3MVEA

Crystal structure of a novel pyruvate decarboxylase
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
396
structure length
396
Chain Sequence
AKETSALTQYMPTSQSLLDEIKEKNGFSWYRNLRRLQWVWQGVDPIEQEQVLARIASSKHSRTDEQWLDTVMGYHSGNWAYEWTRLGMEHQKRAGEMTNEAASEALFSASLCYSIAGYPHLKSDNLAIQAQVLANSAYLEAAKKSKYIIKQLEIPFEKGKITAHLHLTNTDKPHPVVIVSAGLDSLQTDMWRLFRDHLAKHDIAMLTVDMPSVGYSSKYPLTEDYSRLHQAVLNELFSIPYVDHHRVGLIGFRFGGNAMVRLSFLEQEKIKACVILGAPIHDIFASPQKLQQMPKMYLDVLASRLGKSVVDIYSLSGQMAAWSLKVQGFLSSRKTKVPILAMSLEGDPVSPYSDNQMVAFFSTYGKAKKISSKTITQGYEQSLDLAIKWLEDELLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title FrsA functions as a cofactor-independent decarboxylase to control metabolic flux.
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Lyase
molecule keywords UPF0255 protein VV1_0328
total genus 143
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06500 DUF1100 Alpha/beta hydrolase of unknown function (DUF1100)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3mveA00
2OXEA 4BP8A 1MAAA 1E5TA 4QDOA 4BTLA 1HKHA 2XLCA 1ZI9A 3PFCA 2PSJA 2WKWA 3C5VA 4W1SA 2WHQA 1A8SA 2VAVA 4J3JA 2QMQA 4Q3LA 3K2IA 3W06A 1ZOIA 2QXTA 3ICVA 1JU4A 2FJ0A 2VJAA 2CB9A 2I03A 5ALSA 1TCBA 1YS1X 3ESAA 2PBLA 4X97A 2O2HA 3ANSA 3KOOA 1OILA 4JH0A 1LLFA 4FFVA 3FOBA 1XZHA 5AKIA 1ACLA 1AX9A 5I9IA 4N8SA 5LIPA 1MX5A 1MU0A 4MQMA 1QIIA 5AICA 2IIVA 2GBCA 3E1GA 4XWGA 3FYUA 4UBMA 4QEKA 1ZJ4A 4F21A 3PICA 1XZGA 1WOMA 4QLAA 4HZGA 1E8DA 2HA7A 4MEAA 1ACJA 2QM0A 3T4UA 3ED1A 1FFDA 3OPMA 4B80A 2GBGA 2AXEA 3LCRA 3I2HA 1IUNA 1EVEA 1QZ3A 2ZSHA 5ALTA 4LKOA 4J0IA 2ZVDA 5ALMA 1R1DA 3CXUA 1U65A 4J7AA 1VE7A 4M0EA 1THGA 4UFOA 3KSRA 1LNSA 1MJ5A 1XZCA 1LPAB 4LXIA 3ZV7A 1RYYA 5JANA 5E4JA 2QS9A 1CUDA 4L0CA 3QPDA 2ROQA 3FLBA 3AIMA 2YXPX 3C6BA 2WFMA 3F98A 3O4HA 3AINA 2PX6A 1EA5A 1KU0A 4B6GA 5AK6A 4J0CA 3VJMA 4KAFA 3DCNA 3STYA 2IX9A 1G66A 1XZMA 1ZD4A 4KAJA 4IH9A 3ZLTA 1CUHA 1XQVA 3H2GA 1GZ7A 5KWJA 3HABA 3P2MA 4TGLA 5SYNA 4UHEA 2XUOA 4Q3KA 1LPNA 4PQEA 2V96A 3JWEA 3WIBA 4ZV9A 5JAHA 4DTCA 3F8SA 2J4FA 4AO7A 4OB8A 3WYDA 1XRRA 2QRUA 5K3EA 2Z5GA 4XIIA 2WTNA 2JIDA 2WHRA 5EHZA 2QTBA 3AJAA 3A6ZA 2YYSA 3C70A 5A2GA 3EIOA 1EX9A 5BWCA 3PE6A 2ZYHA 1TRHA 3I6YA 4H77A 3Q8WA 4W1RA 4DNOA 3G9XA 2VF2A 1DX6A 2XMRA 5ALDA 2G63A 5CT9A 5ALYA 3OOSA 4EY8A 2LIPA 3I2IA 3WKDA 1CUAA 3FLEA 1MT3A 1FFAA 1FFEA 1MO2A 3WK5A 4Y2VA 4G5XA 4X93A 1O6FA 2R8BA 4X85A 3WYNA 1E89A 4AX4A 5JD5A 2Y6UA 4BVJA 2B20A 4OD0A 1F0NA 1JJFA 4DGQA 5AOCA 5DLPA 1JJIA 4FMPA 4CG1A 3HSSA 4CIBA 3DS8A 4L9AA 4EBBA 4WFIA 4B81A 5AKEA 2JGKA 2EDAA 4X3CA 3G0DA 1GPKA 4ZXFA 1EK1A 4CFSA 5AIBA 4K6KA 1RP1A 2UZ0A 4JNCA 5AM4A 4RNCA 3TRDA 4K2AA 4LYDA 2WU4A 4BCDA 5CH3A 1G5FA 3H18A 4LIPD 3H2IA 3IUMA 3AFIA 3S2ZA 4MQLA 3V1LA 1W76A 4UHDA 5AHXA 4ARAA 4K5QA 1VXRA 3I1YA 3FVTA 1P0IA 1IUPA 1I6WA 5ALWA 2AJDA 4BRSA 5ALIA 4DMCA 2J3DA 2PL5A 4Y2PA 1NU8A 3ILSA 3R3UA 1WCYA 5SYMA 2H7YA 2WLSA 4OSEA 2XE4A 3N2ZB 2BFNA 4X95A 4BE9A 4HXGA 1QFSA 4B83A 1FFBA 1CUEA 2HA2A 4N8DA 2G5TA 5FXMA 2XQKA 4FTWA 2C0PA 1CUBA 4H7DA 2FX5A 1E8NA 5ALEA 4GW3A 4U2EA 5AM0A 2ZJ7A 4MYDA 4Y2QA 2VATA 4RE6A 1ZIXA 3WWCA 1DU4A 1XFDA 1LBSA 2WIJA 3FLAA 2O2IA 1GQSA 2GYUA 2QKYA 1F0PA 1XQWA 2PU5A 5LZ8A 2HA3A 2HA4A 1UKCA 3PI6A 2XLBA 2HL6A 1ISPA 2G4LA 2HA0A 2QVBA 4YPVA 4BP9A 1VLQA 1CUWA 3R3YA 3AZOA 5AH0A 3RKSA 2Y6VA 1YAHA 1VXOA 4QA9A 2HHAA 1QGED 3D5EA 3FCXA 1X2EA 1E8MA 3C43A 4CIAA 3FSGD 4UBJA 3FWHA 1PJAA 7YASA 2Z8XA 3STVA 2BUCA 3STXA 4X90A 2PSHA 2WJ3A 4J0KA 5CBKA 1EH5A 3PUIA 4Q05A 2PM8A 1XRMA 3HXKA 4YK7A 3K9BA 4PO3X 2JGFA 4UFPA 1TK3A 2WG1A 2WILA 2OPHA 4Y2XA 4BVLA 2HFKA 2WHPA 4J0JA 5AKKA 1CUYA 4INZA 3S8YA 5IVDA 1B6GA 2R11A 3DL7A 2O7RA 4UFNA 2IITA 1THTA 1EI9A 1VOTA 3WWPA 2JGLA 3D4LA 2WUEA 2GBIA 1XZFA 4HXFB 1DT5A 4ROTA 5LYYA 4CCYA 2NW6A 1SCIA 4X6XA 4KACA 4P92A 1DWPA 4N8EA 5DYWA 1ETHA 1EHYA 5ISMA 2XDWA 4Y2SA 3KWJA 3HEAA 4DLNA 1R9MA 4H7EA 3WK4A 2PSDA 3WA7A 4Y2RA 2HU5A 3WQHA 4FKBA 2PSEA 1SC9A 1QIJA 3OTQA 5HF5A 1D07A 4BZWA 1G4HA 3DLTA 5AKGA 5HFAA 5FRDA 3ESDA 3RK4A 3WWOA 2OCIA 5BWBA 1HLGA 3I2KA 2GZRA 3OM8A 4OU4A 2DSNA 4N5IX 2OLEA 2PSFA 5AM1A 4F60A 2QUAA 2Z3WA 4ZGBA 5FLKA 4B82A 4RGYA 1QLWA 2PPLA 4UBIA 2DQZA 4KEAA 2OGSA 1DWOA 4EHBA 4C01A 1Y7IA 4J0GA 2HM7A 1CLEA 3CCBA 1TCAA 1CUVA 1USWA 5FP0A 2GYVA 2XUPA 1CUUA 4QWMA 1QIKA 3HRHA 1M33A 1GT6A 4W1QA 5LLSA 5BOVA 5DNUA 1CUGA 3LS2A 3F9CA 4QDXA 3BJMA 3L1JA 2ACKA 4XJVA 4QLOA 5T4BA 2XMQA 4HAIA 3BE8A 4BAUA 2BAGA 2XT0A 4NMWA 5ALFA 5EI5A 2ORYA 1A8QA 1EDBA 1IMJA 3KWFA 4G9GA 2PKYX 4TPKA 1F8UA 1MX1A 4QNNA 2FUKA 1C7IA 3I2GA 3UUFA 4J0DA 3U0VA 6YASA 2QXUA 2G5PA 5C7YA 2V9ZA 2CMFA 4DNFA 2J3QA 5LP1A 4LYEA 2Y2UA 1HDEA 4G4GA 5HK9A 4XVCA 1GXSA 3FYUB 2P8SA 2B61A 2WIKA 3GROA 3I6MA 3WL7A 4QE3A 5DJ5A 4G9EA 3MUOA 4F0JA 2XMDA 1EK2A 4NZZA 5ALRA 1ZD2P 3O9VA 4G8CA 5IVIA 4UHBA 1ZGCA 2HDWA 4IHAA 1LPSA 3QH4A 3VKFA 1XRPA 4FBMA 1QO7A 3SX4A 3QBJA 4OUKX 1XLVA 1DT3A 1WB6A 3I28A 3QPCA 3V48A 1CUIA 2ECFA 4MWTA 1F6WA 4YASA 4C88A 2WFLB 3W04A 3PDCA 4X91A 4CG3A 5J3JA 2WU3A 4HTAA 3B5EA 3WKCA 4ETWA 1Q83A 2XUIA 4EA6A 1QTIA 1H2YA 4O08A 5H3HA 2J4CA 5LKAA 4EY7A 4P93A 5EHQA 4GDMA 4PV7A 1W52X 1L7AA 4S0XA 3C6ZA 3C6XA 5ALZA 1QOZA 3H2HA 4FLEA 3G0BA 2QJWA 1CVLA 3DJYA 5C8ZA 3PUHA 1JKMA 4UHHA 4BVKA 4E14A 3AUKA 5EIEA 3R0VA 4CG2A 1BCRA 3QYJA 4Z49A 4PSCA 2XUAA 1ZIYA 4JUIA 3O0DA 1ZD5A 4BRZA 2VA9A 4UPDA 1BROA 3G9UA 4GI1A 1BU8A 1FSSA 4WCVA 5ALLA 3O4IA 1UXOA 5AO9A 3WZMA 4B9EA 5IH7A 1U8EA 1YB6A 1CUXA 3N0TA 2BJHA 1QIGA 1GQRA 1MNAA 3WA6A 1E66A 3FNBA 4DMHA 4AZ0A 4H7KA 4Q82A 4H7HA 4PW0A 3VDXA 3HYSA 5JZBA 3EQ9A 4UBLA 1QIFA 1WPXA 3EQ8A 4FHZA 3YASA 3X3HA 4AB1A 3NWOA 1P0MA 1LBTA 3W9BA 4MYSA 1XZKA 2XUHA 3R3WA 5CRIA 3GZJA 2VAXA 5AM5A 4BB0A 4AQDA 3WI7A 5JAOA 1EVQA 5AM3A 4KE6A 1R3DA 2OQVA 1R9NA 3TEJA 1DTEA 2CKMA 1QO9A 2QR5A 1P0QA 5JYCA 1UKAA 1FFCA 4WY8A 1FJ2A 1DX4A 1MAHA 4G1FA 5AIAA 1J07A 5HF6A 3CCCA 2OAGA 1XQYA 5ALVA 1XLUA 1O6GA 3E4DA 1L7RA 1TCCA 1LPMA 1MNQA 4QZVA 3RARA 2PU7A 5HF8A 2VSQA 5JAPA 3WK9A 2XUJA 2HRQA 5A6VA 2E3JA 1XKLA 4PNZA 1UOOA 3OC0A 4H35A 2PUHA 1XQXA 1H2WA 3D2BA 3HLKA 5CT6A 4LHEA 3DOHA 3G02A 3L1HA 1X70A 2BUBA 3DOIA 1ZJ5A 3IA2A 4G4IA 2BKLA 5CH5A 5CTAA 2XI4A 4UBNA 1CUJA 3IIIA 3A2NA 5LZ2A 2OCGA 2AJCA 3LP5A 1SCQA 4BDSA 3C5WP 2AJBA 3M82A 2EDCA 4WJLA 4IH1A 1LPPA 1BRTA 5HF9A 1GKLA 1W4LA 2D5LA 2O2GA 3IVMA 2GZSA 3NGMA 5KBYA 1H23A 1QJ4A 2WM2A 1BE0A 5D7BA 3D2AA 4BCCA 4DYHA 4OB6A 1K6EA 5DNWA 1YR2A 3NOXA 4CCYB 1UK6A 5AI5A 3BL8A 2CBGA 1VZ2A 1BEEA 3L1IA 3AZPA 4OPMA 5LZ4A 4BDTA 4LXGA 2I3DA 3SC2A 2V98A 3H0CA 4QDTA 3FSGA 4BAZA 1YB7A 1CUSA 4MJ3A 2WJ6A 3H04A 1T4MA 2JBWA 3C6YA 3ANTA 4P08A 5AK5A 1EB8A 3ZWQA 5FKJA 2W22A 3BXPA 5ALQA 1T2NA 2XQIA 3IUQA 3A2MA 5AOBA 4KYVA 2XMSA 1J06A 4KR0A 3E3AA 1UK8A 3QVMA 2DHEA 2XQJA 1XZIA 4JYPA 5D3ZA 1CEXA 4BTVA 1R50A 4G4JA 5FUMA 3OG9A 3D7RA 2WTMA 1CV2A 3R40A 4AN1A 4CI9A 2RGUA 4H0CA 1CFJA 4OB7A 1KU6A 1J1IA 1YASA 4WDRA 4DNQA 2H7CA 3WJ1A 2X5XA 4FNGA 3GA7A 2ZYRA 4MEBA 4RPCA 4X92A 3TGLA 1VA5A 4IH4A 2Q0XA 4B0OA 1ZICA 4DIUA 4U2CA 3BDVA 3FYTA 3H1BA 4YX9A 1CQZA 4K6HA 4ZWNA 1N5MA 4DM7A 1BS9A 5CT4A 2Y1KA 1JMKC 2DFPA 3WWEA 3V1KA 3GBSA 1EDEA 5JATA 1JFRA 3VVLA 1YA4A 1N1MA 5IKXA 2WIGA 4WFKA 4BYMA 2CJPA 3CN7A 3Q0TA 3DKKA 1CUCA 3G0CA 1DINA 1WHTA 1QIMA 3ZLVA 1MX9A 4BC0A 5D6OA 4X00A 3O95A 4E11A 3F96A 1AURA 5YASA 3RM3A 2VT7A 3KXPA 3EF3A 3G9TA 4AN0A 4FBLA 4EY5A 5LZ5A 2B9VA 3AIOA 2WUGA 2VT6A 2JGJA 3ZLUA 1AKNA 5ALGA 5HCUA 4I4CA 1JU3A 1XZDA 4GWLA 1MTZA 1ZI8A 2WJ4A 3AILA 3QM1A 1Y7HA 2B4KA 3H19A 1HQDA 3AIKA 4PSDA 1GGVA 4BATA 1YA8A 2QJRA 3IUNA 5JIBA 3G7NA 1YAJA 1ODCA 5A7GA 2X76A 1VZ3A 3O4GA 1UWCA 5E4TA 2VQ6A 5JASA 1BN6A 1JJBA 5JD4A 3WKEA 2ACEA 5C81A 2DCMA 2I78A 2WUFA 2XUGA 5E4YA 3GFFA 1SFRA 1XRLA 4Q3OA 1BN7A 3VISA 1XROA 3G8YA 3STUA 1A88A 2DQYA 2OGZA 3E0XA 1LZLA 4UBKA 3PF8A 2CZQA 3IB3A 4Q1VA 3R3XA 4X94A 1L7QA 1R88A 3LLCA 4ITVA 4WY5A 4Y7DA 5A62A 1W75A 2BGRA 1OXMA 3RLIA 3WWDA 4GLBA 1ORVA 2ES4A 2V97A 2VTVA 3TJMA 3IURA 2HA6A 4Y2YA 3HZOA 2W6CX 3V1NA 4ZI5A 2VJCA 4WDQA 1ODTC 1W6RA 2JF0A 3SK0A 4UHCA 5JZSA 4A23A 4X6UA 2DR0A 2JGIA 1WHSA 2C5GA 1LPBB 1XZEA 2ZSIA 3WL6A 3C87A 2BGNA 4ZRDA 2C7BA 4LXHA 5AI8A 4UHFA 5K3BA 4PSUA 1CUZA 2OAEA 4J0HA 4C4YA 5FOQA 1WB5A 2HFJA 2ONCA 3HC7A 3A2LA 5CT8A 1QTRA 1J2EA 5HKBA 3DEAA 4QDZA 4IO0A 2BCEA 3BWXA 1UK7A 5AM2A 3ZPXA 2RONA 3T52A 5ALNA 2QT9A 1JMYA 2OCLA 3R3VA 2JEYA 4C6HA 5ALPA 4H7IA 4AZ3A 3JYHA 3WZLA 2C0QA 4H7JA 4ZV7A 1IZ8A 5IVKA 5E2IA 1B41A 5T4FA 2ZYSA 1IVYA 5CT5A 4U2FA 5AKLA 1EXWA 1AC5A 5HQ3A 4UBOA 2HU7A 1UFOA 4A16A 1TQHA 3F97A 4DSZA 5HKAA 1KEZA 2OCKA 1WPRA 5AI6A 2I3ZA 1AGYA 3G0IA 5AOAA 3I1IA 2OGTA 1BCSA 5BV7A 1UKBA 4Q34A 3DYVA 4QWWA 1Q84A 4FWBA 1AQLA 4EB0A 3AZQA 4EY6A 5FPPA 5KREA 1QIDA 5JAUA 1HL7A 3OURA 4M0MA 4FNMA 4ZREA 5EGNA 1NX9A 4K6GA 1XRNA 3W9UA 3ICWA 1XKTA 1PFQA 2JGEA 1S8OA 4E46A 5CXXA 1VA4A 3G9ZA 4BBZA 4G8BA 1DWQA 4I3FA 5CURA 5DYTA 1YS2X 3NUZA 5AI0A 3V1MA 1Z68A 1K63A 5A7HA 1W1IA 4P9NA 5AKJA 1GPNA 3FBWA 3DNMA 4QDUA 2QOEA 1ODSA 2RHTA 4GHWA 1ZD3A 4V2IA 3IUJA 5CXUA 3D0KA 5FPQA 4FDMA 5ALUA 2QUBA 1IUOA 2XUDA 4J03A 3STWA 5A71A 4M0FA 5K3FA 3V9AA 1ZGBA 4GBGA 1EB9A 5EIAA 2WIDA 1SCKA 2ZJ6A 4B0PA 3CN9A 3W05A 2WFZA 1AUOA 5AKHA 3K6KA 3QMMA 3WKAA 4F5ZA 5DNVA 5I7UA 5LZ9A 1IZ7A 3A70A 2XB6A 4BE4A 1UOQA 5K3AA 1U2EA 4KRYA 3DYIA 2WIFA 4RE5A 4I19A 2JEZA 3F67A 3WMRA 3EQ7A 1N5RA 4HXEB 2Y2VA 5DWDA 1CRLA 5JALA 5CH8A 3WKBA 4C4XA 2WG2A 5ALJA 2RAUA 1OCEA 4BC1A 2PUJA 4NS4A 2D0DA 2XQGA 4AO8A 4EY4A 1H2XA 3QITA 5HK8A 2HADA 3JW8A 4W9RA 3SWWA 4EUSA 4Y2JA 2WSLA 3U1TA 1QE3A 4B7ZA 5HFNA 1GPLA 5AKYA 1DQZA 3GUUA 3I2JA 5D3KA 4C87A 2DHDA 3IULA 4C4ZA 5C8XA 2XUFA 4WFJA 5EHNA 1LPOA 1PV1A 1UT6A 4KRXA 2WUDA 4BAGA 3R41A 3BF8A 3MVEA 5ALXA 4BCBA 2Z3ZA 3QPAA 2ZJFA 3D3NA 3HI4A 2GYWA 3HJUA 3FAKA 4L72A 1VJ5A 3O4JA 4KE9A 5K3DA 4JYMA 3VJLA 2WG0A 3C8HA 4FLMA 4H7FA 5AK4A 4N5HX 5HZGA 1Q0ZA 4IQ4A 2K2QB 4ARBA 2C5FA 2H7XA 5ESRA 2XQFA 5CMLA 3QMWA 5AI9A 4C89A 4B9AA 5LKRA 4BZZA 1SOMA 2OQIA 2XMZA 4GEGA 4G8DA 4FOLA 3R3ZA 1CIJA 3KDAA 3VXKA 5K3CA 2CEKA 1H2ZA 4XX1A 3DDUA 2WHPB 4U2DA 1NU6A 1MPXA 1AMNA 5ALOA 3HACA 1K4YA 4GXNA 1HBJA 3MGAA 3C8DA 5AI4A 1GKKA 1MN6A 2PVSA 1X2BA 3WL8A 4AXBA 1Q0RA 4U2BA 4Y9SA 5DTJA 4OYLA 1ZI6A 4H18A 5JADA 2XUQA 2FJPA 4KE8A 1RWQA 4OU5A 4OYYA 3DL4A 4PF1A 3VJKA 1UOPA 2XUKA 4B85A 1CR6A 5IVHA 3M3DA 2HIHA 2WQZA 3H2KA 1XZLA 5DTIA 1N8SA 1LZKA 1C4XA 1EDDA 3LIPA 5CW2A 5EHXA 3C45A 1XRQA 4DMKA 2RI6A 5A7FA 2OG1A 1VE6A 4Y2TA 4X7BA 2YH2A 1VKHA 5DYYA 1A8UA 1XZBA 1QIEA 4KJXA 4GECA 4DNPA 3DQZA 2WFLA 1H22A 1R4ZA 2RIPA 3M83A 1CUFA 4HS9A 5JD6A 2DHCA 5ALKA 1DQYA 3QMVA 5T4EA 3VVMA 2EEPA 2ZYIA 3H1AA 5AP9A 3PF9A 4HVTA 4TVKA 2HRRA 1C7JA 3STTA 1CQWA 4HRYA 4AMYA 3EBLA 4A5SA 4B84A 1WB4A 2X8BA 1A7UA 4DSAA 3WK8A 3ZI7A 4W1PA 3ESBA 3FYUC 3PFBA 4EZIA 2BUAA 3I2FA 1JT2A 1UK9A 3LIIA 2YASA 5KWIA 2VJDA 1QFMA 5ALHA 3UMJA 4FLFA 1XLWA 2JGMA 4UUQA 4MWSA 3BIXA 3W2TA 1TIBA 4OCZA 4FFWA 3WJ2A 4KE7A 1U4NA 4X71A 4L3WA 3FVRA 1G42A 4D9JA 3WL5A 4HRXA 2VJBA 3O9MA 5AKXA 1XZJA 2VEOA 3D59A 4AMZA 3FCYA 3BF7A 4W63A 2XMCA 1UZAA 5FDFA 4KAAA 4AO6A 1XZAA 1YSCA 2HA5A 2QZPA 3IDAA 2H9YA 3H2JA 3KD2A 5I8PA 1TAHA 3WIOA 1E3QA 1ORWA 5T4HA 3H17A 3G0GA 4CCWA 3WK6A 5JZ9A 5EIHA 2H1IA 3IBTA 1HPLA 3WK7A 3B12A 5JARA 3DKRA 1WM1A 1YCDA 1K5PA 5FV4A 2AJLI 3BJRA 3I6ZA 3B3QA 5K3FB 3MUNA 5K5EA 4MXDA 1TKRA 4NVRA 5C8VA 2GBFA 1BEZA 4JEIA 2AJ8A 5EFZA 3D2CA 2RHWA 1JI3A 3DD5A 1EINA 2C58A 3UUEA 1AZWA 5HQ3B 1QIHA 2XMGA 4X6YA 4DMFA 5AKZA 2XMBA 3M81A 3GELA 2CUTA 1LGYA 5LZ7A 1K8QA 4Y2UA 5AK3A 2O7VA 1QONA 5F4ZA 3BIWA 3QZUA 1Y37A 3BDIA 1P0PA 3ESCA 3WLAA 2C4HA 2Z8ZA 5AJHA 1CPYA 2HU8A 4E15A 4U2GA
chains in the Genus database with same CATH superfamily
3C3BA 3A3PA 3LOQA 4J76A 1QHHB 2OXEA 1RIIA 3NDJA 2ZSUA 3VM6A 3C14C 5AKHA 1BGXT 3E53A 4E5YA 2ZRPA 3IUSA 1RACA 3JVVA 3LQ2A 1EFPA 3ZGNA 4K6CA 2FY8A 2PSJA 3C5VA 1YK0A 4W1SA 3H3JA 2B8JA 1PL8A 5KTKA 1P7ZA 3REQB 3E2PA 4DMUB 1EFCA 1NXWA 1U8XX 1DPGA 1ZUNA 3HTXA 2REQB 2C7VA 2D13A 2WWRA 3KQOA 3VVCA 4HRVA 3ORYA 1ZOIA 5TJ9A 5KYXB 3GLHA 1G5PA 1KFCB 2ZW9A 5I8WA 2ZJZA 3OC6A 5DOZA 4A8JB 3QPWA 4CMEC 1HORA 1E9BA 2HGSA 3EG9B 1UBJS 3LP8A 1SXIA 2VP3A 2VJAA 1PFWA 2Z30A 3Q7TA 2I03A 1GSIA 3PJDA 2G82A 4K9SA 4Y6LA 5FTWA 4CL8A 4CTKA 1JDZA 3R5XA 3CTPA 4ODIA 3RU2A 1ULBA 1VP3A 5C5EA 3BGDA 2ZBQA 2XITA 3BSSA 3Q2KA 4RO0A 1JPJA 4IIYA 3QGMA 3MGGA 1SY7A 2JI7A 4CL3A 3MAAC 3L07A 4O1IA 2O2HA 4PS0A 1O9HA 3DTVD 3FW1A 3IUBA 1YZQA 4MVJD 4YREA 5FB3A 4BVFA 4M38A 3JQBC 3JCZA 4JH0A 1ZG3A 3EA0A 4R7GA 5FWXA 1CVIA 1Z17A 3P9IA 4E4TA 4QPPA 4RMNA 5IN5A 2IWHA 3ZIAD 4B8YA 3FWZA 4BFWA 1T25A 3S2SA 2F4VB 2XTNA 3QX7A 1DBRA 1XZHA 5AKIA 1DBSA 1T15A 3FYCA 2DQKA 4D8YA 3BFVA 2Z6VA 3ROXA 4N8SA 1GT91 5L6MB 1MO4A 2NSLA 1MJHA 4IGAA 1WZNA 1MO3A 3GLVA 5AICA 4AIIA 2O48X 1USVA 2IIVA 1V3UA 4B6JA 4DPLA 5B53A 4DWJA 2WKPA 5BOSB 2VPIA 4JDPA 1OWPA 1NPYA 3L06A 1W5EA 5UKDA 1ESCA 1U0GA 3VZSA 2H2GA 4KXWA 1JPVA 2QTCA 4H17A 1XZGA 2EYQA 2IPMA 2JLBA 3FNRA 3SBXA 1EGAA 2VUUA 3T4UA 2QM0A 1WZEA 3SLRA 4GMXA 5KOYA 3RRNA 4KLAA 4CRWB 3C24A 1VLVA 1KZ6A 4PYKA 1D4OA 4OGFA 1LQUA 4DTIA 1EFLA 3OQ1A 4MWZA 4B80A 1M2EA 5A4DA 1L7DA 1YCHA 2MMGA 3JATB 3LA6A 4NF2A 2FLVA 3RSSA 4DIBA 1BVHA 1USIA 4F45A 4OLAA 2QTHA 1Z25A 4RA9B 1OTYA 2BKAA 4AG6A 2BP7B 2QG4A 3BZWA 3K1JA 4KODA 2H08A 2H7VA 3ZH2A 4UU7A 3SXUB 4GE0A 3Q15C 4PR3A 1IUNA 4DQ0A 2BHRA 1M66A 1EVEA 1TO2E 2FKAA 3C3XA 4G4SO 5TPZD 1KDTA 2FHSA 3P9CA 2XXBA 3JAKA 3KJIA 3WDLA 4B6OA 1PCXA 5DHSA 2QGZA 1SR8A 4YPFA 2NO1A 4BFSA 3W7AA 3ELYA 2QUHA 4KIJA 4M1KA 3BRCA 2XKKA 4MPRA 5ALMA 4X8OA 4YMUA 4QYIA 4IXTA 3A7DA 3W2FA 2OV4A 2XDQA 2YINC 1MUUA 4L6CA 5GPBA 4I7EA 1V7CA 2L17A 4EHIA 1D5CA 1QO0A 3ZHQA 4C06A 1YUBA 3W5DA 4Z5XA 3DMTA 1DXHA 1ECCA 1S7CA 3RJ9A 1LPAB 3WHPA 5CVJA 2PZGA 4Z99A 4OSOA 5DEIA 5JWRA 4IP0A 4ZVSA 3R8FA 1M34E 4U8HA 3H1GA 2OESA 4OGKA 3H5VA 3GJXC 3B1YA 5GY7A 4CVNA 5JANA 1Q44A 2MSWA 3P9XA 4TZKA 4J3NA 3S2UA 4OJKA 4AD8A 1BOFA 4TT3A 3P0RA 1JTFA 3SZMA 4OJMX 1QU3A 1WQ3A 3COPA 3QPDA 3QYFA 3EGWA 1R0CA 4LVUA 5AYVA 3UK6A 3AIMA 2YXPX 4D82A 4ICIA 1U99A 1GO2A 2LUOA 3U3XA 2WFMA 5CA1B 2PKQP 2YVQA 3AI1A 1X42A 2BBSA 4PLVA 3QX9A 3RU9A 4CMGA 4EG7A 1RC1A 3MMZA 3TIXB 4FK8A 1U94A 1II0A 4P7KA 4DKJA 2EAUA 4BVGA 5KYWB 4BO0A 2H59A 1GQQA 3TEFA 2P4UA 3ASVA 4GG1A 5ERXA 2ZUFA 4AJ4A 2J8ZA 9MHTA 1Z39A 1J97A 1C9YA 4WL0A 4F1JA 1U11A 1NXSA 1J8FA 1R5OA 2W00A 3PZRA 4GVXA 1OU0A 1G66A 4TTRA 3STYA 4QATA 3VHLB 1BYIA 4RPGA 1Y7TA 1UM9B 3H1FA 4LOKA 4Q7KA 1O97D 3JY6A 5IC6A 4KAJA 1U0JA 1YJCA 4P82A 1PL7A 2BFBB 1W581 1CETA 1GOTA 2CXXA 2AF3C 2Q5IA 4RL4A 3ZLTA 3ZU4A 5HKOA 5JBIA 3UB2A 4ENQA 4ZZ0A 2DLCX 4N41A 3P2MA 1ZH0A 4XWKA 2D0PB 5CLJA 1Z88A 4IO1A 2XUOA 3EC1A 2RAPA 2YBDA 4PINA 2IV2X 1LPNA 4PQEA 4YMTA 4LBZA 4WZBE 4TUYA 5JAHA 4UNQA 4P80A 1KQGA 5AHRA 3FSJX 2IPXA 2AR9A 2GVZC 2DPLA 4DGSA 4R68A 1EGMB 1CS0A 1DDOA 2DFTA 3DH0A 3SZ3A 3TOSA 4OB8A 5IBCA 2W2OA 4OM8A 4KQGA 5KNBH 3R7LA 3FR7A 2QRUA 1RYEA 1H69A 3OZSA 1A72A 2EX4A 3AIIA 1U9IC 2XVYA 4XIIA 2WTNA 2JIDA 3GYGA 1GEGA 3D6UA 4JLJA 3EXHB 3AUAA 3G5TA 4WUTA 3G2JA 2QTBA 1SJ9A 3AU9A 4F91B 3NHYA 5AJZA 1YRYE 2J08A 4J1QA 3SD7A 4D3DA 3EIOA 3MTDA 4HVLA 1SVIA 2EX1A 2NU6B 4IDGA 2QN3A 5BWCA 1TRKA 3FHOA 1G4AE 5JWOA 3PNYA 4KRGA 3QFSA 3QHQA 3D1JA 4QBGB 2CF5A 2QGNA 4H77A 2GILA 1KDVA 4XJXA 2NU7A 1NJGA 4IGKA 1Q0LA 3IEIA 2GXUA 3WGOA 1UJBA 5C51B 4MP8A 3AHCA 4HC4A 4FMCB 4HGZA 1FXUA 5AVZA 1MEOA 2IU3A 4D9NA 4O2AA 4U8GA 2VF2A 2XMRA 4OLBA 5F7JA 2FOLA 2GF9A 4IG4A 2VFAA 3W6OA 5DMXA 4ZJPA 1MR3F 2G63A 4IMPA 3U7QA 4BLOA 3TL2A 1T26A 2WT9A 3NCHA 3OKAA 2JLZA 5JSKA 4RENA 3TLEA 5IPFA 1X1TA 3WLSA 4EY8A 4Q7JB 1O87A 4Y2GA 1O96B 4QNRA 1E59A 3JQGA 4X1IA 3PUWA 2I4OA 5FCDA 2PUCA 1MJGM 4WN9A 2XGJA 4TKLA 3GGPA 1SVLA 2HWKA 3I9FA 4OHPA 1L1FA 4C1NA 3PR3A 1FSFA 1MO2A 2VP6A 1RM3A 3FCCA 3WK5A 2OC9A 4Y2VA 2WM3A 4TZ6A 1KETA 3FGZA 3IAHA 3SR4A 1KFBB 1BXKA 1O6FA 2R8BA 2X7JA 3MB8A 1LC3A 3NNNA 4KFRA 3AP2A 3KUKA 2BWJA 1FVHA 1YO6A 3RU3A 1NSFA 2JZCA 4BVJA 1N5LA 2OD7A 4LQ4A 1KZ1A 1MB9A 1KEPA 3PQ5A 1QQ7A 3IHTA 1G21A 4LYGA 4W8HA 3TJZA 2H2IA 4HNAB 3HXOA 4PCVA 3V2UA 5DLPA 4BGUA 2PZ8A 1GL6A 2V6IA 1W1UA 1MV5A 4NAVA 4D9HA 2ERXA 1DZ3A 4R6WA 1KDPA 1ST2A 3P2YA 3RYHA 2FEOA 3VAAA 4CG1A 4CIBA 4GPTA 4XD7D 3BWBA 1CVRA 2JCSA 3F74A 3DS8A 3H4MA 1ZWLA 4RV4A 1NF8A 4M8KA 1Z82A 5HCNA 4EBBA 4W9NC 2J09A 2YHIB 2Q3CA 1QF7A 4B81A 1TQ8A 5K8UA 3I04A 5AKEA 2FR8C 2JGKA 1FMFA 4F2DA 5DMHA 1ILEA 4YP9A 2ECQA 2FN4A 4HDAA 5EIBC 2RAVA 4C4SA 2CLOB 2H4FA 1EK1A 4UEOA 1BA2A 3AFNA 3WMEA 2IZ7A 3CJRA 4CFSA 1E9SA 1RWKA 2CL7X 4L8FA 4IJMA 1IM5A 4II3A 2UZ0A 4AL4A 4GP9A 2ZJ1A 3W8NA 2DBZA 3L8GA 3HKDB 3LF1A 4RNCA 3UMGA 5ICCA 2QQ5A 2XHEA 2R8ZA 4LYDA 4P3PA 2WU4A 3JQDA 3N0RA 4CKWB 1UJ5A 5E0KB 4ZDIA 4ZDKA 1PI3A 3A9VA 2QJFA 4I2VA 4HNGA 4LIPD 3IUMA 3OPVA 5P21A 1HYBA 2YRFA 7MDHA 1MQAA 2IXBA 2J5RA 2YOFA 2AZMA 3BMOB 5BOSA 2JLYA 2ZJ8A 1RXUA 4LCEA 1R27A 1NQVA 2GNOA 3ZOKA 2HK7A 1ZMOA 3TB4A 4UHDA 5AHXA 3H6KA 1D6NA 1MXHA 4NULA 1IRXA 1U3TA 4YJ3B 1MAVA 1QK4A 3T5BA 1MDBA 4UUPA 3L2OB 1DSSG 5IYZA 3N6VA 5FWXB 2PN1A 4MWEA 2OO5C 4F7WA 3LD9A 2DJ5A 1PZNA 4HG2A 1D1SA 4LYHA 5ERGB 4DQLA 4F72A 7ABPA 4YCLA 5G1PA 4BRSA 1Z0AA 2H1VA 3KQVA 3PE4A 3HJTA 4HQ6A 5E6SA 5HILA 1CZHA 3RJTA 5JRDS 4C29A 5C3UA 4DMCA 1OFHA 5ADUS 2UZ4A 2ISCA 4C08A 3P0IA 4F3CA 4Q1DA 2GCPA 1D4AA 1YF3A 1T1GA 4D02A 2ORIA 3FFBA 2QR3A 5FA5A 2ZROA 2IVFA 1K9VF 4RELA 4QOHA 5EXPA 2DUUA 5E7IA 1WCYA 4UJ5A 3DMFA 1TC1A 4EGSA 3DKPA 3LM8A 2YWDA 3N8KA 2XE4A 1FDTA 3COSA 3RO7A 5JXWA 2DUMA 2Q3EA 4DARA 1SKBA 4IS2A 3MWFA 2BFNA 3QFTA 5MF6A 3ZWXA 3E7PA 3OFKA 2HB6A 4ENPA 3N74A 1TEVA 1S2NA 4KSBA 5K4AA 4GVLA 4BNTA 5IWCA 3KQUA 3EGVA 4MHOA 2BI7A 2FNAA 2FPIA 3G82C 1I4WA 4YMSA 5B57C 3A4VA 1U8UA 3L18A 1S3SA 3M8KA 3H5NA 3CVOA 3FPLA 4FFDA 4NG5A 2VBCA 4PLZA 2CHQA 3IYLW 1ZZGA 4A6DA 2Y1OA 4BLUA 5J5AA 2XQKA 2XNHA 4CM5A 1N6NA 1S4MA 3SDBA 1CRZA 3UK7A 4JGIA 4FIDA 3GEPA 2VQDA 4FTWA 3SLGA 1E6UA 1XEWY 3EE6A 4BKUA 3G49A 1ZH4A 4MVJF 5JCOC 3L7BA 4LA4A 3RUDA 4B3HA 3MRVA 6CHYA 4NV0A 1KMNA 4F86A 1P1CA 5ALEA 3MRSA 3I9LA 1HRDA 2E9SA 2IYSA 1LS1A 2WKSA 3R6GA 1QGZA 1UXHA 1OLXA 4GW3A 4LGMA 2JRCA 4NATA 4Q9LA 3ZHBA 3QU7A 1P5JA 4IWYA 3EEBA 4Y2QA 2WZDA 3NWBA 2OGUA 4V0QA 2IJGX 2OE2A 4K8RB 4R84A 2XXJA 3E9MA 1DU4A 2V7WA 3IL2A 2VQSA 1ENOA 1S2OA 1XFDA 2EWVA 4JT8A 3DA8A 2WIJA 5FORA 2P5TB 1VFPA 4EPVA 4HPJB 2QRPA 3AW9A 2W6JD 3CLHA 1L5NA 2BZ0A 1GQSA 2HUPA 4QOSA 5J2TB 2NUPA 1F0PA 2H1WA 4L8VA 5L8VA 3NTXA 3AVYA 4AZWA 2FVYA 3D8NA 6REQB 1NURA 5ITSA 3CLKA 1QSGA 2NTJA 2QDXA 4DDKA 1ECPA 2QRVB 1X1AA 1P7VA 3AVTA 4EPXA 3L8DA 1WUHS 4C7JA 2HRCA 4NCJA 3L7DA 5E8JA 4O8CA 4UTVA 1PVDA 3MGBA 4INJA 2PZAA 4CMIA 2X4GA 2HL6A 4O4HA 4PC2A 5JLAA 5IDWA 1YKSA 4Z0NA 4LBVA 4UVGA 4EGAA 1CF9A 4PRYA 4US2R 3FZYA 1S1CA 3DLIA 1Z07A 2X14A 3PSHA 4XIFA 2O3JA 4FSXA 4QXRA 4ZYLA 4G1MB 5LA6B 1KTVA 3L82B 1ENZA 3FMOB 1PJ2A 2GO7A 3HCOA 3RKSA 3CX7A 1R6DA 4HUJA 5L53A 4CIVA 1YAHA 1VXOA 2F9FA 4FP9A 1G4UR 3KQHA 1RBMA 1MW9X 1QGED 3QPVA 4RSHA 3D5EA 2CJFA 2WSBA 2YJTD 3EDOA 4MITA 3UKOA 4PPNA 2JD2A 3MTQA 1E8MA 3VUFA 4YWHA 1VSBA 1F1BA 2MYNA 3ZEAA 2I2DA 2F64A 1KBOA 2PLWA 1PJAA 3PNSA 1VJRA 3G2OA 1M8JA 1TQ2A 3MCTA 4A6PA 1KFEB 2QTRA 2ZI4A 1G21E 1WXXA 3BOSA 3QKUA 2OO3A 1CP3A 1GVNB 3AR3A 5K0JA 2OYRA 2I4TA 4OMDA 3EQ6A 1KPGA 4J0KA 3NAQA 3HV2A 4YCMA 2YXBA 5KINB 3KSMA 1Y9EA 3TTUA 2JFYA 3OIYA 3QFRA 1Q0HA 4HI0E 5I7OA 4MMXB 2Z43A 1YVPA 1LBIA 4BJ5A 3HWWA 5AW7A 1BOOA 2R0QC 2UDPA 2LR0A 4IRUB 4YK7A 2VNSA 2OHOA 4LOLA 2CHGA 3ELBA 2Y8EA 3ZNPA 1EIWA 5JO0A 2FW9A 1ZGZA 3RADC 3WSWA 2PMWB 3U62A 2MSKA 1TFUA 4BN0A 2HPVA 4GYKA 3WRWA 5KDLA 4ZN6A 1UAGA 4OQEA 4HMPA 1EWTA 2XW6A 2WNIA 4MW1A 1J5PA 2VBFA 2JK0A 1XNHA 4X66B 2GPBA 1E5XA 2EKZA 2HFKA 4I55B 2ODPA 3AG6A 3OMLA 3E15A 5H80A 5B1SA 5H82A 2B21A 1WBBA 5JNRA 2P6OA 1L6RA 4YRJA 4J0JA 4C4AA 5C1PA 3VZPA 2A78A 1CDOA 2Z2XA 3U5ZB 5JQWA 3S8MA 3SHWA 4XOUA 1HSZA 2IHYA 3ACDA 3EAGA 2YX1A 4FEGA 3DL7A 4R8LA 1GA4A 1VPVA 2O7RA 1MLDA 1VKRA 3PLRA 1IEWA 3DDHA 3TNDA 2QY9A 2QSYA 2EP5A 3L41A 1OFGA 1THTA 1EMDA 4MKGA 3WWPA 2J9FB 3E61A 1DZIA 5CA0A 4N76A 4TN5A 4NBTA 5BV2P 4OI4A 2OK7A 4M0PA 3T5CA 1QKIA 1VJGA 2VRCD 4JJ4A 4HXFB 2CLKB 5DE3A 3WMGA 4LMPA 3VU1A 1EHIA 4ROTA 3DMGA 4EO9A 2DWPA 1A04A 3FJYA 1JF8A 1ZDMA 4GX5A 1NBWB 2HH9A 1M6VB 2YHUA 1G8KA 4FDTA 4D9KA 1FUIA 1XEWX 4EW2A 1SCIA 1KI6A 1NVFA 2Y66A 2VEDA 4X6XA 4ALNA 2YNMD 3L5OA 4KACA 1EA7A 3AFHA 3MJVA 4KX5A 1GRCA 2W37A 2AW3A 2EP7A 2GEDA 2P11A 1AY0A 3LUKA 1E99A 1XT6A 1TMYA 1OA0A 4WZBA 5J2TA 1ONBA 1IVSA 1LDGA 3NAMA 5TGTA 4IMRA 1T2CA 1NE2A 3GJTA 4JUDX 1NVAA 1NZJA 2B9EA 2I65A 4E6PA 2XDWA 5ISMA 2YVKA 1E7QA 3RVPA 1ZM4A 2C82A 2ZM5A 3WOVA 1F2VA 1TTQB 2HSWA 4G26A 2BHTA 2EKBA 5IJAA 4GKKB 2J5QA 2FW7A 1W0JD 3VFDA 4WVFA 2X1LA 4EJSC 2V3VA 4POAA 1TZJA 5L4SA 5IDVA 5BYAA 1SC9A 4O4IF 2WJWA 4II7A 4RACA 4DIKA 4RPIA 2NU6A 1CQIB 1WZUA 4E0BA 1C1XA 4S1VA 2VK8A 2ZRCA 1NVWQ 1MG0A 1XTKA 1ZESA 3KAJA 3NHKA 4L85A 4LE1A 4DBLC 2C8VA 2BSXA 4U7FA 2LGJA 4GE3A 2OCIA 1IG0A 4EJSB 5BWBA 3EGOA 1HLGA 2FPIB 1MC4A 1F9EA 3GUCA 1K6JA 3TCXB 2CZGA 5BN3A 4MUFA 1OVGA 16PKA 3LW8A 5AWFC 2PUGA 2APJA 3EOAI 2Q49A 3UXHA 4TV8F 1T10A 1FTWA 4CTJA 2GN9A 2OLEA 5AM1A 2Y1CA 1JA1A 3I0NA 2JJ8A 2IEIA 1G8JA 1R5BA 3C4JA 2PRYA 5IARA 3T7EA 1QLWA 1A1VA 3EZXA 3V34A 4D4GA 4MWGA 3LT2A 1UFQA 1Z4OA 1PR5A 2C5EA 3KBOA 5DT2A 3H3XA 4UBIA 4YRZA 4FEYA 2DQZA 3BZUA 2O0HA 3DF7A 3KE9A 4D0GA 5JS2A 4GMGA 4EHBA 4Q3AA 1Q19A 1G17A 1P1KA 2CY0A 3PE3A 3CCBA 2C59A 1JR2A 3QKSB 1CUVA 1JKJA 5DK6A 5B58C 3OETA 1CE8A 2VF7A 2PWPA 3UPTA 3TCKA 5KWEA 3M89A 4XX0B 2O0LA 1QIKA 1UXJA 5EXEA 3UG7A 1Z6QA 3ZHOA 421PA 1VPTA 5LLSA 1XLTC 2FV8A 1TOAA 2HMTA 3EFHA 1YMUA 3GD5A 5HIMA 4DYDA 4LNHA 1Q12A 4RTMA 1KS2A 2HU2A 3PVZA 1S3FA 3TN7A 2GZ2A 3UK1A 5JMTA 1E3WB 1S2IA 5I3ZA 1H8ED 5BMVF 5LXTB 3DHVA 1Z7WA 2HY7A 3BE8A 4HAIA 5GONF 4BAUA 2PY6A 5DX1A 1EK0A 2BAGA 3K1AB 3M3PA 4RM2A 2YC4C 4RFLA 1T9GR 5ALFA 2M6LA 3SBEA 4ME6A 1KE1A 1C3JA 4L78A 5C9ZA 3CZAA 1F1JA 2PNFA 2GPTA 1EDBA 1J24A 1UPBA 2PUAA 3KWFA 4G9GA 1IJEA 3VSAA 2PKYX 1JXOA 1L7PA 1NMZA 1Y3AA 3IUYA 5KQLA 2PE5A 3BXZA 2Q99A 1QV9A 1NLMA 5CXSA 5CHYA 3EVBA 4NAUA 2L42A 2O5EA 1K08A 3H5IA 5LJIA 2WVJA 2VSNA 5BRJA 1IN4A 1JDPA 3PIRA 3P9YA 4OQZA 4FYVA 4J0DA 1U4OA 8AT1A 2ZAGA 1D6SA 3U0VA 1FSGA 2GKGA 1RI1A 3W2EA 2G5PA 3UT5A 1EZ1A 4RV5A 2GX6A 1JHPA 1Y4DE 3MMPA 4Q4HB 4G0VA 1RI5A 2FPGA 1SVOA 2QJTA 2JHPA 2V9ZA 5BSHA 2LZ0A 3SQWA 4N82A 2Z5LA 3L01A 2CMFA 4DG5A 2Q6VA 3QI2A 3HKBA 1OPRA 4G65A 5I9SA 1I5EA 4R9VA 3B2EA 5IJZA 1EVLA 2J3QA 2O2EA 4HNAA 4V39A 1YS7A 3HY4A 2MCFA 3RAGA 3ENWA 2PJUA 1HDEA 5G1OA 5DIZA 1Z6AA 2A9OA 2FRXA 2ZTMA 1UC4B 4G4GA 1E2UA 5HK9A 1SGWA 1SG6A 3KKMA 3JQ9A 4XVCA 4RPKA 1OXKB 2Q3HA 3A4TA 2P8SA 4MCIA 4QPDA 5HMMA 3INTA 1XVVA 4PZAA 3VNUA 1XP5A 3CM0A 3BMNA 1PK7A 2Z2ZA 3GROA 3WL7A 2Q6OA 5DJ5A 3AP1A 3GBPA 1TZMA 3SFZA 1V5FA 4Y1FA 5ALRA 3IHWA 3QELB 4B40A 4DHEA 2PX3A 1ZD2P 1KC3A 1I94B 4QKQA 4GLFA 5E6UB 2D0OB 3U1BA 2A59A 4UHBA 3PXCX 4H31A 3IQWA 4JLWA 4OOFA 3FZEA 1N2EA 1LPSA 2XY4A 4FI3C 4E5UA 2BOVA 5IS2A 3UAGA 4FBMA 4NZ9A 1O95C 3G2LA 3SX4A 521PA 5B1DA 4UU8A 3QKIA 4OX9B 4EGJA 4BFXA 4TKMA 4URUR 4BPRA 3IQEA 5L4LA 3I53A 3DSRA 1CUIA 3EAQA 2G4VA 2GM5A 2GOYA 3EIWA 3LZ6A 4HP8A 3GJ8A 4P3KA 4RXUA 3FB1A 1XDGA 4HAOA 3FOZA 2C57A 4E1VA 3RAFC 2JJ1D 4KPYA 4YV2A 3L43A 2CYAA 3WLNA 7MHTA 3PDCA 2C9MA 4X91A 1KMMA 3EYAA 4RJKA 5JECA 1W8DA 3U44A 3KQPA 1IY2A 1Z5PA 4ERXA 1Z4IA 1KHTA 5GZ6A 4GICA 2XUIA 4ZQIA 4EA6A 3PHJA 2GZDA 1Z08A 4DV2B 1DE0A 1JB1A 2WYHA 3KSZO 1X1RA 3N87A 3NIWA 4J49A 2I87A 5H3HA 3MAJA 2J4CA 1D2NA 3QE9Y 1R0RE 2W70A 3ND9A 4XB1A 3QF7A 4FHEA 5JJIA 4GDMA 3I5UA 1WIWA 4S0XA 3DUWA 2IHUA 3LT4A 3DFZA 4E2ZA 3EVGA 4YDQA 2BW0A 2VNAA 1PBTA 1JPNA 3C3DA 3GCGA 3T7JA 1BFUA 3EFOA 4BQRA 3R4VA 2JVIA 2J6IA 2W11A 1ULAA 3NJ8A 3H2HA 3CA8A 1GXSB 4LVCA 3HADA 2QQEA 4B6PA 2QJWA 3NTVA 4MWDA 4GI7A 4ZK2A 3SJAA 1U5AA 4B3CA 5LVAA 1AE1A 3DJYA 4TMWA 2IPAB 1B6TA 1U9ZA 3P2JA 4XQGA 1ID1A 2IS2A 2NU8A 3TLCA 2DT5A 5COAA 4BQPA 2P0EA 4B3SB 3BB3A 4OY3A 2R4UA 4UHHA 4BVKA 2F59A 2P1DA 5EIEA 4MVJP 4R3WA 5CLHA 5EZ5A 1RPTA 2Y0BA 3LKBA 1NNEA 2MYTA 2UUBB 5A6SA 5FL7A 3VDQA 4XVUA 4JT4A 1Q7GA 4C4OA 1J42A 3LF2A 3ENVA 2WMNB 1JHOA 4HY3A 3MAGA 3TR5A 3MT0A 1LK5A 1EEHA 3QX3A 3K6SB 4PSCA 3BC1A 1KKLA 4FFSA 2V7EA 3ZHSA 8ABPA 2JGRA 3IR6A 4BS9A 7AT1A 3K2EA 1ZIYA 3S1LA 3B38A 1MW8X 4JUIA 1ISFA 2QN8A 1D5WA 2W58A 3JZDA 4MJ7A 2IEYA 5LYJA 1JEQA 4B6QA 3H11A 4BRZA 1QQTA 1PE0A 1LTKA 4MAFA 3EMVA 4UPDA 2V6BA 1FFXB 1ODLA 1BU8A 1FSSA 5LP6F 4D6YA 4K0RA 5ALLA 4UVIA 5IH7A 2XBMA 3EGXB 2JAXA 3KT8A 4ZT4A 2E49A 2WVHA 3KHUA 3EMBA 1YB6A 2DCUA 3FGOA 4Q3DA 1T9CA 1PF7E 2BJHA 3GB9A 3DXXA 2WJZB 2HLHA 3DG9A 4EABA 1E66A 4R7ZA 1S2DA 3FNBA 4IM7A 5T8KC 2C61A 2D8MA 3ET5A 4H7KA 3K09C 1JBEA 3Q7SA 4NIMA 1Y3IA 4AZ0A 3H4VA 1L4GA 2C4MA 4EBFA 1K7CA 1U0SY 3M6MD 4H7HA 2IUEA 5KTSA 2WU0A 3ETLA 4FWTA 1T4GA 5JZBA 5BXQC 2FSVA 4OAPA 2CFIA 3RAEC 2I2FA 2C7GA 3OKCA 3KLOA 2YV3A 3PX2A 4PBTA 3EQ8A 1P4GA 1T43A 5HW0A 1UODA 3SYNA 3ORHA 1ZLXA 2PRSA 1NAHA 1XZKA 1OI3A 2JFQA 4YY3B 1GGMA 1A2KC 1HE1C 3H9QA 3L6RA 3H9CA 1H6AA 4KN6A 2E4ZA 3BWCA 2VAXA 4Z8YA 5E3IA 3URMA 2GFQA 3DP7A 5JV5A 2NSYA 3BIOA 3VSCA 1Y48E 2XF8A 1OYYA 1NUUA 3AYZB 4XUEA 1RPAA 2R2AA 3TEJA 4CF6A 3RHFA 1M72A 4Y18A 5AT1A 1DTEA 2CKMA 2JGDA 1QO9A 4TS3A 4UATA 2K7FA 3RB8A 1J5EB 3Q88A 1NXOA 1E79D 4BLTA 1GCAA 3EOBI 2EJWA 1QE0A 5DNDA 1P2UA 1I6MA 3LGXA 5C31A 1QRSA 1KAQA 4LXYA 4MKFA 4ZAYA 4XYBA 1FJ2A 3FI9A 1D2CA 3U7GA 1DX4A 1Z29A 1P0CA 4QELA 4YCNA 1DUIA 2GGSA 1NMQA 1MAHA 4F11A 1QC5A 4DLKA 2JJ1A 4UTRA 1AZSC 2ZUEA 4J2TA 1H66A 2NM0A 2E4AA 3I45A 4X63A 1JS1X 1KDOA 2VDUE 4UCWA 4AMUA 1XCLA 3PFNA 3UFXA 4F3YA 3EFBA 3G2MA 4BHTA 1Z7GA 1JSRA 2MR6A 2OAGA 1XQYA 1H1DA 2P9FA 3ESQA 2QTVA 2QRMA 4I1IA 2L0XA 3FMIA 1O6GA 3RIEA 1GPAA 1L4HA 3IAAA 3ZU6A 3E4DA 4BXOA 2RI1A 2GEFA 4FQ8A 1V6SA 2L82A 1TCCA 2VOJA 1U8CB 3G7UA 2MINB 3C3CA 3O94A 3MF4A 4HTFB 5SZKB 3DTTA 1CDEA 2C4TA 3TNYA 4HDCA 4A36A 2IYWA 3RARA 1DLIA 1PT7A 4KZKA 4UXJA 5KNCD 4JVLA 4LTNA 3OPYI 4J43A 4M99A 4N6OA 1JAXA 3AY6A 1L5GB 3TGWA 3EODA 5JNLA 5A6VA 3CVYA 1RJ9B 1OKKA 2E3JA 2RJ3A 1XKLA 2VDWB 5AHKA 2XJ4A 1K89A 1UC5B 2ST1A 1UOOA 3OC0A 1N0WA 3ZIUA 1KR2A 3OEHA 4LWOA 1XQXA 2G1UA 3QE4A 3T7IA 4YAIA 3ZKWA 1TYEB 1V5GA 1QTNA 2WINI 2HRBA 1SHZA 3AR5A 4RGVA 5BPFA 3GAAA 2P27A 9LDTA 4R9UC 1B0UA 4NBLA 2VSXA 3LFUA 4EG6A 2ZE7A 5AD1A 4F3TA 5KEIA 3DTYA 3J81A 4J29A 1G291 2PRIA 4G4IA 4D1YA 4QBKA 2BKLA 2E5LB 4KDEA 4KFTA 1W85B 3UANA 4JC5A 3ZW9A 2P9YA 2COEA 3SEQA 4U7DA 4M86A 4NNJA 4BO1A 2PAFA 3HFJA 1UAAA 1E64A 1Q1GA 2PHZA 1WZIA 2WJVA 4GUDA 4LC9A 2WIBA 2J7KA 3IVXA 1LU9A 1JDNA 5HG0A 4DIFA 1FTYA 2HJGA 4EDFA 1FFSA 4H7PA 1PDVA 1PK9A 1EG7A 1M8PA 3A3OA 3NORA 4N5MA 4WZAA 5TIIA 1V45E 3R7AA 2B4YA 4C14A 4JI5B 4AJIA 1NI4B 1WV0A 1XDUA 3CF4A 3N7UA 4RWEA 3TZBA 4D46A 1GZSA 2P7HA 4P84A 3FF1A 5B7QA 3M82A 4HH3C 1BG6A 2ANCA 4AJOA 3ANXA 5IKPA 2WTXA 1JDSA 4YN3A 4ZAVA 3GAZA 5KNBA 1M2OA 2Z8YM 5HF9A 1PGOA 2D5LA 2O2GA 1FRFS 1R16A 2GZSA 2XKBA 1WDWB 1I4LD 3F4BA 3HUTA 3MG9A 4ND6A 4G1UC 3WP1B 1C4KA 2QROA 3HDHA 3LC0A 2VDNB 1CQJA 5B5SA 1H23A 4IDOA 1SK8A 5KYYA 4KB5A 2HMUA 5C1BA 5C34B 1W49A 3MOGA 5DM2A 5BNTA 1BE0A 4GWGA 4XCVA 3UV7A 2XD9A 4AW9A 5EYPA 4EB0A 4XWAA 3QF4B 5IAGA 1YHYA 1RRGA 2HO4A 3QVGB 3SIXA 3LYUA 5IAEA 4D9EA 1VLJA 2PMEA 1K6EA 1V1RB 1W9HA 3BGVA 1YB1A 4JQCA 4CI0B 1MF7A 3NOXA 4KJZA 3CT6A 1NWCA 2FSIA 5C35A 5KDDA 1RJFA 3QUCA 4OXNA 4IEIA 4PANA 2VZ8A 1D1TA 3CB2A 4XM2A 5TMBA 3ZV4A 3ZK8A 3ZYCA 4DIMA 4BKRA 1DIHA 5EJ5A 2GO1A 3JQ7B 3W5BA 4NZPA 2X15A 2FF7A 4TMTA 2ETVA 3SQOA 4AT1A 2C7PA 4LXGA 1NC1A 1YQWA 4RHTA 3WLJA 1I2BA 1DIBA 1NBMD 1Y1RA 3EK2A 2QRVA 4BO4A 1XKQA 4QSMA 4BAZA 3CSDA 4MS1B 4NSNA 2PMKA 4DV5B 2EC5A 3BWMA 3GJ7A 1CUSA 3GI1A 2GZMA 4C4PA 2B3TA 3KB2A 2WJ6A 1F12A 1VKOA 3RRFA 4HWRA 4BIMA 1MOSA 1T4MA 2GVNA 2R6JA 2YXNA 4TYMA 1DKUA 2WZQA 2C97A 5EWMB 1N2BA 1OYVA 4EPTA 2PK3A 3DMPA 1UFRA 4IJQA 3Q0EA 4GBMA 4IOJA 4LBWA 4MR9A 2XVZA 3C6YA 3ANTA 4E4RA 3OQIB 2C7OA 2G9VA 2B6HA 4JWKA 1RHMA 5JCZA 5FKJA 5LD2B 2BFOA 2WDPA 4MUAA 1FQWA 1Z6XA 1EUDA 1A9SA 1T2NA 1VLHA 3IUQA 2EF1A 2JARA 2OC4A 1YFJA 4N6GA 1CJMA 5AOBA 3UMRA 1L2TA 3EOZA 2JZOA 4HVAA 3HXMA 1MDFA 3IQHX 5TJHA 5BMOA 1NW5A 1JR4A 1U7OA 1J06A 2WYOA 3LBAA 4Q00A 4IHJA 4CU2A 1EUDB 2HD4A 3LZCA 2GH1A 3E22B 3F6YA 1TQ4A 2IYPA 5JTTA 4MDHA 1ZSYA 2CV1A 1VL8A 2DHEA 1KOGA 2OHJA 2AFRA 4JYPA 2OYCA 5KNDH 3K9CA 5TRTA 4IRXA 2OSVA 5BQFA 2HN9A 1Z37A 4J16C 3A3YA 4WFQA 4IVQA 3SZUA 1CEXA 5HFJA 4CT0A 1Y4AE 2Q3JA 3BK7A 3SMQA 3AL2A 4I50A 4TLMB 3M6WA 1Z8NA 1PJRA 1YZNA 7REQA 4BQQA 5FUMA 4YI3A 2E5FA 3FKJA 3LMKA 7GPBA 1P77A 3VX4A 4D9MA 3H4TA 4FEAA 1E6KA 1A9RA 2GWHA 3OLXA 1Q22A 3RUIA 3TAHA 3U13A 2RGUA 3VR4A 4CI9A 3OP4A 4Z3OA 4KFCA 2A9PA 2BJVA 4IMIB 4BJ1A 4ASUD 4R0NA 3S4YA 1DJOA 1KU6A 3D3KA 1C0EA 3LL4A 1IHDA 2V4MA 1J1IA 1I2AA 3OZUA 4RD2A 2FUEA 4UHKA 3DWIA 5CPFA 4CL0A 5IF3A 5L4NA 2CYBA 3I9OA 4JL6A 3P9NA 4J94A 4FNGA 2YYAA 3KWMA 1J0DA 3C7AA 3PFHA 1WB9A 3U7EB 3R8XA 5FUYA 2OXTA 4MEBA 4RPCA 4JLPA 1K06A 1EXMA 3KOYA 5IJ9B 4Q9DA 1PGJA 1LA2A 1C8LA 3M3HA 3L46A 4RADA 4IH4A 2Q0XA 5CEJA 1ZN8A 5IT5A 2M32A 4MQUA 3UJPA 4MV3A 4B0OA 4UREA 4MV7A 2KJQA 2X1VA 3LYHA 2FPPB 3OO0A 4FQ7A 2RHOA 1O96A 3BCSA 3PXEA 3BTSA 5KSYA 3MQFA 1FDRA 4FOOA 1SCNE 3OOHA 5K1ZA 1BS9A 4DAEA 3TECE 1WZ2A 3HDGA 1H0KA 3GARA 1FX0B 2QW0X 2VH2A 1Z4QA 3E22A 3MJTA 3CB4A 3GBSA 3V1KA 4QQ8A 2BT4A 4KDFA 1EDEA 1RLMA 3FD8A 4WT7A 1TAGA 1EQ2A 4KK3A 3B6MA 3Q8KA 2ZRKA 1KJYA 3PNVA 4FN4A 1ZOOA 2QENA 3HEMA 2A14A 1FNMA 1OLXB 1N1MA 2PUEA 4TKZA 5BQ5A 1ONOA 4TSKA 4PZZA 2PLRA 3KSUA 2QN7A 1HEYA 4G23A 3DKKA 3OUUA 1CUCA 1RZ3A 3X1MA 4NCHA 3AFGA 4DWWA 1PR2A 4EFMA 4LJKA 3GLGE 2AC4A 2DOKA 3U4MA 3HL4A 4EHJA 1KIAA 3A1TA 1W30A 3PXUA 3N9IA 4ZVRA 2G1AA 2OBBA 3ZLVA 5CDGA 1E6EA 1JHVA 1MX9A 2GA8A 2M1XA 5FFNA 5D6OA 3R7NA 1G8AA 1AQIA 4DZZA 4X1KA 3Q2IA 5DOVA 1G60A 1UDXA 4GEKA 1IN1A 1ZO8A 3BD9A 4MINA 1RWWA 1GSHA 4LJ5A 3B9RA 1AURA 2C5BA 2EZ4A 2H4JA 3OZTA 4MCAA 5YASA 2NZXA 2AOXA 3T3PB 1PJ8A 5JMOA 3TAUA 3EF3A 1FUYB 1JZSA 3D02A 4GL4A 5K0FA 4QUDA 3IOMA 4FBLA 1T4CA 4EY5A 1E4OA 1W93A 4UMFA 3AU8A 3GPIA 4JC4A 5LZ5A 4ATNA 3ZKWB 4R0VA 2B9VA 2F3SA 1T5BA 2HWUA 3DMHA 3GGJA 3JVUA 2PZLA 3GRZA 3P2KA 2JLVA 1E92A 2JGJA 5H9VA 1Y6FA 1A76A 3SR0A 2CLMB 3N2IA 2WYIA 4Q16A 4JEHA 5A3SA 1PR1A 1KQPA 4RIFA 4PLPA 1SG9A 3TDMA 3H65A 1DHRA 2Q2NA 3WGTA 3QTLA 2QA5A 1Z5OA 3UGTA 1GA1A 4GWLA 4CMJA 3IX7A 5EJ7A 4J4HA 3AILA 5ICGA 3QM1A 4KKVA 1HNXB 1XD2B 3Q7EA 4RSMA 5JY6A 3GEHA 1N5KA 4YMWA 4Y2HA 3AJEA 1QR2A 4F2PA 2P90A 3OD1A 2B0JA 3V97A 1GGVA 1WWKA 2PKRA 1YA8A 3WLHA 5ELXA 1ZSVA 2GS9A 4ML3A 1MC1A 2Y4OA 4ZKDA 2GHRA 3RSHA 2FSGA 4L0MA 3UAWA 4C7KA 5JIBA 1SC3A 1XWIA 1MOPA 2ACVA 3G7NA 4WLOA 5IBRA 1BHSA 2W6OA 4BNXA 5L95A 3WGQA 1XFAA 2YHBA 1ODCA 2E89A 2QLJA 4OREX 3P71T 1Y3BE 1GNTA 1Q1BA 3ROZA 3IAM6 1WDTA 2VVTA 2IW1A 4WBNB 3P9SA 4F92B 3ZDEA 5T6BA 4NH4A 2JFXA 3C4VA 2EKPA 2LCQA 4UM7A 4PVCA 4MI3A 3BQMB 3FYDA 5CW1A 1BFKA 3QJGA 4A0RA 5CFNA 3K70B 2GSWA 2ACEA 1NYLA 1LBEA 1T1IA 2OXRA 2I78A 1N5DA 4N0EA 2CCGA 2WUFA 3CPJB 2PXCA 3ITDA 4FFNA 5E4YA 3HNPA 4KL8S 3GFFA 1SFRA 1Q1AA 2FJUA 4WK2B 1GCGA 1QAOA 2QLTA 5JYBA 1XROA 2J0UB 3AL0C 5JXIA 2B1QA 2BV3A 1DG1G 3STUA 1RRKA 2WM8A 2OGZA 5CIQA 3AUYA 3RTBA 3UC9A 3EIQA 2SECE 1YJAA 2CXPA 4NK5A 3E0XA 1OH8A 1DAIA 2NP7A 1HFKA 4JJGA 3QUSA 1O6CA 4G84A 4K26A 4ESEA 4I99A 1EU1A 1NW3A 4UBKA 4E22A 3PF8A 1KY2A 1PNVA 4Q1VA 4RVOA 3INGA 4QOGA 4E5VA 1I3NA 1XU9A 2C78A 3VC7A 3PWTA 1UAYA 4HQFA 3R3XA 1OASA 4B7UA 2IBSA 3RVSA 4OI2A 4O3MA 1M67A 2XADA 3NM4A 4IY1A 5HS6A 3W4JA 3E8SA 1L5MA 4IYJA 3FJOA 3NHSA 1CZOA 1ECBA 1HV8A 1RXSA 4LKRA 4WY5A 1SA0A 4RVDA 1HLDA 4XASA 1NUHA 4Y7DA 4YEDA 5KHAA 4B46A 4XGQA 2XZLA 1VPLA 1W75A 5HJ2A 3S1AB 2AX3A 1WR8A 2H5JA 2RGGA 3K0EA 5JPIA 4BQNA 4GOKA 2MINA 1A50B 2BZ1A 2ZWVA 4JKOA 1ZVMA 1WSAA 1J8QA 4FHDA 5FIUA 1FYEA 3WWDA 4OX9Y 1XE3A 3WQRA 1SVUA 4EG1A 1ORVA 5JQGB 2ES4A 1TK2A 2RHRA 2V97A 3JYLA 1GAEO 3TJMA 3D6HA 2W2KA 4O5OA 1FMJA 4E31A 2DE0X 2R1TA 1EX6A 2CNLA 3TB6A 3HZOA 2W6CX 1RWBA 2CEAA 3C0KA 3CWZA 4TOIA 4A0HA 3ZJ4A 2VAWA 1W2HA 3ZCRA 2NXEA 1Y8RB 3AUFA 4FN5A 4M1TA 1ODTC 1W6RA 2GJKA 1P61B 2JF0A 4JT9A 4LY6A 4ZTBA 3SK0A 1T2FA 4AX4A 1BE8A 2AL7A 3I6QA 3LT5A 4HJXA 3F46A 4UHCA 5KVQA 3U0BA 3UAOA 2NVBA 3CG4A 3M2TA 3TK1A 1O7JA 2E37A 3GT7A 3OF3A 4XQ9A 1T2VA 3QNMA 2ZYWX 1SCUB 2AMYA 5A6SB 1EXVA 2RGNC 2NXWA 2HGZA 2XAUA 2BBOA 2DMRA 3H1TA 3D6TB 4JEMA 2Q62A 2RB5A 3FDZB 5GZ1A 4Q7MB 3MCZA 2IKSA 1VHTA 3EZGA 2R96A 4P0QB 5ITZA 2OA0A 2C7BA 2AFIE 2P9EA 5AI8A 3ZY3A 5HWSA 1NQWA 3RLFA 1WOYA 3MIZA 5K3BA 4DCPA 5KOHA 3BDAA 5FLXA 1JFTA 1Z2NX 3L6DA 3NALA 3TZLA 5FPKA 2PIAA 1BXGB 1WB5A 3B9QA 3LLMA 1OIXA 3LLSA 4YXFA 5JFGA 2D1YA 1J1ZA 4YJFA 5JS7A 3BMCA 4F2WA 1QCZA 5IUNC 4FBGA 4ARCA 1HMYA 2CVPA 1QGYA 3NEPX 3O8DA 1K75A 1N2OA 4G4SP 4RTSA 3JTMA 1D04A 2H1HA 3MLEA 1I0IA 4D56A 5K6RA 4HEQA 3DEAA 1YZVA 4R2WA 3EVCA 4AJEA 1W59A 1YHZA 4NMMA 5IBQA 3TPFA 5C7IO 5JBQA 1RQ7A 5AM2A 3VKHA 2OD9A 2SCUA 2VSYA 4U63A 5REQA 2JFPA 2XEXA 2VJOA 2C2BA 2DYKA 2PTHA 4QGFA 4ZD6A 4GF5A 4BLRA 4BKQA 3VKWA 5E9WA 3T52A 2A67A 3BWYA 1C3EA 1DS6A 3HBLA 1PQWA 1LDNA 1JIJA 2FE4A 4CF7A 5A3VA 1K68A 2O8NA 4NG4A 5GOTA 5KCZA 1RMYA 3C97A 4C6HA 1TJ4A 5DXJA 1B43A 4YRNA 1GADO 3ZY4A 3VO2A 3GN2A 2UUPA 4GOMD 4H1HA 2OHGA 2YNMC 3MJHA 3PHHA 5U4XA 4B8WA 1IZ8A 4O2BF 1NQXA 4E09A 3I0MA 3SGLA 2Q3LA 4KQJA 2G08A 2BYTA 5T4FA 1KJIA 2CFRA 4CCAA 2ZYSA 3TSCA 2OUIA 1QUFA 1VCOA 2XWPA 3PL5A 1BKSB 4MRNA 4AU1A 4V0NA 5BN1A 4RVGA 5AKLA 5K99A 1EXWA 5H70A 2V5AA 5DRYA 1UBTS 1H8HA 1M7BA 2FN3A 3UJBA 1PV2A 4D43A 1PW7A 4UBOA 3OZIA 1KYXA 1N25A 1FEZA 4RC9A 3QBTA 4H1WA 1X87A 3MFYA 3VTAA 3PEEA 3DBLB 1W0KA 3X2EA 1BX3A 5HKAA 3DAPA 4NYJQ 3JD0A 4HZIA 1KI8A 4JBLA 3F5MA 4FJ2A 1VL5A 3QUBA 4I9GA 2HF2A 1E0AA 1WPRA 4I14A 1ARZA 3U9SA 1KEWA 2Z8YA 5EPUA 5JZMA 2H57A 3ZXUB 3P94A 2QRJA 4I3GA 4TQGA 5B3KA 1K3TA 1X1EA 2PRKA 2W9XA 3H7IA 2FMIA 3I1IA 4NLLA 4UZEA 1ITZA 1Q5PA 5BV7A 4C6SA 3GLKA 1XGKA 2OILA 4I50F 3DYVA 3MQ2A 4QWWA 1T6ZA 4I1YA 4FWBA 4LMRA 3LA8A 3OJWA 3TTTA 3AZQA 4MKXA 5B7NA 5JW6A 5IYZF 1FBTA 1ORRA 3V4PB 4GZ3A 3F5QA 1D9XA 3ONNA 1P1RA 3HN6A 5KREA 1CZUA 2FPGB 1P33A 4P4TA 5CD9A 2H1CA 3LBNA 3MTJA 4P98A 4PY2A 4RMGA 4GSYA 4C0WA 1RI4A 3IQDB 2P2NA 3C3WA 1HL7A 3BGOS 4GD3Q 3UYKA 4BNKA 5LP6B 2XGOA 1VG9B 1ISMA 1STOA 1DL5A 2V7PA 1DDIA 1VIYA 4ZGGA 1JQJC 5JT1A 2HK8A 3FDIA 5EGNA 3JAMA 2EF0A 2BKXA 3NV7A 4V03A 1EDOA 3K0BA 4X1OA 3DVQX 1T0BA 1SA0B 4KWTA 1KEEB 1ZOPA 1UT5A 5E2AA 3TLXA 1B0ZA 5K9ZA 3STHA 3FSEA 1XRNA 1FNNA 2G70A 1SCUA 2I4IA 4HLDA 3TTYA 1P2SA 1AXEA 1X9IA 5A4KA 1E94E 4S05A 2XRFA 4IEEA 4OVKA 2ZBEA 1KJWA 5K4HA 3E9RA 4AKEA 4MSUA 2ODAA 5CR9A 2QZ9A 3RV4A 1JX6A 3AV0B 1E3WA 3PZBA 4FI3F 1TVKA 3G9ZA 3P9QA 3A4YA 4H15A 2DBYA 5KWVA 4FPXA 4I3FA 1MD9A 2VTDA 3LY9A 2IYRA 3PQ8A 1YNOA 4YP6A 5F64A 3V1MA 4HHEA 5H3CA 4D26A 2DRIA 2CMGA 2WMDA 1GGJA 2FPPA 1Z68A 1JLKA 2G25A 3A1EA 4IIJA 4W5HA 1W1IA 4U7TB 2OCXA 1HUQA 1DTWA 1OFIA 1QO0D 4WD3A 1MRSA 5TQ0B 1P4AA 3FPKA 4M1YA 1JKFA 3ZBQA 5A4JA 4O1HA 2P4HX 3V7FA 3WLFA 5GJWC 4JUCA 2V65A 5EE5B 2RHTA 4QU5A 2HJWA 1ZIOA 2D2FA 3HB0A 1E9FA 2FRDA 1XMXA 4NBUA 3CNEA 2PT6A 3T34A 5JZOA 3EPLA 2V0NA 5JDCA 1ZD3A 2DKNA 1TZBA 1NXXA 1PL6A 1HE8B 2VSFA 2ZUCA 1QE5A 1QLHA 4K9KA 4TV9F 3V32A 2FK8A 4LE2A 1NM5C 2H5LA 3ZZNA 3Q9SA 5PNTA 3AESA 1SPBS 4BNFA 2F8TA 3JQ9C 1CT9A 4CF3A 1AKUA 3D7LA 4MGYR 2D2VA 2XUDA 3KL2A 4J03A 4LSMA 3P96A 1FJHA 1T5SA 2HKIA 3IPRA 1JAYA 2F48A 4M0FA 3AJRA 3GPBA 1IXYA 5ED0A 1ZGBA 3TNLA 3V9AA 2AK2A 1VIVA 1IPHA 4ZZIA 4Q7LA 1SCKA 1GG2A 1U8ZA 3JARB 5F5NA 3I64A 2RK3A 2QDKA 2XYQA 3MYYA 3NTQA 1XD2A 4OHCA 4UNSA 4MV6A 4XYMA 5AMXA 4EJSA 1V3TA 4M36A 2EG5A 2O8DA 1GZUA 4XUCA 5K4GA 1WP4A 3PXAA 3OZWA 2WFZA 3A25A 2WY2D 1P75A 1YZYA 2B2XA 2R3SA 3GNTA 3B7GA 3QMMA 4NZMA 1IK4A 1Y33E 3B8HA 1NBAA 2EP8A 3F6RA 4RVUA 5DNVA 2BR3A 1PVVA 4X24A 1XL1A 4CNQA 3DHYA 2VNIA 1E60A 4U7PB 1RPJA 2CT8A 3DMYA 1CNEA 4BE4A 4PX2A 1UOQA 3RRMA 4D8TA 4C2TA 3E6AA 1JG6A 1QH9A 4MW4A 4KSYA 3I73A 3PCXA 4BNUA 4RHUA 4GZMA 1RRFA 4EENA 2E82A 1QZZA 2BFDB 2JFNA 1WMBA 3K5PA 2ZOSA 4G5QA 4MS4B 4TV8A 4YCAA 3NHJA 3ZUGA 4MR9B 2O57A 2AI3A 5F21A 2V0GA 5E7MA 4I19A 1GPMA 1IZ9A 4TWBA 2VYCA 1RC0A 3FKSA 5JQGF 2OHIA 4X65B 1J33A 4NEQA 1XVUA 3W6NA 5DI3A 3EQ7A 1XJWA 1N5RA 4PWYA 4O2LA 3TSZA 1UPAA 5JJLA 1K5GA 2VXYA 3RHTA 5JHGB 4KXYA 2ZXUA 1FVFA 3GLGA 1RI3A 1N3LA 3BN3A 2OV1A 1Y5IA 3NI2A 5CK4A 4PRKA 2VUIB 1EZ4A 1EGVB 4K9PA 3ZK7A 4YRRA 3JALB 2QAGA 2YY6A 5FOWA 1T5OA 3B1JA 5CH8A 3MLAA 2X77A 1P5FA 3GEEA 4KXQA 5F78A 1NI5A 4QEZA 3A0RB 5EIFA 3OECA 4C4XA 4ZI7B 5ALJA 5CPBA 1W1WA 3OQBA 1V1RA 3ILXA 4CLOB 4RLSA 2QNRA 3SBDA 4YROA 2WB2A 4FMCF 1U2RA 1O5OA 2GR9A 3GLRA 2PUJA 3TPCA 4N9QA 4PGHA 1VE3A 4DQKA 2XQGA 4AO8A 1FP7A 5HK8A 3IP9A 3THYB 1K27A 4YBZA 1LD3A 3QBDA 5DV9A 3ZHRA 2HADA 4E12A 2XB9A 3BKWA 3JW8A 4W9RA 4EG4A 1RPZA 2DB3A 2JIQA 4PZDA 3ZH9B 3SWWA 3NRCA 2G83A 1WPGA 2AZTA 4EUSA 4ZJYA 4QGBA 1WUTA 4MR7B 2R6ZA 1COWD 2PCLA 4DJEC 1J2UA 4NBWA 5HFNA 1GPLA 1C4OA 5AKYA 3HP7A 2Y71A 3ZQUA 3VR3D 1PSZA 4CJXA 2EL9A 3GUUA 1UPCA 4ZCPA 2IU6A 1GUYA 2WAOA 4MAMA 4N7BA 2Q5OA 4YR7A 2BMWA 2P40A 3IHKA 4LSGA 4ZRMA 3AKZA 1QGAA 3UENA 2HF7A 5DHPA 3THWB 3IULA 3TUZC 3INRA 4KN8A 4H4DA 4WFJA 3RFVA 2QG9A 2X9QA 3JQAB 3UMYA 1KO8A 4MUJA 3QEOA 1IJKA 221PA 2DPGA 2FZLA 3Q0IA 1TUBB 4OXQA 4XIYA 5DYIA 1QWSA 2DHRA 2B82A 1YUMA 4HF7A 3W5UA 3L3BA 3HJFA 4G0XA 3R77A 1TB4A 4QU8A 1TXGA 1ZEJA 3DZGA 5FL3A 1F9AA 1NM5A 2DJIA 3R6WA 4REQA 2Z3ZA 3FOAA 1E6WA 1TM1E 1W4BA 4B76A 1X0XA 3D3NA 3HJUA 3MJ4A 3MTBA 3OF2A 3FAKA 1H5UA 3T1OA 2COKA 3FPGA 2D59A 2Q5CA 3OZEA 4L72A 4CM9D 5B4UA 3IQFA 2X13A 4XB2A 1SCJA 1FOEB 3SDZA 1A97A 1N6PA 1KP2A 2VLBA 2RGAA 3VO9A 4U5XA 2J46A 5F5LA 4HZUB 3WNVA 2IK8A 1EUYA 4M7PA 1YACA 2CD7A 3U4IA 4HEHA 4IIBA 1TF5A 5FBZA 4FZ5A 3VJLA 2IBTA 3T7KA 5LXTF 4WVLA 2IUFA 2VDWA 4G41A 2Q7DA 3LJKA 2J6HA 4L4UA 4FLMA 1ZJJA 1DFIA 4PLTA 4RKFA 5FADA 4H7FA 3SSAA 3VR1A 4QUHA 1AV7A 3AR6A 4RIIA 1V8ZA 1Z4MA 3CEMA 3U2QA 4MJLA 5HZGA 1N6KA 2W8BA 3LBHA 4ARBA 4JL8A 2C5FA 1UIRA 2H7XA 1OC2A 1U5BA 1W44A 3QOYA 1M2HA 3OY2A 3VSEA 5TPWB 1D4ZA 2I7DA 2QLNA 2DFNA 3QMWA 5GVSA 1Q20A 2BMDA 4RD3A 2JEOA 2HK6A 3FUWA 2YJNA 3OIGA 1CJKC 1Z2OX 1JA9A 2OOSA 5F9HA 1Z7YA 4KITB 4J9VA 4RTQA 1L4FA 2R1VB 2OQIA 2GCIA 3L8YA 3TLGB 3EZYA 2XMZA 1KYVA 1Y34E 2GPWA 4FW9A 4G8DA 2IUUA 4CR8A 3FM9A 4ZVPA 5FWNA 5SV2A 1FXWF 1LRLA 1PFGA 3TRJA 1SQ0A 3QU2A 3EXEA 1PQYA 3M6XA 5LNK6 1A98A 1YBMA 2CEKA 3JQAA 5EJ2A 2I7CA 3REGA 4XX1A 4BOYA 3F0TA 3FUTA 1OHHA 3MC1A 4ZOCA 4H9GA 4E7OA 4U2DA 5DBHX 2GF0A 1PUJA 4OXIA 1YL6A 2IE0A 1FSZA 2VPYA 4JN6B 2AKAB 4NFHA 3THOA 5F98A 2QAGB 3LVBA 1L7NA 4UEKA 2AFHA 1XXHE 1AMNA 3VR5A 3WL3A 3HI6A 3PSAA 4PZ9A 4K1LA 4V38A 1K4YA 1Y9ZA 3Q7PA 4LRYA 1FLDA 1JG4A 4DUGA 5DM60 5DTEA 1L8QA 4R1PA 4XDZA 4C0BA 3ORFA 1X7DA 3GRYA 3KUCA 3MWYW 4BMVA 4N3AA 3GH3A 3Q3HA 3EGCA 4AXBA 2WNSA 2FRVA 2Z83A 4U2BA 1NUQA 5AXCA 3HB9A 5DTJA 3KB6A 4OYLA 4EH1A 5EWMA 3MS7A 3RTEA 5HKLA 3TTXA 2BELA 2Q50A 4W6QA 1KJ9A 4WOCA 5JXGA 1G2IA 1R6TA 1YIOA 2X8AA 5B1HA 2DKFA 3F90A 4UCFA 2PKCA 1C5KA 4OYYA 2OEPA 4OU5A 3AO0B 3SJZA 1VI5A 1U98A 1V8DA 3PGKA 4PF1A 5GGXA 2RGDA 1LW6E 1X80A 2ZAIA 4B2YA 1QRTA 1DPFA 5G3YA 4B85A 1TZ2A 1JWLA 5CYOA 1ANKA 2VDOB 3DULA 3OZVA 3LKVA 4P38A 3Q3EA 4M9ZA 3E5RA 4Q3BA 3M3DA 2W4IA 1EJ0A 1RCUA 2NZ8A 1RKQA 2O1EA 3M5WA 1P81A 2AOUA 3U4CA 2FG5A 3RVMA 2NTYC 3QWIA 4KXLA 4EI9A 1NY5A 2OY0A 5FR2A 2WWHA 2ZT5A 1N8SA 3ZY5A 2Z2JA 5KMGA 3LUDA 3ZI0A 2NVUB 1EFDN 2ZTSA 1R4MA 2X23A 1HT1E 3UCXA 3LIPA 2X58A 1MVNA 1FCJA 2QX7A 5CW2A 3ZIAA 5EHXA 2NTVA 5D5PA 5TS3A 2FQYA 1PGQA 1SB9A 2B94A 2BN4A 3CVVA 4M9UA 3U19A 2XR1A 2OG1A 1VL6A 2R1UA 4Y2TA 1NFRA 2PKWA 4GQBA 4IIVA 4RMIA 2QL9A 2YH2A 3OPYA 2XGSA 1RAFA 3U3OA 3UMFA 4DANA 1PFKA 1A8UA 4J0FA 5SICE 1OLOA 4RKYA 1QIEA 4MGKR 1L7OA 5A5EA 3BRWA 3QBVA 4IJUA 4L3VA 4DNPA 1X9GA 1NG9A 1ZVKA 3LXMA 4IGIA 1ESEA 1Y8AA 3FUUA 4I1SA 4OHZA 4K8OA 3KS9A 4NQRA 5LQSA 3RVKA 3UXMA 5L3ZA 3ADKA 3F7TA 4DLXA 1U7UA 3ILHA 3M83A 4ZP1A 4E2YA 1I0LA 2HJ9A 2Q28A 2C03A 2WF7A 4LZNA 5ALKA 4GUAA 5A02A 1OD6A 1Q16A 3QXCA 4GPBA 5G41A 4J2OA 5IKEA 4BBPA 4N48A 1P9WA 3UGQA 4AKIA 2GM9A 1FC0A 2L2QA 2WQ6A 2AQKA 3DOJA 4AJJA 3THXA 5FH9A 3B2QA 3ROMA 1GTG1 2RH8A 1KO1A 2JBHA 3AP3A 3W78A 1XMIA 1TLFA 1BKYA 3JQ8A 1FS5A 3K31A 3CMMA 4Q9JA 1QKJA 4JLMA 2HRRA 1C7JA 1TLLA 3FXAA 4GC9A 1OXSC 4REQB 3IBCA 5T5QA 3STTA 4GU5A 3V7UA 4B4VA 4AMYA 1PR0A 2NO6A 4RL6A 1G59A 2HEIA 3EBLA 4A5SA 4DEYA 1RAIA 3TRFA 3UKDA 1KY4A 3KT6A 3HS3A 1Y4UA 3E58A 3ZI7A 3DE3X 2OL4A 1I3MA 3QW4B 4MP3A 3GEIA 5DNAA 4JFRA 3TE7A 2XTMA 3FYUC 3VNAA 3RRZA 4ZPJA 4EJ6A 2OVBA 4L7VA 1Q7BA 4TS9A 3EJWA 3GY0A 5KWSA 4H59A 2IELA 4G1VA 5IC4A 5K2OA 3N1UA 2G72A 4DHWA 3FH0A 3O8NA 1EXNA 1U31A 2Z4RA 3M1YA 3FTDA 1GKUB 2YASA 3QBEA 3CUTA 4I4LA 1E6LA 3E18A 5SY6A 4BFUA 1CY4A 5KWIA 3CTMA 4YRLA 4EX6A 3U4QB 3HKEA 3UMJA 5A1TA 1CJTC 2BFPA 4UM8B 5HQTA 2ALJA 1VYTA 2AN4A 4MWSA 4IFEA 4ALKA 3NM6B 3HK2A 1A9ZA 1ZGHA 3E8XA 5JVDF 1B1CA 2QUKA 1U7ZA 4PFKA 2QD1A 4G6ZA 4C0JA 3H97A 4MK4A 1CULC 4MYUA 3JQGB 3VU3A 5C32A 3GFPA 3WL5A 1GA6A 3REFA 1E6MA 3CF0A 5AKXA 3IKJA 3NOOA 2VEOA 3K1ZA 4AMZA 3TX2A 4DLTA 2ODQA 4IQ0A 2XNDD 3IP6A 4PYRA 4HRAA 3TD9A 4ER0A 5JYEA 3EC7A 2Y68A 3LZDA 4WK4B 5K0EA 1UZAA 1K97A 4JXXA 2PUFA 1SQSA 4P33A 1WVMA 1YSCA 3O8QB 1NDHA 4BX3A 3AB3A 1N9ZA 1AKYA 1JL3A 2O0MA 3O3NB 4FGWA 4MKIA 1AQUA 4W5JA 4X3OA 4Y0NA 3SU8A 4Z4GA 1E9RA 4RTPA 3TEMA 2VG8A 3WIOA 4KUGA 4QTUB 4FYJA 1NHGA 1MA3A 2JFGA 4HUQA 4HYTA 4EVQA 1X7XA 4MV9A 3RFTA 4EF4A 4KP7A 1M5UA 3PX3A 5TLSA 1PBNA 2VQEB 2WNHA 4CLXA 2GUGA 2CLDX 8ATCA 1BS1A 5K3OA 5KYKA 1IY8A 3ETGA 1CTQA 1Z5UA 2DTDA 4UEJA 4YRTA