1VDGA 3JWNC 1A2YA 3C09B 1QLEL 1KJ2B 3OGCB 2QHRH 3V95A 2BX5A 2X4SB 1IAII 4TUOA 2Y1VA 2NY7L 4F9PA 1ORQB 4FQHA 4NQVA 2L7UA 1W0WB 3X12A 4NQXA 1KT2A 4LNRA 4XCNA 5FM5M 2EH7L 5GS0H 3SKNA 1EEYA 3N9GL 1W72H 4DFIA 1KIRB 2JCCA 3IFPA 1KEML 3WSQL 5I66B 4GMSL 4OT1H 5DJ8A 4GSDH 4U7KA 2AI0H 2D4FA 3MFGB 3V4UH 1CXIA 1FYTD 2HTKC 5KN5B 2GKIA 4WFHD 3LKSB 1S7SA 2YD9A 2ICWJ 4ODHH 4XNXH 2EE2A 2A1WH 3QEUA 3PG2A 4DK6A 4P3CL 4Y4KA 1D9KC 3RWCA 3ZE2F 4NM8H 1BD2D 3GUTB 2EE6A 1QNZL 1FV1B 2R1WB 2FL5B 1SVZA 3GSRB 3PGCB 1GZPA 1S9WB 1UH3A 4DQOH 3KPLA 1FAIL 1FFPB 1Q0XL 1NEUA 4P5MB 4DUXA 1L7IH 4FQ1L 2AEIT 4NJ9L 2GHWB 1FVDB 4UV7H 5SWQB 4P9HH 1S78D 4A6YH 1TTUA 1F11B 1SJHA 1BVKB 1KN4L 3CXHJ 12E8L 4MLSA 3D69B 4OLXL 3TN0B 1JN6B 3L3HA 2P5WA 4PLKD 5D1ZD 1FFOA 2VERN 1RZ7L 5A16A 4LVNB 4UUJA 4XNYH 4H1LB 2VITB 1M71B 1XF3B 1CFQA 5DD0H 2GJ6A 2XYCA 5H94B 2Q8AL 1YN6A 3ALWA 1DBML 5IB3A 4UT7H 4FXKA 1UM5H 4KK6D 1EH9A 1RUKL 3C5ZA 4XBEL 5DLML 3P9MB 2WP3T 2H1PH 1QEWB 1MHPH 1DQJB 2R29L 1A7QL 1A7NH 4GBXA 2YD4A 1Q1JL 2GITA 3OQ3B 3RWJA 4AH2A 3SDCD 4NRZA 3SQOL 5D71H 4WFFD 3CFDB 3QRGL 4GLRI 5ISZB 3FB6B 4J8RA 1IGFH 2I9TA 5FGSA 3K3QA 4XNMB 1QR1B 4HKZA 3QDGE 2I07B 1A0QL 2VABB 3R1GH 1P2CB 3QNZB 4PG9A 1Q0YL 4UDTB 4OCWL 3PWPB 5EU5B 1A2YB 4KJWD 1EXUA 2EXWD 4Y5XC 2OP4H 3DVGA 4YBLC 4OLWL 5HYQA 1EHXA 3P4MA 2BVTA 1MFAL 3O3DA 4PRNA 5DEZA 5HYJA 3KYAA 5IJVA 1J1OH 1RIVL 5JIIA 3WKML 4TUOB 2WWKO 5DMGD 2GUOA 4FABH 4FTVA 4FQHB 4RGOL 4YDKH 3BPLC 3G08B 4NQVB 4UDUA 2PYEE 3RKDC 3X12B 4NQXB 4XGZA 1KT2B 4LNRB 3HE7D 1EEYB 2JCCB 5CUSH 3IFPB 2HAZA 2EZ0C 3GMLA 2J6EH 4Q0XL 5DJ8B 1N64L 2Q6WA 2WUCL 5ANMA 2EDEA 1CLOH 4HWUA 4U6XA 5DZOA 5EBWA 2PW1A 4PP1D 1BGXH 1S7SB 4NBYB 4LPTA 1CU4H 1YNLH 3FRUA 4S10A 3V79C 3QEUB 1V3JA 1CK0H 3ULUL 1LEKA 4Y4KB 3RWCB 3RY6C 2C1PA 4JFOA 3MJ7A 1OWRM 1U3HA 1F58L 3EO0A 3KXFA 3C9NA 3WIFB 2EDQA 1GZPB 5D6CA 1IILE 3KPLB 3ARDA 2X1WL 2LE9A 3PQYA 5A3ID 1MCFA 1VCAA 2I5YH 3MRHA 4KK8C 3BZFA 5E6ID 5KTEH 1SJHB 1BFTA 2DM3A 4J3WA 3P0YH 4G9FE 3QUXD 1KENL 3E3QE 3L3HB 2P5WB 4M93C 1FFOB 1KC5L 5HGBA 2B20A 3S8WA 1J0JA 3IFLL 4UUJB 2B5IC 4HH8A 2NZ9C 1LO5A 5CEZD 1CFQB 2GJ6B 4LSSH 1IGCL 5I8CA 1YN6B 5IB3B 3FKUS 5DA0B 4FXKB 2YKLH 1TFHA 3C5ZB 4G6AC 3E3QC 2Q8BH 4ZTOL 4GG6E 4BZ1H 2NXZD 3U7WL 2LV4A 1CQKA 3G6DL 2CXGA 4GBXB 4H1LG 2GITB 3RWJB 2CDFA 4AH2B 3JWDC 3TNNA 2YD5A 1WBYA 4NRZB 4RWYL 1S9VA 1UZ6F 5DJXA 2BMKA 5JZ7D 5F6IB 4HIEA 4J8RB 1O7VA 4Q9CA 2I9TB 1F97A 2ZCHH 2A38A 4P2QD 4RGNE 4HKZB 3AUVA 3SDAA 4FFWD 4HBCL 1ZAGA 1KPUA 4PG9B 4Y16C 1KJMA 1AO7A 5J12B 3FMGH 4JB9H 5I1CL 4NCC2 2IH3A 1EXUB 5HYQB 3DVGB 3P4MB 4PRNB 5HYJB 2EDJA 3O3DB 1JZ8A 3OPZL 5IJVB 2XT1B 3VXPA 3RGHA 1QFOA 1OF2A 3V52L 2GUOB 4FTVB 5C0ND 4UDUB 4RGNC 4XGZB 3UPCA 3RFZC 1INDL 5EB9A 3D1MC 2B4CH 3D87B 3SDDA 2ZCKH 2CKBH 3V6OE 3GKWH 4ZQKA 1FGNL 3ULVH 2YS4A 1TXKA 3LQZA 4X4XA 1T20A 3O9WC 3GMLB 5TDNA 1I85C 1BQHA 2Q6WB 1HIML 5ANMB 4BA8A 4IRZL 5IQ9A 5HI3D 3I6GA 2DRUA 4U6XB 5EBWB 2PW1B 3HUJA 2Z31C 4GXVH 3V6OC 4F7MA 1NMCB 3S98A 2V2XA 4LPYA 4FQCL 3RRQA 3FRUB 2XQBL 4YDJA 2J4WL 1LEKB 4PR5A 3GI8L 2IG2H 4R96A 2C1PB 3NGBC 3MJ7B 4QOKA 1U3HB 3TBTA 1RZJC 2XTJE 2Y7QA 3EO0B 2R0KL 3KXFB 3R06A 3C9NB 4L5FL 1A6VH 5D6CB 3LB6D 4K3GA 4FFVC 3ARDB 3RVWD 3A6BH 3EZ8A 1JWUA 3PQYB 3SDXE 3MRHB 5TQ0H 5J9PA 3BZFB 1CL7H 5J8OA 3KPOA 4IDJH 1A7OH 4MJ5A 2XTJC 3TJEL 1Z0MA 2P24A 5HGBB 1MCDA 1DSFH 4XH2A 3U83A 2J6EA 4UTAH 5D7IA 2I60L 1ZA3A 1LO5B 2EDFA 2O93L 5DI8A 2ZG3A 4OQTA 5I8CB 3U7YL 3VG0L 3V4PL 1AJ7L 1TQCC 3EO9H 3KGRA 4PD4K 3UP1A 5FKAA 2AAVA 4ZD3L 1A14L 3KDMA 3T0EB 4U1HA 3QI9A 4AG4L 3P11H 5HVHC 4M6NH 1MCOH 4HIIA 2CGRL 2CDFB 4H0GA 3SKJH 3BQUD 1C1EL 3TNNB 4K7PL 1S9VB 1V5JA 3DECA 2BMKB 4P2RE 5DJXB 5JHLL 4XVUD 4HIEB 3W0WD 2ILLA 2VZSA 4Z7VA 1WAAF 5C0JA 1RUPL 5JHDE 3SDAB 1X5AA 4JPVL 1N5YL 4L4TA 4MYWB 1KPUB 3MRKA 4AENA 1KJMB 5FGBC 4L4VB 1AO7B 3QO0B 2GYSA 1Q9KA 2IH3B 2CLRA 1FAKT 1G0XA 4B50A 5IGXH 1IZKA 3VXPB 3RY5A 4GW5A 1OF2B 3I6LD 3F7PC 2VR9A 4Q6YA 4OCRL 1OAYH 4P3DA 1EJOL 1KJVA 3SDDB 5JQ6H 1RZIA 4ZQKB 2ZOKA 5JXAH 4U6HA 3LQZB 4X4XB 3BKMH 1T20B 4KJQC 4NQSA 4YPJA 1TVDA 5TDNB 3TVMA 4JFZL 1BQHB 5EOQH 1S7XA 5L9DH 1F3DH 3E1F1 3OJ2C 5ACLA 1AFVL 5IQ9B 1TCRA 3I6GB 5B4MD 2ICEA 3HUJB 1J0IA 2FJHA 2XZQH 4F7MB 2V2XB 4M7LH 1LGVA 2VXQH 3MV11 4YDJB 2XY2A 3P77A 1PKQE 4XVJL 4NN7C 1A1MA 4PR5B 4M6MH 4R96B 5DHYA 4QOKB 3TBTB 5KS9F 3NCYP 1MF2H 3LS5L 3R06B 2E7LA 4Y88A 4DUWA 4MXWH 5EPMA 3ZT6A 5IR1A 1FZKA 1EGJH 1JWUB 4U4BA 1DQQB 3MGTA 2HLAA 4YNYA 5J9PB 2CLVA 3PP4L 3GSXA 3KPOB 2NCMA 4LVOC 4OM1L 1NKRA 2ATPA 4F3FA 2A9NH 3SO5A 1BOGA 2F9BT 5D93B 1FIGL 4KI5D 1MLBA 5CEZH 2NXYD 4XTRC 5D96B 2CKBA 3WJLA 5E0QA 3QFDA 5KZCD 1FYTA 3QDAA 4XH2B 5KVFL 5D7IB 1ZA3B 3QSKB 5DI8B 3T0BA 4ZSOA 3WXVL 3Q3GA 3ARED 3DHMA 1J10A 4CMMA 2VDKH 4EKXA 4YUEH 5FKAB 1BD2A 4EDXA 2CUHA 3ARQA 1B0GA 2QHRL 3KDMB 1ZOXA 4ZOCA 4U1HB 5LVEA 1CGTA 3EJYD 3QI9B 5GXBB 4G7YH 1TPXC 4NPYA 4HIIB 3PGFH 3DNKA 4LSRH 5IVNA 5GS0L 3BZ4A 5I6XC 1W72L 5JXED 4X6DE 3WUZA 3QPXH 3ROLA 3UTTE 1LE5A 4OT1L 4PUBH 4Z7VB 4GSDL 5C0JB 4WWKD 2AI0L 2J8UA 3S5LA 3C5SA 4L4TB 5D1ZA 5T3ZH 3V4UL 3MRKB 2QEJA 4DKFH 4AENB 4NO2A 4KQ4H 2OK0H 2ZCLH 4HPOH 1Q9KB 3GGWA 1NBVH 1E4WH 2CLRB 5DVNA 3IDUA 3VGEA 1FZMA 2EYRA 4XNXL 1CIUA 4GW5B 4NM8L 4P3DB 3SHSA 1KJVB 2PTUA 3GJFH 3P9LA 5JW4R 3QG7H 1TJHL 1RZIB 4PJ7F 2VXUH 2ZOKB 2UVFA 4L8SC 4U6HB 4DQOL 1U2HA 3MUHL 4NQSB 2V5SA 1UZ8A 3TVMB 3FZUD 3SDCA 3C60D 3EOAA 4UV7L 4P9HL 1S7XB 3RVUD 3GDBA 3LKQA 3X13A 4A6YL 1OQOA 4N8VA 5H37G 4LCCC 4XXDA 4OLVH 4JO3L 1TCRB 3KPRD 4APQD 2CKNA 5ADOH 3ZKND 2ICEB 3RTQD 2FJHB 2YBRA 1S3KH 4NQDE 2BVEA 1VKXA 1WAAA 3KLAA 3P77B 4XNYL 1A1MB 3NCCB 5I73B 1B0RA 3BH9A 5I71B 1M7DA 5DHYB 2V5YA 1BQHG 3B2UC 5DD0L 5JPMA 2Y4SA 1GXEA 4UT7L 1H5BA 1UM5L 1FO0L 4LLDA 5IR1B 1FZKB 3GJFK 4LSPH 1F3RB 3MGTB 1JNLL 2DQDH 2HLAB 1KG0A 4YNYB 3HE7A 1MHPL 2MQCA 2DYPD 2KDGA 5TJWK 2CLVB 4XX1G 3BKYH 5D2NE 4JRYD 1EUUA 3GSXB 1A7NL 4F3FB 4OD1H 2ATPB 4JANA 2WBJD 1BOGB 4DTGH 1MLBB 3TIDA 5KOVC 4DVBA 5D71L 1IGTA 3BPCA 2CKBB 2BJMH 5T33H 2BNRE 3MRGA 3QFDB 1ZS8A 3PL6C 1YNKL 1IGFL 3HC4H 1FYTB 4UT6H 3JV5A 3OMZA 5CZXC 4F9LA 1QFUH 5D2NC 3R1GL 4ZSOB 4X98A 4H5SA 3Q3GB 2LAGB 4CMMB 3V0VA 1BD2B 1EHNA 4EDXB 2OR7A 2OP4L 3BP4A 4X6EA 5KAQG 3S3PA 1B0GB 3QUZD 1J1OL 4XVSH 1DEEA 3ZL4H 2VR5A 4AY0A 4YDKL 4FABL 4G8GD 3QHFL 1L0YA 1NMAH 4HUXA 4PJCE 4PFEA 4NPYB 2HTLC 2UUDH 2VSCA 5FIEA 1X9QA 2YUWA 3BZ4B 3TF7C 1MREH 5CUSL 5E6IA 3ROLB 5L7XH 4CUCA 1EGJA 1LE5B 3PF2A 3WE6A 3QUXA 3U1SH 5DS8A 1WQVT 2J8UB 3S5LB 1YPZF 3C5SB 5D1ZB 4UBDC 5EOCJ 1CLOL 4NO2B 3VFTA 5JW4N 1ZT4A 1CICC 4JN1H 2P1YA 3AVEA 4G5ZH 4M43H 1EO7A 5EBLA 1BGXL 3GGWB 5IMMA 2CO6B 5EZJA 1FZMB 2EYRB 2HVKA 1CU4L 3GMRA 1YNLL 1CK0L 4IOIA 2W0LA 1QYGH 2G5BA 4Y2OA 2W91A 3O6FC 3FN0L 3QAZC 4MCZA 3P9LB 4ZUTA 4KK9C 1JZ2A 5DJDA 1OTUD 2UUDK 2IGFL 1RZKH 4RMVA 2XPGA 4LVEA 3SDCB 2I5YL 3WDHA 3BD4A 3EOAB 4LOUD 3OL2A 2J1KA 3LKQB 4ZTPH 3X13B 5KTEL 4N8VB 5B21A 4JJ5A 4PBWD 1MCWW 3BSZH 4XXDB 4TVPE 1Q38A 3FO9B 2EDOA 3P0YL 2NY4D 3OKYA 4YPGA 2HFGH 4P2QA 2YBRB 5DJ2A 4P2OB 1DE4A 2BY3A 1VKXB 3KLAB 3UTQA 3X14A 3IETA 4BFEA 1B0RB 1M7DB 3U7AA 3WLBA 4LLVA 4R90H 4FZEH 4XP5L 4HUWA 3HR6A 4ERSH 1H5BB 5F97E 1PG7H 2YKLL 4LLDB 5E9DE 5T5NF 1N3NA 4YQXH 4URTB 2Q8BL 4JVPA 1KEGH 1KG0B 4BZ1L 3HE7B 5DURD 4JO4H 1BWWA 2FB4H 2VDPH 1AXSA 3L1OH 4JANB 1DQMH 4N0YH 3GHBH 3DYMA 3TIDB 4DVBB 4PGBA 1IGTB 3BPCB 5KSBA 5KBNC 3MRGB 1ZS8B 1JYWA 4F15B 1F2XK 5EO0A 4N9GA 3X11A 1ZGLA 4O9HH 1S9YA 3ZDZE 4UILL 3TV3H 3S36X 5CWSA 3T1FA 1CDUA 4H5SB 5ALBL 2XOTA 3ARSA 3T2NL 1NSNH 3FMGL 3HMXH 4JO2H 3V0VB 5IOPA 1UVQA 2X1PA 3BP4B 4X6EB 1JI1A 3BMWA 4X7FC 3SY0A 2W0FA 1DEEB 4EI5D 1FPTH 4Q7DA 1DBBL 2PR4H 4HUXB 3MRDA 2BVUA 4F7TA 4YC2C 2ZCKL 3VFGH 2CKBL 5FYKD 3K4ZA 3GKWL 5E6IB 3ULVL 2W65A 1FNEA 4FXLA 4V1DB 1FIEA 4JKPL 3WE6B 3QUXB 4MAYD 2WWKT 4RFNB 3UO1H 1NANH 3QYCA 5K59F 4J12A 1JTPA 2NY3B 1MWAH 1SEQH 1XGRA 5T1DH 1ZT4B 1KCRH 3VFTB 1HHJA 4KTYA 1NFDF 5IMMB 4XNQB 5EZJB 2HVKB 3GMRB 1J5OH 1FC2D 3T2OA 5C0FA 2Z8RA 1R3JA 4IOIB 2IPTH 2IG2L 2G5BB 4PJ5E 4MS8C 2DLEA 3S5LG 4MCZB 4ZUTB 1ERNA 2NXZB 2I9LA 5DJDB 1A6VL 1FFNA 4W68A 3A6BL 1VEMA 2XPGB 3BQUA 1IAIM 5TQ0L 5HYFA 4LCYB 1P9MA 4JJ5B 4IDJL 2AGJH 1A7OL 1QBLH 5GGVH 3W0WA 1QVOA 3MUY1 4BZ2H 2MKLC 3OKDA 1DDHA 4YPGB 4P2QB 1YEEH 4ZDHA 5DJ2B 1DE4B 1F6LL 2FO4A 2W07A 1DSFL 4HMCA 2J88H 1FLTX 5H2BA 3TA3D 3UTQB 3X14B 3QQNA 3IETB 4UIKL 1T2QH 3WLBB 4LLVB 1KPRA 4N8VG 4Z18A 4P0DA 4HUWB 2R4RH 3D2UD 1MCKA 1JFQH 3DX9A 1N3NB 2HT2C 4G80A 3X3GH 3CVHL 3TN0C 1Z0NA 1V3MA 3T08A 1PX3A 1AXSB 4LVNC 3WLWC 3P11L 1KTLA 1U8PA 4A2LA 1MCOL 3SKJL 2H32A 4N8CH 5E70A 4PGBB 4X9GA 5KSBB 5MEQA 1K3ZA 4LGPB 2NQCA 4OZ4A 3DYPA 5DVMA 3JVGC 4N9GB 4NQCE 5EO0B 1IGYA 4K3EH 3X11B 1ZGLB 5EU7E 1S9YB 1NCDL 5JW5A 4N5ED 3RPIA 5CWSB 3T1FB 3AMKA 5A2FA 2E9IA 4Z78A 5IOPB 1HDMB 1UVQB 1S9XA 3PWPE 3STZA 3DUSA 1AD9A 2YOCA 5IGXL 3SY0B 2W0FB 4F33A 1HKLL 1AHWA 5EU7C 1OAYL 3MRDB 4F7TB 3SN6N 1D5ZA 3QEQD 1XR9A 5JXAL 1NFIA 4KUCD 5AUMA 2W65B 1FNEB 2JJVA 4B0MM 1IAKA 4KKBD 4QTHA 4S1SH 2X6MA 1A3LH 4TNWK 5EOQL 5L9DL 3I50H 4EIGB 5KANG 1JI2A 4F9PC 5C08E 1XGRB 5HHMD 1KULA 4PJXA 3L3DA 1HHJB 5DYOA 2FZ3A 2XZQL 1UJ3A 2IBZX 4JPKH 4M7LL 5BVJA 3QIUD 3ZKSD 5C0FB 1KN2H 3GM8A 1B0WA 1R3JB 5T1LD 3AREA 4U6VL 4M6ML 4Y4FC 1LP9A 1MF2L 2X4RA 1UWGL 4CKVX 4YHNA 4MXWL 2AV7A 3KVQA 1FFNB 1RAMA 3O3UN 1EGJL 3HMXA 4JFED 5HGAA 4J6RH 1JGEB 2HLFC 1ZMYA 3BQUB 2HH0H 3LZFH 3UTSD 1VFAA 1FNAA 5JXEA 2FECL 1XGYH 3PHQA 2QBWA 4XRCA 3W0WB 1FCGA 1QG3A 1QVOB 5E5UB 2A9NL 3RDTC 2YRPA 2FSEA 3OKDB 1DDHB 4WWKA 2J5LC 4ZDHB 4PPTA 3UPAA 4NUJA 4K71B 1OCWH 2FO4B 1NAMA 3GK8L 5H2BB 4KK5D 4L3AA 4PRHD 4G3YL 1G7HA 1KPRB 1NL0H 4LK4A 3CDFA 3L6FA 1Q9LA 2GJ6E 3JWOH 3DX9B 3GSQA 4OCMC 2VDLH 1Z9OA 2VDKL 4WFGE 4G80B 1DUZB 2CSPA 3LMJL 1IGJA 2FH6A 1FG2A 1YY9D 4JKKA 4Z7OE 4ZFOA 4AQ1B 2C7UA 3VGAC 3QEHA 3U0PA 1KTLB 4G7YL 3QNYA 1F4YH 5CILH 2Z0BA 1LEIA 1U8PB 1T0MA 1W8OA 3PGFL 4WWID 2H32B 3C60A 4R0LA 1U8IA 4MXVE 3QPXL 2NNAA 5MEQB 3DO7A 3C5ZC 5M94B 4PUBL 4OZ4B 3KPRA 4APQA 1IGYB 4OZHE 4NO3A 2FX8H 3RTQA 1C7TA 4NQTA 5JW5B 1Y6MR 1RFDH 5T3ZL 3RPIB 4DKFL 2UWEA 1KB9K 2PXYD 3BRFA 1GGUA 4GBXC 4KQ4L 1U8HA 4Z78B 4HPOL 4YEFA 3STZB 1FGVH 3DUSB 1AD9B 1T89A 2PCPA 4IJ3B 4F33B 5EOTA 1AHWB 1B6UA 3PE9A 5DZLA 3W9DA 1D5ZB 5E1HB 3ARUA 3LEVH 3PDOA 2DYPA 3QG7L 1XR9B 2VXUL 4JRYA 3TYFA 1NFIB 5AUMB 5J12C 4YHYB 2C9AA 2WBJA 1KNOA 1IAKB 4QTHB 4RMRA 5CKAA 4UINH 2ZUWA 2KKQA 2NXYB 2W9LA 3CDCA 5IMLA 1DANU 5I74B 3D85D 4OLVL 5KZCB 4KKNA 4LCWE 4PJXB 3L3DB 1JGVL 5IM7A 2ZUQB 5K9KA 5ADOL 4GQ9H 1RULH 5DYOB 2FZ3B 1UJ3B 1S3KL 5BVJB 1HINH 4C54A 3ZLQC 3AREB 2CRYA 1UM4H 1FN4A 4AL8H 2JKXA 1RIUH 3RQ3A 1N6QH 1LP9B 1YEDA 4NNXA 1XF2B 2CMRH 2X4RB 3VFRA 5C3LD 3D25A 3QUZA 4YHNB 2OYPA 2AV7B 3KXFE 4ELMA 4WCYH 4G8GA 2QQLH 5HGAB 4PJHF 4XP1H 2DQDL 5C86A 1H8OA 3EYOA 3LH2H 4NHUA 1VFAB 5DEGA 5F70A 3BKYL 3PHQB 3I3BA 3OTTA 4XRCB 4OD1L 5IKCA 5F7NC 1U3HC 4MXQD 2OXHA 2FSEB 3VE0A 4WWKB 5FHBL 4X7EC 3B5TA 5GS1A 3LCYA 2BJML 2WWMD 4NUJB 2R2HA 2WIMA 1NAMB 3HC4L 3VXTA 2BRQA 3ARDC 1NLBH 4HKXA 4UT6L 5HY9A 2M2DA 3SGKA 1G7HB 3P4NA 2ID5A 1AE6H 2AW2A 2D2OA 4M1CC 4JAMA 2VLJE 1TITA 1Q9LB 3L6FB 3GSQB 3W2DH 4JFHE 4C83A 2ARJQ 3CDGA 3B9AA 4UT9H 1FG2B 3CMOH 3IB4A 1NBYA 4ZFOB 4XVSL 1VGKA 2C7UB 3ZL4L 2YRZA 3QEHB 4MJID 3U0PB 3QNYB 1NMAL 1LEIB 4TTDD 1G7JA 4D9QE 1T0MB 4PJAB 1QACA 3C60B 3EO1A 3OAUH 1U8IB 4JFYA 1MREL 2ADFH 3MV8D 4YFLF 1V7NH 5FO9A 5L7XL 3DO7B 5DJ6A 4P23D 2IBZY 1N59A 3KPRB 4OF7A 4ETYA 3W11D 4NO3B 3UTPD 5JIHA 3RTQB 2UWEB 1GHFH 4JN1L 4G5ZL 1U8HB 4M43L 4PJFF 1QFWM 3HZKA 1AO7E 3MRCA 4XNUH 5I19H 1TZGH 2YXMA 2LVCA 2PCPB 4NNPH 4YBQC 2W9EH 3GMQA 8FABA 5EOTB 5E8NA 2UVEA 2VLRD 3W9DB 4OUOA 4MNQD 3PDOB 2DYPB 1KYOJ 4OIBA 3TYFB 1URLA 1RZKL 2VRAA 4Y5VA 3MXWL 1NKOA 2WBJB 1KNOB 4PJGA 4P46A 4OF6A 5IMLB 4ZTPL 2WIIA 4KU1A 3BSZL 5L0QB 5DMYA 3VXME 5IM7B 5K9KB 2HFGL 5I76A 3IS1X 4DW2H 4W81A 1BJ1J 1LK3L 1MQKH 4KHXH 1BZ7A 1FN4B 1M1SA 4LMQE 1YEDB 4NNXB 3CX5J 4FZEL 3VCLA 3VFRB 4D9LH 1BF2A 3D25B 3QUZB 4ERSL 4ELMB 1PG7L 4M7LT 4H0IA 2R23A 4I48A 2FYYA 3Q6FA 4G8GB 4YQXL 1OTSD 1KEGL 3EYOB 4NHUB 4S11A 4JO4L 5DEGB 2FB4L 4BFBD 1AC0A 3UAJD 4G7VH 2VDPL 1VPOH 2HMID 1E6JL 5SV4A 5F9DC 3L1OL 4QCIA 1EAJA 1DQML 4N0YL 4YHLH 5IKCB 3GHBL 3UJJH 2IPUK 4MAYA 4NZJA 2F8OA 4NUGH 4HZAA 2R2HB 4CGTA 5JO5A 4EBQH 3VXTB 3N1PC 2D7MA 1NDMA 4HKXB 5HY9B 3G5ZA 3P4NB 4O9HL 3L5XH 4N1HB 4JAMB 5C07B 4WTWA 3TV3L 5BV7H 5BRZD 1HWHB 3WL9B 5F9AC 3T77A 3NVQA 2ZZUT 4HH9A 1NSNL 2XWJA 4JO2L 4QGTA 4TPRH 5D93C 4C83B 8CGTA 3CDGB 5D96C 3NPSB 1QSED 5GRUH 1NBYB 1VGKB 5EFIA 2GJZA 1FPTL 1G7JB 3BGFB 3PWJA 1VA9A 5E03A 2E8YA 2DLFH 2WAHA 3EO1B 3VFGL 5ACZA 4JFYB 4RAUA 3DRTB 3WV0A 2YD8A 5FO9B 1D5MA 3IDMA 5DJ6B 2DKSA 1N59B 1JRHI 3TPKA 2NY4B 1UACL 4UNVA 2JJSC 2EEDA 3UO1L 4Q97A 1A7PH 4Q6IA 3QI9C 1MWAL 5T1DL 1JTOA 1KCRL 3TA3A 4FFZH 3HZKB 3MRCB 4JM2D 1WIUA 4MD4A 5EIVA 3HZYA 4MCYA 4NZTL 1J5OL 5DO2D 3D2UA 1JF6A 8FABB 4ODSH 2IPTL 2XIDA 1CFNA 5E8NB 2JJWA 3UYPA 3CC5A 1EHLH 5DURB 3MLZH 3WYRA 1N4XH 1GAFL 2YXFA 4I4WA 1T7XA 5EU6E 2LU7A 4Y5VB 3U30C 4KFZC 2B8OT 5IBLD 4PJGB 1WF5A 4P46B 1HSAA 4CU6A 2I27N 2WIIB 4FG6C 4OZFA 1W2KT 2AGJL 3O45A 1QBLL 2YD3A 2DM2A 5HHQA 1H3VA 4OJFH 4BZ2L 5C70A 3RWDA 4K94H 1YEEL 5I76B 1A02N 4UTBH 1UZ6E 2DIAA 4ZODA 2MKWA 1NBQA 1OARH 4ZUSA 2J88L 1BZ7B 43C9A 1T2QL 3TVMC 1MFBH 5I1DA 3VCLB 2H26A 2X5PA 2R4RL 1JFQL 1OVZA 4HFUH 2VDOH 2DTML 5FYJH 2R23B 4I48B 2FYYB 5FECA 4KZEH 3Q6FB 3X3GL 2VO5A 1G0DA 3WS6A 4O5LL 3EDJA 2HTKD 4CDGC 2KL6A 3QEQA 4HUKB 4YHMH 1CFBA 3DXAD 1TJGL 4QCIB 4JEGB 5I73C 2K7PA 3NN8A 3ARXA 3CFJA 4MAYB 1D9KD 4N8CL 4LIQE 2E7LC 4LNVA 5JO5B 5I2IA 4D3CH 1NDMB 2W9DH 1FYTE 5TE4H 3G5ZB 4K3EL 5JQHC 3ARGD 3VXSE 5D5MA 1ONQA 4WHTA 3KWWA 5F7MC 4XB7A 1UKTA 3T77B 3QIUA 4LGRB 1H8NA 4HH9B 3LHPH 5GS2H 5T1LA 2XWJB 2B4CC 1JWMA 1BD2E 3WJLC 4R97C 3MRNA 5EFIB 2GJZB 3IU3A 3WIIH 4JFEA 1BAFH 1TQBB 3PWJB 3NFSH 2ATKA 4PS4H 3UTSA 4RAUB 5ACZB 4WVRA 1D5MB 3IDMB 5KW9L 4HIXH 4S1SL 4UQ2A 1A3LL 2C4FT 3I50L 3NZ8A 3MCG1 3LOWA 2OTUA 3BKJH 2EH8L 4Q6IB 3TA3B 4PRHA 1EMTH 2KUTA 3QUMH 1QHPA 4MD4B 3HZYB 4JPKL 4GRMA 1S78C 4MCYB 4XWOD 2O5YH 4LPWA 1KN2L 3D2UB 3EYSH 1KSRA 1FL3A 1CFNB 4BUGA 4EVNA 4OTXH 4JFQA 4WI5A 4OFYD 4PLKC 2DOCA 3CC5B 1REIA 4I4WB 1IEAA 4K23H 1NJ9A 5CZVH 1DN2A 1MCPH 4J6RL 2ADGA 4KJPD 1HK6A 1GCFA 5I1EH 1E6OH 1HSAB 2HH0L 3LZFL 4H25A 1WFTA 3CK0L 1GIGH 1Y6NR 2DDQH 4MSWA 4M5ZH 1Y0LA 4OZFB 4MA1B 4KK6C 3O45B 3D0VA 5FAAA 1LE9A 5HHQB 3RWDB 1VHPA 3ISWA 2W38A 5IQ7H 3QDGD 2GEEA 5C6PB 2I24N 4EZMA 2PXYA 4MX7A 1GGTA 4IOSD 4MD5A 3TWCH 43C9B 5JW3H 1WAAE 5FA3A 4Z7UF 2EZ0D 5DVKA 1Q72L 1EV2E 5I1DB 1ED3A 5IHUH 5CFHA 1NL0L 2H26B 2R2EA 3PV6A 5GQBA 3JWOL 4ACPA 2VDLL 5FECB 1AR1D 4JZJC 4B53A 2PYED 2VL5A 1J18A 3QEQB 5CILL 1F4YL 5E8EA 5GRYA 3WFEH 3SDYH 3GFUA 4GRWB 2A73A 3NIDF 3NN8B 2EXWC 4KJWC 3CFJB 2PYFA 2EDYA 4S1RH 3QZWA 5KVGH 3D85A 1T04A 5I2IB 5DMGC 5HHMB 1CFVH 3TEUA 4C55A 5D5MB 1ONQB 3DVIA 3KWWB 4WHTB 5IB1A 1F02I 1RFDL 4NQUA 1CZ8H 3QIUB 3BIKA 3FTGA 4HS6A 5T1LB 1LEGA 3INUH 2ITCA 1A1NA 1FGVL 5TH2A 3BWAB 1JWMB 3MRNB 3IU3B 4F15C 1OAZL 4JFEB 4JZNB 4P48A 5E2JA 4PP1C 4PJEA 2AVGA 2ATKB 3I2CH 2NZ9D 3LEVL 3UTSB 4ZAKD 4J1UA 3GRWH 3QDME 4RNRA 2AJSH 4G9FD 2XNAA 3ZKXB 4UINL 4UQ2B 5MHSD 1QO3A 2ARJA 3NZ8B 2VL4A 2N4IA 3G6JF 3ZTNL 4QTIH 2OTUB 1L9NA 4TUKH 5D2LA 5ILTH 2JELH 4PRHB 4XI5D 4GQ9L 1RULL 4KVCH 5A3IC 4GRMB 3NABH 4LF3A 5JNYA 4N68A 4PTTA 5E6IC 2ICWA 1FL3B 1UM4L 4AL8L 5T3XE 1N6QL 1RIUL 4EVNB 5D7JC 4JFQB 2V7HA 2R8SL 2CMRL 4RFNC 5BV7B 1ITBB 1A6UH 4YBHA 2L4OA 1MUJA 4WCYL 1I3GL 1IEAB 4MJIA 2QQLL 4BK5A 1SY6H 1KLGA 2ADGB 4Y16D 4XP1L 4JRXE 1CN4A 3WUWA 4H25B 5K9OA 4UB0H 2X2YA 3MV8A 4MSWB 1QSVA 1Y0LB 1W0YT 1JNHA 3D0VB 2ZJSH 4HSQA 2QL1A 1LE9B 4P23A 3W5NA 2FEEL 2ZSWA 2IAMD 4PV9A 4R4FL 4YHOL 4RGND 4JKMA 4UIMA 4P2QE 4O2EA 2PXYB 1NLBL 4MX7B 4MD5B 5FB8A 3ETBF 5FA3B 1AE6L 4HUNB 4WHCA 3O9WD 1ED3B 4QNPF 2XA3A 3PV6B 4OZFG 1UJTA 1EO5A 5JZ7C 2RR3A 3AFLA 3W2DL 3F7YA 5EUKA 3HC3H 3ZKMC 1OAUH 1ZANH 2VL5B 2VLRA 4L9DA 3RUGF 4HC1A 4POZC 4I8DA 2AQ3A 4FFWC 1GZQA 4MNQA 1L9MA 4M1DL 5E8EB 2A73B 4OZGA 5MEOA 1WWWX 1LO4H 2ADFL 3HFMH 4PJ7E 3QZWB 1V7NL 3D85B 1T04B 3TGXA 2DQFA 3RNKA 5C0NC 4KI1A 4NN6B 2YD7A 4O00A 2VZ3A 3V5KA 4KMQA 3G5XA 3MPCA 4X6CA 4ONFH 2G9HA 2EO9A 5DRNA 5IB1B 1YNTA 4HD9A 2V9QA 3BIKB 1GHFL 5J13C 4HS6B 4M9OA 1LEGB 2ITCB 5I19L 5TH2B 4XP4H 4X5XA 2XTJD 4NNPL 3SBWA 2W9EL 1VERA 4DOHB 3IDNB 2NY6D 4NIKB 4OZIF 4U1MA 2BNQD 2BOBA 4PJEB 3SO3C 4G42A 4ONGL 2E9WA 5SWSE 1P6AB 4J1UB 2Q20A 4NC2B 3ROOA 3LSOA 3C8HA 2VZUA 1F3JA 1CCZA 4RNRB 1MFCH 1HH9A 2XNAB 2XZAH 4NWUH 1QO3B 2ARJB 4KC3B 2XV6B 1IGIH 3B5HA 3LB6C 5D2LB 2VQ1A 5F7LB 3RVWC 1P5VA 4EEEA 1JHTA 5I8OH 3RU8H 4DW2L 2C3GA 2RB8A 4LF3B 5I18H 5BRZA 4PTTB 1EVUA 3THMH 4R8WH 3TCLA 4BKLB 4XPBL 2ICWB 3VRJA 1MQKL 2XXCB 1RZFH 4KHXL 1ZXQA 2V7HB 1IBGH 4Y7MA 3OG4B 2Y07H 4OQ1A 1QSEA 4WRLA 3LV3A 1MUJB 1IC5L 3LKNA 4QEGA 4MJIB 2C4FU 4O2CA 1FQ9C 1KLGB 1RUAH 3MO1A 4ZS7H 3WUWB 3PUCA 5K9OB 4G7VL 3MV8B 3RZCD 1PSKL 3N1GC 1JNHB 3O6KL 3WHE0 1UWEH 4YHLL 4ZXBC 4ZFZA 3EHBD 4P23B 5D70H 4JLRA 3ZTJG 3TP4A 3B6SA 3TO4D 4UIMB 1WCQA 4LVHC 4O2EB 3EYQD 4MDJA 4EBQL 3GRWA 1C16A 5FB8B 3G6JA 3OG6B 4JM2A 3BQUC 3DJ9A 5EG6C 4R7NB 5BV7L 1YPZE 2Y72A 1P9MC 4PG2A 4XP9H 3F7YB 5EUKB 2P5ED 4GO6B 5JDJA 4HLZH 5IG7A 5D9SA 3DIFA 2VLRB 1B4JH 5SX5K 1GZQB 4XPGH 5GRUL 4MNQB 2XZCH 2A83A 3SEPA 1CDBA 4YAQA 4OZGB 2DLFL 5MEOB 3A0OA 3JTSA 2Q3ZA 2A6IA 2N7AA 2DQFB 1FLRH 2R69H 1SY6A 3RNKB 3RI5K 4KRPC 3WFZA 3V5KB 3G5XB 4X6CB 2G9HB 5DRNB 2A74A 1YNTB 1A7PL 3AAZA 4UAOB 5FO7A 4FFZL 4OV6F 3QPQD 1RUMH 4OSUH 1U0QA 1GRWA 4X5XB 5IF0B 3QZWG 4XVTH 4ODSL 4XTRD 5DJYA 1EAPB 2OLDA 3PWNA 4IS6A 3HZVA 5D6DA 5F7WC 5B4MC 5BO1H 4U1MB 4P4KC 5DF0A 4F80A 2BOBB 5D7KE 3V4VH 5J6HA 4G42B 1EHLL 3MLZL 1N4XL 4OKDA 1BOYA 3ROOB 4QGYA 3LSOB 3DXAA 1F3JB 1AC6A 4YX2H 1HH9B 4KUZL 1BLNA 1D9KA 4S2SA