3MVEA

Crystal structure of a novel pyruvate decarboxylase
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
396
structure length
396
Chain Sequence
AKETSALTQYMPTSQSLLDEIKEKNGFSWYRNLRRLQWVWQGVDPIEQEQVLARIASSKHSRTDEQWLDTVMGYHSGNWAYEWTRLGMEHQKRAGEMTNEAASEALFSASLCYSIAGYPHLKSDNLAIQAQVLANSAYLEAAKKSKYIIKQLEIPFEKGKITAHLHLTNTDKPHPVVIVSAGLDSLQTDMWRLFRDHLAKHDIAMLTVDMPSVGYSSKYPLTEDYSRLHQAVLNELFSIPYVDHHRVGLIGFRFGGNAMVRLSFLEQEKIKACVILGAPIHDIFASPQKLQQMPKMYLDVLASRLGKSVVDIYSLSGQMAAWSLKVQGFLSSRKTKVPILAMSLEGDPVSPYSDNQMVAFFSTYGKAKKISSKTITQGYEQSLDLAIKWLEDELLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title FrsA functions as a cofactor-independent decarboxylase to control metabolic flux.
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Lyase
molecule keywords UPF0255 protein VV1_0328
total genus 143
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06500 DUF1100 Alpha/beta hydrolase of unknown function (DUF1100)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3mveA00
2QTBA 3O95A 5I8PA 3FLAA 3YASA 3BL8A 4JNCA 2XI4A 1HKHA 3MUOA 1XRQA 5C7YA 1OXMA 2J3DA 4CCYB 2ACKA 2AJLI 1Y7HA 2JGEA 3H2HA 4C89A 1XZMA 2ECFA 1NX9A 3HEAA 1AQLA 1EXWA 2I78A 4X95A 4EB0A 1H2YA 5C8XA 3P2MA 1GT6A 4Y2JA 2RAUA 3OTQA 2XT0A 4XVCA 4U2DA 3JYHA 4EY4A 4E14A 5AO9A 1G4HA 2FJ0A 3HZOA 4UBIA 5LZ5A 1THGA 4B81A 4BP8A 3WWPA 4MEAA 3WZMA 4KR0A 5KWJA 2WUFA 1MNAA 3GROA 2XMRA 2QJWA 3C5VA 1JU3A 3A2LA 1Z68A 4KE7A 3F98A 2OGTA 2WUDA 2IIVA 1WOMA 4UHDA 2R8BA 4FLEA 1CQZA 4MEBA 2ACEA 1OCEA 1XKLA 3AZQA 4DNQA 3C8DA 1E89A 2OXEA 1ZIYA 1GPLA 3FYTA 1F0PA 3DL4A 4PNZA 3I28A 4F5ZA 1USWA 1EVEA 4AO8A 3QH4A 4OU5A 7YASA 3K9BA 1W6RA 1WPRA 3PF8A 3FCXA 2XUDA 2C5GA 3IB3A 2AJ8A 5IVDA 2D5LA 2XMGA 5CXUA 5AI6A 1CIJA 5K5EA 1FJ2A 2H7XA 1H2ZA 2JGFA 2G5PA 4DSZA 1HDEA 1DX6A 2EDAA 3I2GA 5EI5A 1WB6A 5LZ2A 2RGUA 2G4LA 3DKKA 1K6EA 3H2IA 4C4XA 5HK9A 2ROQA 3WA7A 4J0IA 3QMMA 4HVTA 4H77A 2XUOA 4RE6A 2WUGA 4CI9A 1AZWA 1UK7A 3H2KA 5JYCA 3LS2A 3I1YA 5D7BA 2IITA 4X00A 1MX5A 5BOVA 5JD4A 4FOLA 2OGZA 1DT3A 1YAJA 3VVLA 5AKLA 4AN0A 4B7ZA 2H7YA 4AB1A 1N5MA 5AI9A 4BYMA 1MAAA 1ZJ4A 3N0TA 2CEKA 3WL8A 1JJFA 1X70A 1U2EA 5HK8A 4EY8A 3BXPA 2OCGA 1L7AA 3C6XA 3AINA 2ONCA 3PICA 2C58A 4J0HA 3HRHA 5HFAA 4G1FA 1UOPA 4W9RA 4GBGA 4MYDA 5ALVA 3B12A 1CVLA 2BGRA 1F0NA 4FKBA 5HQ3A 4U2GA 2OCKA 3D7RA 4AQDA 3G0CA 5IVHA 1TCBA 4HXEB 3Q0TA 3H0CA 1XRLA 5AH0A 5FKJA 2QMQA 5K3FB 5F4ZA 3WL7A 3D59A 5LKAA 2V98A 2WTMA 1R9MA 4HZGA 2QUAA 4H35A 5A62A 3O4IA 2WM2A 4AO7A 1N5RA 4WFJA 3IURA 1BCSA 5CURA 4L72A 1UOQA 1Q83A 4I19A 4IQ4A 4ARAA 4PW0A 3V9AA 1J07A 5EIEA 1E8DA 4X91A 4U2EA 5DYTA 1L7RA 1EDDA 4J0JA 4KE8A 4W63A 5ALSA 1R9NA 1E3QA 3OM8A 1XZLA 3S2ZA 5I9IA 2XMCA 1Q84A 3EIOA 1ZI8A 3BIWA 3JW8A 5K3EA 4NZZA 1EVQA 3QMWA 5DTIA 3QPAA 2JGKA 3R0VA 1GQRA 3M82A 3B3QA 1VOTA 2EEPA 1ZICA 1VXRA 3CCBA 5CH3A 1VE7A 5HF9A 4FLMA 4ZV9A 3PUHA 5AM4A 5CH5A 2C0PA 2HA2A 4Y2YA 1UFOA 1JKMA 3DNMA 1FFAA 1YS1X 2IX9A 3I6MA 1VLQA 2DHDA 1CUXA 4YX9A 2JEYA 4JYMA 3HSSA 5CW2A 2DFPA 2OCIA 5LZ8A 1P0IA 1ZOIA 4UBMA 1MTZA 3M83A 3VVMA 2WLSA 3VJKA 1LLFA 1U8EA 2BUBA 1H23A 2XQGA 1QTRA 4FNMA 4PSDA 2HRRA 3KOOA 4P08A 2UZ0A 2OGSA 3H1AA 4AXBA 1XZHA 1GPNA 3FVTA 1TRHA 3D3NA 3D2CA 4EBBA 5DJ5A 1CUGA 3IUQA 4JH0A 4QDXA 5K3DA 3ANSA 1Q0ZA 4UUQA 2HFJA 3IIIA 4W1PA 1DQYA 5CMLA 3LLCA 3AIOA 3FYUC 3ESDA 2PL5A 3G9TA 3WWEA 5AKEA 4UPDA 4G4IA 5ALMA 4U2FA 1XRMA 4MXDA 3G8YA 3BF8A 4F0JA 3W04A 4MQLA 1ORVA 1ZD3A 1ZD5A 2ZVDA 4V2IA 3HC7A 1AKNA 1CRLA 5LIPA 5JASA 5ALPA 4QLAA 1Y37A 4QWMA 2PSHA 3HI4A 1W75A 2WU4A 3WK8A 2PUHA 4EUSA 3FYUA 3WA6A 2WHPB 3WK7A 2GZRA 4WY8A 4Y2UA 3VXKA 1ODCA 4I3FA 1T4MA 3H18A 3AIMA 5AKKA 5JARA 2VEOA 3IA2A 3I1IA 3ZWQA 1BN7A 1UKCA 4P93A 1K63A 3W9UA 2VSQA 5BWBA 1KU6A 5BWCA 5AKJA 4ZRDA 5AJHA 2GBCA 1X2EA 5FPQA 2WIGA 4QDTA 1W52X 2VAXA 3MUNA 1H22A 5EHXA 4FMPA 1CUFA 6YASA 2CBGA 1A88A 3STYA 4N5IX 1ZD2P 2C7BA 2FUKA 2Y6VA 4GECA 1HBJA 5K3FA 3T52A 5AKYA 4NMWA 1ZI6A 3WWDA 5SYMA 4H0CA 5LLSA 2HDWA 5D3KA 4B0PA 2PVSA 2HA3A 3STVA 4CG3A 5AM0A 3D2BA 3G02A 4KACA 1RWQA 2PSJA 1LZLA 2OQVA 3PI6A 5LZ7A 1XZKA 4UBKA 5A7HA 1XQYA 5C8VA 2H7CA 4YASA 3QVMA 1MAHA 3I2FA 1W4LA 3O0DA 4BE9A 2GBGA 1VA4A 3LP5A 4X97A 2YYSA 2RIPA 4BDSA 2X5XA 1XZDA 2WG1A 4OCZA 4B85A 1LPOA 1UWCA 1FFEA 5AK4A 4BZWA 5T4EA 1XZEA 1XROA 3BJMA 1EINA 1CUIA 4M0EA 4RE5A 2QR5A 5ALYA 1VZ3A 3WK9A 1UK6A 4QEKA 1IUNA 2C5FA 4PV7A 5AM5A 2HU8A 3S8YA 1SFRA 4LYDA 5HKAA 5LKRA 2HFKA 2HHAA 1P0QA 4H18A 4PSCA 2XUIA 4N5HX 3A70A 1XLUA 2HIHA 2JIDA 2P8SA 4TGLA 5HKBA 5JAOA 4E46A 1XZAA 3H2GA 1E8MA 1CR6A 4KYVA 1A8QA 2Z3ZA 4UHEA 2RHWA 1AUOA 3DQZA 2Q0XA 1ORWA 4N8SA 3C6BA 5ALDA 4HAIA 4GLBA 4Y2PA 5DNVA 5ALQA 4DTCA 1VJ5A 2WU3A 2XB6A 5ALHA 1TKRA 4QDOA 4BTVA 1QONA 4W1RA 1XRPA 2XDWA 4H7IA 1GZ7A 4BRZA 4FHZA 1FFCA 1YSCA 1JMKC 2QT9A 4GW3A 4NVRA 1DWOA 1XKTA 5H3HA 3QMVA 3DOHA 3O4GA 1MX9A 4J7AA 2ZYIA 4YPVA 4W1SA 3KXPA 1O6FA 1MT3A 5LYYA 1E5TA 1NU6A 3FYUB 1JJBA 2WFMA 5A71A 1AX9A 1AC5A 2WG0A 3V48A 3FLEA 1ZD4A 3I2KA 4HXFB 3WKDA 4C4ZA 1CUBA 3G9UA 2GYWA 1BCRA 4Q3KA 1CUSA 2RI6A 1A7UA 4O08A 2WHRA 4B83A 1THTA 4X3CA 4Q82A 4IH1A 1CUAA 2XUFA 5AK5A 2WKWA 1QIMA 1PV1A 3UUEA 4OSEA 1QGED 2J3QA 3BJRA 3DOIA 4X71A 2B4KA 1F8UA 3VISA 1TCAA 3STXA 2XQKA 5A7GA 2WJ4A 3GFFA 1VA5A 3D0KA 3G7NA 1CV2A 1K4YA 1MPXA 1T2NA 3STWA 3ZLUA 2ZSHA 1G5FA 5ALGA 4CG2A 3NGMA 4QLOA 4B0OA 5T4FA 1AURA 1QIFA 3D2AA 4OYLA 2WFZA 1BN6A 4OUKX 4OB6A 1BE0A 2XUKA 4UHHA 3AIKA 3AFIA 4G9GA 1VKHA 2NW6A 2X8BA 3HABA 2HA5A 3DYIA 3ESCA 1AGYA 4C88A 3K6KA 2R11A 1EK2A 2QVBA 1FSSA 2V96A 1CFJA 4L3WA 2QXTA 1UKAA 3LIIA 1QIHA 5AM2A 1EHYA 1W76A 4PQEA 4HTAA 5AIBA 2CMFA 1DINA 1CUCA 3WL5A 3DL7A 3HJUA 3V1LA 2JEZA 4DNOA 4BVKA 4WDRA 4BBZA 3HYSA 3QPCA 5EFZA 4ZGBA 3ICVA 5AM3A 3FOBA 5JANA 5JAUA 3PFCA 5EGNA 3VJMA 3N2ZB 2BUCA 1RYYA 1MX1A 3ANTA 2J4FA 4C87A 2XUAA 4LKOA 2WHQA 3QITA 1LZKA 4OPMA 4J0CA 4QNNA 1H2WA 3H1BA 5SYNA 5ALWA 1I6WA 3ICWA 3NOXA 4X6XA 3KSRA 1LGYA 1CUEA 4WCVA 4X92A 2O2IA 5KBYA 5DYWA 5AK3A 4N8EA 3IUMA 2GYVA 3PFBA 3D5EA 3GUUA 3C6YA 2AJBA 4Y2RA 3E0XA 2XMSA 4YK7A 3WQHA 1EDBA 3CN9A 4W1QA 1WB4A 4OYYA 1TAHA 4BP9A 4C6HA 1WCYA 1EB9A 2PSDA 4P9NA 3KD2A 5EHQA 5ALUA 5CT5A 4DLNA 1XZJA 4K6HA 4XWGA 3OOSA 3ESBA 3NWOA 3TJMA 3CXUA 1QE3A 5AIAA 3I2JA 4KE6A 3KWFA 4M0FA 5HFNA 1YS2X 1IZ7A 4Q05A 1HQDA 4ZXFA 1GXSA 1B41A 3HACA 4JYPA 5FP0A 3ESAA 1QIEA 5AKZA 2WIKA 2I03A 1XZCA 1IVYA 4MYSA 3RM3A 2QKYA 2PSFA 3W9BA 1QFSA 4UFNA 5ALRA 5ESRA 3WWCA 1XRRA 3WK6A 4CCYA 3G0IA 4BVLA 3G9XA 3IUJA 1LPAB 1SCKA 5KWIA 1P0PA 5IKXA 4BATA 2WJ6A 3DDUA 3OPMA 1W1IA 5JIBA 3RK4A 2O2GA 1X2BA 2OG1A 4FFWA 4XX1A 3W06A 5FDFA 1LPPA 4H7EA 4K5QA 1EA5A 4UBNA 1QFMA 5AM1A 2VT6A 4FTWA 3WKCA 3C70A 1OILA 4F60A 2XMQA 4Q3LA 2GZSA 3G0BA 4WJLA 1U4NA 1C7JA 2OCLA 5K3BA 3WJ2A 3WWOA 1VXOA 2PU7A 1JMYA 1CUJA 3E4DA 3G9ZA 3PE6A 4OB7A 3IULA 1MU0A 2PBLA 3FLBA 4EA6A 3C87A 4B9EA 1DU4A 2JGJA 4GHWA 4AN1A 1XZIA 2XUJA 4E11A 3R3ZA 4UHBA 4QA9A 5ALNA 3SK0A 1XQWA 1AMNA 4FBMA 1XZFA 1J1IA 3C43A 5AICA 4TVKA 2WSLA 2VTVA 3EF3A 4LYEA 5JATA 4Y2TA 4ZI5A 3V1MA 1CUVA 3DD5A 5DWDA 3ED1A 3L1HA 2VJAA 4BTLA 4J0DA 4DGQA 4KEAA 3ZV7A 1YASA 3DEAA 3R41A 4H7DA 5I7UA 5LP1A 4KRYA 2FX5A 3BWXA 4UFOA 4XIIA 2H1IA 4KAJA 1ACJA 3GA7A 2VF2A 2CKMA 5AOBA 5K3AA 2FJPA 2BAGA 4ZV7A 4ARBA 3RLIA 1HPLA 3T4UA 2WILA 5HF6A 3WI7A 4FFVA 1XQXA 3DKRA 5DLPA 1TK3A 2GBFA 3PUIA 1XZGA 2VJBA 1D07A 2WIJA 2OAGA 3BDVA 2ZYRA 1DQZA 4WFIA 4X6UA 4EY5A 4KRXA 1YR2A 2HADA 5ALOA 5D6OA 5CT4A 4LIPD 2BUAA 2QZPA 2QS9A 1KEZA 5EIHA 1G42A 4UHFA 4C4YA 3V1KA 3R3UA 2ZYSA 2PSEA 3GELA 2HA6A 3G0GA 4QDZA 3VJLA 2W22A 1P0MA 4UBLA 2YXPX 2GYUA 1H2XA 4X90A 4QDUA 4INZA 1YAHA 2E3JA 2RHTA 2V97A 4OU4A 1M33A 5C81A 3EQ7A 1EH5A 5DTJA 2GBIA 4RGYA 4L9AA 3WKBA 4FBLA 4DNFA 1A8SA 1ZIXA 4C01A 4UFPA 1MNQA 4QWWA 1L7QA 3FAKA 1U65A 4BCDA 4K6KA 3ZPXA 2O7RA 2XQFA 3TGLA 4DMCA 4AO6A 4KAFA 2X76A 3I6ZA 1K5PA 3G0DA 2BCEA 4Q34A 5T4HA 2WIFA 4P92A 2Z3WA 4WDQA 4RPCA 1R50A 1QIKA 4WY5A 4QE3A 1ODSA 4CFSA 2ES4A 5CTAA 5ALZA 5FLKA 1UXOA 1VE6A 3VKFA 5FPPA 4MWSA 1QLWA 3ZLVA 1Y7IA 2HA0A 3FVRA 2WQZA 4BCBA 2WFLB 4U2CA 2DCMA 3L1JA 2DHCA 5EHZA 4E15A 5JD6A 1LPSA 2DSNA 3H19A 4BAZA 3SC2A 4D9JA 2ZJFA 5JZBA 1EX9A 3DLTA 1UK9A 1UOOA 4Z49A 3A6ZA 2JGLA 2WJ3A 3BE8A 4J03A 3EQ9A 2XUQA 1ETHA 3C5WP 2YASA 4FLFA 3B5EA 1E66A 4K6GA 2ZJ7A 2CB9A 4CIAA 3AILA 3IDAA 3H04A 3WMRA 3STUA 5K3CA 1MO2A 1O6GA 1R4ZA 5IVIA 2YH2A 3Q8WA 4JUIA 3U0VA 2Y2UA 2G5TA 1XZBA 4H7HA 5FXMA 1GGVA 2BFNA 4B6GA 3FWHA 2JF0A 3WKEA 4DSAA 2B61A 3CN7A 4N8DA 2J4CA 1YB6A 3M81A 2HM7A 5LZ9A 4GEGA 3HLKA 1EB8A 2PUJA 4X85A 4G5XA 1G66A 5AHXA 5AP9A 3A2MA 4NS4A 4ETWA 4BC1A 1JI3A 2B20A 1CLEA 4RNCA 2C0QA 5LZ4A 4L0CA 2HRQA 1RP1A 2WFLA 3WL6A 3LCRA 2XLBA 4S0XA 2WHPA 1BRTA 3I2IA 2PU5A 5CT6A 1SC9A 1BROA 4BRSA 1LBSA 2WUEA 2DHEA 1LPBB 3O9VA 4BE4A 2XLCA 3ZLTA 3R3YA 1ZGBA 3WYNA 2RONA 4BVJA 2BKLA 1TIBA 4X7BA 3I6YA 2VATA 4BB0A 4MQMA 3F8SA 1C4XA 4EY6A 3MVEA 1XRNA 3WIBA 1F6WA 1GPKA 5JADA 1R88A 4EZIA 1GQSA 1QIGA 3O4JA 3IBTA 4KE9A 2JGMA 4A23A 2D0DA 1DX4A 4WFKA 4G4GA 3PDCA 1CEXA 2QOEA 5A2GA 4BAGA 3BF7A 3CCCA 2AXEA 3KWJA 3WK5A 1CUWA 5E4JA 1R3DA 2HU5A 3R3XA 3DJYA 2CUTA 5EHNA 3OC0A 3PF9A 3ZI7A 3FBWA 2QM0A 4ITVA 1MJ5A 2G63A 3KDAA 5CT9A 4UHCA 2DQZA 3AUKA 5IVKA 1WM1A 1FFDA 2JGIA 4GXNA 1YA8A 1QJ4A 4B9AA 1BS9A 1LPNA 5JALA 2OQIA 1CUDA 4IHAA 1XLVA 3JWEA 2OAEA 1JFRA 5KREA 2Y2VA 3RARA 1CUZA 3UMJA 4DM7A 4JEIA 4ZWNA 3TRDA 1YB7A 1ZGCA 4M0MA 5FUMA 4LXHA 3F97A 3AZPA 3H17A 1DWPA 5E4YA 1C7IA 2WTNA 3FCYA 5AKHA 3NUZA 4DMFA 4Y2XA 3QZUA 4Q3OA 1J06A 1BEZA 5AI0A 5YASA 1UK8A 4X94A 3H2JA 1LNSA 2I3DA 5CRIA 2VQ6A 5FRDA 4DMHA 1TQHA 3C45A 4PF1A 5JZ9A 1CUYA 4TPKA 3X3HA 4BC0A 1Q0RA 1EK1A 2WIDA 1QO9A 1JJIA 1ODTC 5ALFA 3F9CA 3DCNA 1A8UA 2HL6A 1QIDA 4HS9A 4CIBA 1IUOA 3V1NA 4DIUA 3EQ8A 5ALLA 4ROTA 1IUPA 4FWBA 2HU7A 2ZSIA 1SOMA 4H7JA 2QUBA 1CUUA 4B82A 1NU8A 3R3VA 3C8HA 2XQIA 2AJCA 3DS8A 2WG2A 3OURA 3WLAA 5DYYA 3F67A 3WK4A 3HXKA 3LIPA 4Y2SA 4CCWA 1TCCA 2VT7A 3SX4A 2PX6A 1QO7A 2C4HA 4AZ3A 2O7VA 3F96A 3WZLA 1DTEA 3C6ZA 4IH9A 2VA9A 3QM1A 1PJAA 5AOAA 3GBSA 1K8QA 4UBJA 4H7FA 1IZ8A 2K2QB 5BV7A 4ZREA 2Z8XA 4HRXA 2ZJ6A 1QTIA 1GKLA 1E8NA 2LIPA 2Z5GA 4Y2QA 5D3ZA 5CT8A 3K2IA 5CXXA 4DYHA 2AJDA 2QJRA 3TEJA 4A16A 1DT5A 3A2NA 4EY7A 3MGAA 5ALEA 4BDTA 4DMKA 2XMDA 2XQJA 1KU0A 1VZ2A 1WHSA 5CBKA 3D4LA 5EIAA 2W6CX 5FOQA 1ISPA 4AZ0A 5AK6A 4A5SA 3OG9A 1CQWA 4BCCA 5E4TA 5A7FA 2ORYA 2CZQA 1MN6A 4PSUA 5HF8A 2XUPA 1HL7A 2XMZA 4IH4A 1YCDA 4GI1A 4PO3X 5JD5A 2VJCA 3E1GA 3AZOA 5IH7A 1CUHA 4KAAA 5DNUA 4FNGA 3RKSA 1J2EA 5JAHA 1QOZA 2Z8ZA 3GZJA 1UT6A 5C8ZA 4HXGA 1UZAA 1FFBA 1EI9A 4UBOA 1UKBA 2BJHA 5HCUA 2XUHA 1QIIA 4F21A 4X93A 5ALTA 2PM8A 4AX4A 1ZJ5A 3QPDA 3FSGD 4K2AA 3R3WA 2PKYX 4I4CA 4OB8A 2OPHA 5AKIA 3BDIA 1QIJA 1SCQA 4HRYA 4IO0A 5E2IA 1B6GA 1XLWA 1SCIA 1QZ3A 4BAUA 5AOCA 1PFQA 5ALIA 3FNBA 3WIOA 3STTA 4U2BA 3W05A 3O4HA 4GWLA 4FDMA 1XQVA 1N8SA 3W2TA 1BU8A 5ALJA 3EBLA 2JBWA 4CG1A 1GKKA 2DQYA 2QRUA 3UUFA 1JT2A 1JU4A 4Q1VA 5ALXA 2Y6UA 2VJDA 1ACLA 4Y2VA 1CPYA 5A6VA 2CJPA 4G8CA 1S8OA 3FSGA 3ILSA 3R40A 4BZZA 3IUNA 4AMZA 2QXUA 2VAVA 1BEEA 4G9EA 5HF5A 2HA4A 4J0GA 4MWTA 5FV4A 4G8BA 3WYDA 3WJ1A 5JAPA 5ALKA 3O9MA 2OLEA 1LPMA 3I2HA 2XMBA 2EDCA 3L1IA 4AMYA 5AKXA 4QZVA 4MJ3A 4J3JA 5T4BA 1IMJA 3VDXA 4X6YA 2I3ZA 3IVMA 2XUGA 4LHEA 2HA7A 1LBTA 1XFDA 1ZI9A 5CH8A 4XJVA 3QBJA 1WHTA 3U1TA 3BIXA 3DYVA 5HZGA 4B80A 1EDEA 2Y1KA 4LXGA 1R1DA 5HQ3B 4G8DA 4OD0A 1WPXA 3QYJA 2O2HA 4J0KA 4GDMA 2XE4A 2H9YA 2DR0A 1HLGA 3SWWA 5DNWA 3WKAA 5ISMA 4H7KA 3AJAA 4G4JA 2V9ZA 4B84A 1YA4A 4Y7DA 4Y9SA 2PPLA 1WB5A 2B9VA 4LXIA 5JZSA 1N1MA 5AKGA 2ZYHA 5J3JA 1DWQA 2BGNA 5AI5A 5AI8A 4DNPA 4KJXA 4EHBA 5AI4A 3E3AA 3M3DA
chains in the Genus database with same CATH superfamily
3LUCA 4RCVA 1IN4A 3R6GA 4AUNA 2BFDB 1P9RA 2JIZA 2VNKA 1G8MA 4TXLA 5F5XA 3FLAA 2JHGA 1Z08A 3TOSA 3ZHZA 3ESYA 2C00A 1NX6A 1MC1A 1N6IA 1FX1A 1V5GA 3Q87B 4M9SA 3V8VA 3AESA 4XQCA 4QGSA 2GETA 3K94A 4FGUA 2ZB3A 3EWNA 4L8LA 3UHOA 1JSRA 2COKA 1E3MA 1XJQA 3D0RA 3RADC 3LPDA 4HB4A 2PH7A 3R9WA 1US8A 3HNRA 5C7YA 3OFNA 1EIWA 3T61A 3TQIA 2J3DA 3OLXA 2WSSD 5GONB 2AJLI 1CZLA 2I65A 2JGEA 1HDXA 3L4KA 3H2YA 2L82A 2QX9A 4CT0A 3UPTA 1Q20A 1Z2AA 4YP1A 2ECFA 2HLDA 2Y4NA 4FIZA 4M9XA 5MN6A 2NAFA 2X8JA 4MUAA 121PA 3HEAA 4FMCF 1V8PA 2EIHA 4K05A 3BEDA 3SS9X 2A7QA 5JSUA 1DMRA 1NBMD 1NW9B 1II0A 2OVBA 4LY6A 4R1LA 3TIVA 1XT6A 3GAMA 1E0KA 2GHTA 5E7QA 4YI3A 3UJNA 1IJKA 2X9NA 3SN6A 1VP9A 1G5HA 2D5IA 1DFGA 1RXSA 3H6KA 4ZC1A 3V34A 2HNBA 3VZPA 1L8OA 1VJGA 4Q9JA 1BGVA 1JLLB 3T9EA 1J2TA 2WMYA 4DJAA 2RE8A 4DDVA 3FD8A 1K86A 4QGGA 5ICSA 4Q7EA 4E14A 1GTVA 1G4HA 3FOEC 2FJ0A 4KO8A 1X7YA 3A25A 3N8DA 3MMZA 4UBIA 1JTVA 5EMHA 5LZ5A 1GAWA 3SQDA 4BZPA 1NJ6A 4DNXA 4MGIR 3L8FA 3LWBA 5FI0B 1TPYA 3KT6A 1KKLA 2X8WA 4MIEA 3I01A 3E22A 3AETB 4OSPA 4XIGS 4JP2A 2QRKA 3HP4A 5EZYB 1S0UA 4BN0A 5JFGA 1FDTA 1KMNA 3LCMA 4TTJA 4EDFA 1AU9A 4AJEA 3AUYA 4UMDA 4OK6A 4V0RA 4ZU1X 1J9GA 2C9BA 3D6VA 1M67A 3L07A 3HB1A 4LJ8A 1O94C 3K16A 4RH0A 5HTKA 5FOXA 1N2HA 3GEHA 3OSUA 4RJIA 1TXGA 1D6MA 3DBVO 3J80A 4NJOA 3C5VA 1WUJS 3A2LA 3GJSA 3DZKA 1KIMA 3OX4A 4OTZA 2AKAB 1VJ1A 1YJCA 3HU2A 4UZSA 2AG0A 3DYBA 2IPOA 1T36A 2O3RA 1FP2A 2QTMA 3PT5A 4HAXA 1DOHA 4PM4A 5EMMA 3TAUA 3GHYA 5B6IA 2YIVX 3JVUA 2CSXA 1ZJ6A 4IYJA 4OV6B 2ZUUA 2OGTA 1G8AA 1OFIA 2ODNA 2IIVA 4MUKA 3DEKA 1P9OA 2EYQA 2E4WA 3BMOA 3TRFA 3ULKA 2PH1A 1DAHA 4ZCTA 3B6EA 5GZ1A 2REXB 2ACEA 4JUBA 1XKLA 3C8DA 1TCVA 3W5VA 1LDBA 3O31A 1PCXA 4C30A 3RIGA 4R8VA 3AUAA 3NKVA 3WICA 1F0PA 4FMDF 4L1KA 3HYTA 3RU7A 3F3MA 3H75A 3TE6A 1OB2A 4PNZA 4CT5A 4DLXA 4GDFA 4F5ZA 4WXPA 3COSA 4X8MA 5DTQA 1HEYA 1USWA 3OUUA 5BMOA 3PFFA 3N86A 5CA1A 2E4XA 4DA0A 4RQBA 4QUBA 3DDWA 1YKFA 4RNDB 2P2YA 3CT6A 5FJIA 1N25A 3K9BA 2XNJA 1M76A 3AEQB 3IT0A 3MWEB 4O4IF 2JI7A 1F8YA 4Z9AA 4LF6B 4NZNA 3QTBA 2IHNA 2C3YA 5B1HA 7ABPA 4DR6B 2Z4SA 3TM4A 5L45A 3DEYX 1HO3A 2AHOA 1KY3A 5H3CA 2AJ8A 2RG1A 3AEKB 1I24A 3GLFB 4RXUA 2HYDA 1MBZA 3PNKA 1FJ2A 4ER7A 5LU9A 1H2ZA 4EVQA 1GADO 1QKJA 4MWCA 2H8KA 2EDAA 4NFHA 2JFOA 4NMXB 5IUJC 4A4DA 5CG1A 1IUKA 4KUEA 3G8DA 4EKEA 5LZ2A 2RGUA 3ZY6A 2G4LA 3N6RA 3GOQA 3B9BA 1JR2A 2PBRA 3WYBA 4L9RA 2BBOA 3QE3A 5EWMA 2HRBA 3O5AA 4G0MA 4P35A 4RIFA 5HK9A 2DKOA 3NT2A 2Q8NA 2VLIA 1T1RA 3PQ3A 4UM8B 2RB4A 1TK2A 3L04A 1SURA 5I3CA 2QX8A 4BZQA 4RH3A 8AT1A 4MPTA 2C9ZA 3Q3CA 3SYKA 2REQB 3H1EA 4CM5A 5BSWA 1S2OA 1GZHB 1KQPA 2FZVA 2H3EA 3I1YA 4XM0A 2JCVA 3EUWA 5IHPA 1LBHA 4O2AB 4PQRA 5FL7D 1U99A 1OIWA 3REFA 1KWGA 5BOVA 2DHQA 2N46A 3I0ZA 1NF2A 1X1QA 2F7SA 4O4IB 5KYWA 1PJCA 1DELA 1QK4A 3JRWA 5AKLA 4Y18A 2H7YA 1IQUA 2GCPA 3R0ZA 3EFOA 1DUSA 2H31A 3M5PA 4LVCA 5AHWA 4AB1A 1UEIA 1W1WA 3GPCA 4MMXB 2WHXA 1QAOA 1BGWA 1DO0A 2HXSA 2BF4A 1MAAA 1WXXA 1ZJ4A 3A1SA 1M7BA 3JWIA 4HS4A 2H7VA 4MQEA 3RS5A 4BV2A 3B7WA 3K0FA 2GPTA 1O96A 2P9TA 1E1QD 4GPAA 4X64B 4Q01A 4J6EA 1RLJA 1R3UA 2Q27A 5KTPA 1KFKB 3SDBA 3DMDA 3NEPX 5HK8A 1VKOA 4IG9A 2R6GA 3Q1KA 1OWMA 3C6XA 3W5DA 4P83A 4QDKA 2VTBA 1M0WA 2H2HA 5I47A 3PICA 5FEMA 2CLLB 5BXQC 2FEWB 1KJYA 5DGHA 3CVXA 2EGHA 3EXG1 1JLLA 1BMDA 4Q19A 4J0HA 2YVKA 621PA 1NXOA 3W2HA 2VJNA 4ZVRA 1Z6XA 4AMUA 1YHZA 3OZSA 4IGIA 1IBRA 3AGPA 3HHEA 1GZ3A 3Q3IA 5ALVA 1CVLA 1LTHR 2QSYA 4IM7A 5GIOE 2AR7A 1W48A 1U1EA 3HO6A 3ZCVA 1V4NA 4DEXA 3A31A 4C20A 3VQTA 3VOBA 2IVZA 4GI7A 3M6AA 3M4YA 4HK4A 1ZW6A 2OCAA 2XQVA 3AEUA 5CG2A 4C7KA 4IPTA 5KYXA 3LCJA 4KOEC 4OFXA 4BQPA 4MMYB 4QXQA 1OUMA 3N5CA 3OCUA 1PUXA 4G84A 2HEIA 4HUTA 2QPAA 3PX7A 1Y48E 4N7RA 1NF8A 1RIIA 1TYBE 3X2FA 5I45A 1MLDA 3EPHA 1BCRB 5BUCA 4B3DA 4ZCIA 1G55A 1JTEA 2ZYGA 2OZKA 3GO4A 2Z3VA 3NYIA 1G8PA 4QQFA 3ZDFA 1RWPA 2DLDA 2QM8A 5HA5A 4LWQA 2WTMA 2FR0A 1DDGA 2VCYA 3GGSA 1Z38A 4MPRA 3H8VA 4C4PA 4KTTE 4BFUA 4HAVA 1OWLA 3KQQA 4HJRA 4OFZA 1XN1A 3L7DA 1E3TA 4ND1A 5DHQA 5LYJF 2BFBB 4JEHA 4DMGA 3U0BA 3BQMB 5LBIA 1QYWA 5KYVA 4ZRMA 3IOEA 4CQLB 4AO7A 3JASA 3SX2A 5ER6A 1NY6A 3LSYA 5L6MB 4MINA 2YHBA 3HKBB 1BWQA 3MXOA 4L72A 1UOQA 4B7UA 1Q83A 1P33A 4LCEA 5FEUA 2UYOA 1L4FA 4HB2A 3KZXA 3LHSA 4RY8A 4EVRA 1W4CA 4IQ4A 1AGXA 3I76A 5KSPA 3P2IA 5EXEA 4X54A 1J8YF 1UL1X 3TMYA 4ARAA 2JFPA 1BC5A 3CH4B 3V9AA 1C14A 1J07A 1I1QB 3EDOA 3GMSA 2DERA 2G28A 3AR8A 2VJMA 2ZTVA 3PNOA 5TB5A 4DIEA 2VK2A 4LJLA 2ZRAA 2CJYA 2RBEA 1ENPA 2AS0A 1Y3FE 4HZUB 3F47A 2F3PA 4JLAA 4MWGA 2WSMA 4ZHQA 2Z1MA 2NU6A 1MC5A 1EGMB 5FAXA 5KJCA 2IBTA 2DFNA 2REOA 4Q1CA 4BO4A 3PC6A 4UCFA 1HWYA 1I3MA 1PL0A 3HEBA 1EDDA 1EWTA 3KR9A 2FX2A 4B5KA 5AVTA 4NR0A 4J0JA 2GHIA 4QOJA 1I3LA 3C7DB 4K9PA 1EFAA 1SBNE 1YDGA 1KXZA 1NR7A 2OWEA 1XD2A 4GMDA 1M3SA 4KQEA 4KX5A 5DIZA 4DDTA 1R9NA 4LC0A 2GNAA 3G2NA 1QE5A 3DR3A 4QUJA 1PFKA 1X13A 3F3SA 2YQZA 1X80A 3OM8A 3QXHA 4KDFA 3ISTA 1GRRA 1QNLA 2CXUA 3P9SA 1L8QA 2H5IA 2MINA 2JFBA 4QUKA 4ENRA 4QTYA 2MWMA 2ZIEA 2CXOA 4DRXB 1XRJA 2QTAA 5B2FA 3ANMA 2FFRA 1T91A 1LQTA 2F17A 3M49A 4I1UA 4NARA 4DIMA 1SC4A 3JAKB 3U3XA 4E6PA 4QJBA 1CIPA 1XCJA 3P45A 1XQ6A 1Y1PA 1J0CA 2XWBF 4NL4H 5DTIA 1D09A 1XTRA 1DKUA 1FVHA 1KQNA 3VNQA 4OGLA 2C7PA 1BSVA 3DTYA 4FIDA 3KBBA 2IXDA 4IIGA 1NBAA 1B8NA 4D4GA 4DLWA 1VOTA 3H4MA 2E37A 2ZE8A 5FO0A 4A6XA 4IW3B 4UMVA 4YXFA 5KTMA 2DKNA 1E5LA 2JK0A 2YHUA 1DFHA 1VXRA 1RVDA 2KYRA 3A9TA 2M32A 3OQBA 2WKRA 3L43A 3A2KA 2V5AA 3GJXC 2D1QA 4PS1A 4DUZB 1YRBA 2J9YB 3LPCA 2QN3A 4HC4A 1KC1A 4WBXC 3EH2A 5I7VA 2F6RA 3C3PA 2QU7A 1LX6A 3Q1LA 4DYVA 2X0NA 1P61B 2HA2A 1Y3CE 3T3PB 2P5YA 4EHAA 3BSSA 1JKMA 3I34X 3CR3C 4FEEA 2X0EA 4BS9A 3DPSA 1EM6A 2C1XA 4HTFA 1VHTA 2I6FA 4M99A 3ZCPA 3VR4A 1UQUA 3TZLA 4DLVA 1W36B 4M0UA 4Q66C 4KQKA 1NIPA 4TMKA 1S2GA 4DCMA 2JIMA 5JZVA 1GZ5A 3NALA 1LJ8A 1T1JA 4QFBA 5F5NA 3GEMA 1RHUA 3TQHA 4L5BA 1A82A 3A7EA 4J1QA 2BGLA 2EP5A 3HB0A 1PW5A 5CW2A 2NXNA 3IV9A 3M34A 1NI4B 3C0KA 2I4LA 2V58A 2F9LA 3GU3A 1B00A 4HGQA 4LE2A 4QHYA 5EZQA 3MSCA 2P9FA 4OJMX 3SXUA 4ZEXA 5C5EA 3ET5A 1QX4A 4Q9HA 4OI1A 3TZCA 3TBFA 4UBMA 1H05A 1MTZA 2A9QA 4ERXA 4R0NA 4A2WA 2J6BA 5DGXA 4DMLA 3BERA 5DRTA 1LLFA 4ZT7A 3T34A 1KXJA 2BUBA 2V7GA 4HHEA 3R9IA 6ADHA 3ADBA 1M0SA 3S2SA 2KPOA 5DHTA 2NX2A 5JCOC 1UEXC 2SNIE 3BTUA 1H23A 1U7PA 5GGXA 2G72A 2XQGA 1JHRA 3ZBUA 5T8KA 2C42A 3H86A 2JCGA 4F4FA 4F3YA 4NAHA 1ZKDA 3THYA 5B3AA 5CIYA 4S24A 3TLZA 4RC9A 3ID6C 3KIPA 3TLAA 4JSYA 5KKCA 1R0ZA 1RE1A 4KBGA 1TTQB 3O3OB 1K68A 4YHBA 1YTUA 4KRFA 3VR5D 1XELA 3FRJA 3L06A 5AWFC 2CK3D 2OP1A 4P08A 1XLTC 5G3YA 3TAXA 4BFTA 2AMLA 4TSFA 4CV1A 1N7GA 1JR4A 2LP4Y 2FPUA 1S6YA 3TKAA 1XDWA 4BNDB 1WX1A 1DEKA 2E5FA 5G02A 3V4RA 3E5NA 4C03A 4CZ2A 2MSDB 4AYTA 3RVMA 2R1VA 5EVCA 3VR4D 2B2CA 1OPXA 3HVJA 1TQ6A 1H6DA 3ZC3A 3NNSA 1KEUA 1R37A 2GAIA 4D0NA 2P9GA 1QOQB 2BMDA 4JGBA 4PBSA 5JCZA 5FPHA 2DJIA 3TRHA 4L8VA 5BW4A 5K3DA 3KXDA 2IZ6A 3OEHA 5JNLA 2HQRA 2CV2A 1Q0ZA 4MQBA 2NU9B 3V00A 4UUQA 5IEJA 3U5TA 3CEHA 2ATIA 1E3WA 2XDQB 1A9QA 2O8NA 2PG3A 1FP7A 3W9YA 9LDTA 4F6LA 4W1PA 1T6XA 1DQYA 5LFAA 3UAOA 1DBWA 2IGBA 2IYAA 1ZIOA 2Y71A 2YIDA 1V43A 1N78A 4DBLC 2HF8A 4WKCA 5KMGA 5LMUB 4J4TA 5BNIA 3AL3A 2QLFA 4G6ZA 1U2PA 2XGOA 4TLAA 3HU5A 5IK2A 2EJWA 2QTFA 1Y3IA 3FYUC 4UM9B 2PL5A 3QEMA 3KT0A 5GINE 2P65A 3BTSA 5GIPE 4ARIA 1ZYUA 1PGPA 5D84A 2YJ5A 5DK6A 3WWEA 3MTQA 5EEHA 2YJGA 4LHSA 3HFRA 3RRFA 1NC1A 3P9QA 3FDIA 1ZJZA 5G1PA 5HCNA 2XOXA 1YR7A 3NEYA 4EO4A 3H97A 2OCDA 3RKUA 3TB4A 2X3UA 3Q7PA 4KQJA 3K0HA 4IIEA 5E1BA 1T29A 2MMGA 5GJCA 3VR5A 3EMVA 2F8TA 3BF8A 1RRVA 3DLAA 4F0JA 3FNEA 4RVNA 5JUWA 3KZKA 1ORVA 2WABA 1RMYA 1ZD5A 3BBPA 3EC1A 9GPBA 5K4HA 2RGNC 1J0AA 3HC7A 2IYTA 4OLFA 4ETMA 1CRLA 4WUTA 3DHNA 2CLHB 1WZEA 2Z4TA 5H70A 2X5JO 3MMPA 2XGGA 4DSOA 4QLAA 4HRAA 3FPEA 5T8KC 1RCUA 3KQPA 1LWOA 1DKQA 2EBHX 4HGYA 4QWMA 3PP8A 1YDWA 2FQXA 2I4IA 5B58C 3RGGA 3IELA 1CT9A 1CETA 4K03A 4HX9A 4J1TA 5HQJA 2CXQA 3FJOA 2VZ8A 3WWZA 1Y7LA 1J21A 5CFQA 2Q1WA 4I9HA 1FJXA 3LDHA 1FP1D 4K8RB 4CMJA 4Z2AA 3BB4A 1OLOA 1ACMA 4GVPA 3U44B 1JSXA 2PJZA 1V8BA 4XQ9A 5KDLA 4V1CB 2ZCUA 4HWTA 1I5RA 3DM9B 3PPVA 4JOBA 5ENZA 3VXKA 2ZZNA 4YMIA 2G04A 1T4MA 3M9LA 5EE5B 3H18A 5GWXA 3K2QA 2AQHA 5EWJA 3AR4A 3AIMA 5AKKA 4A91A 3W6OA 4Z4QA 2MSKA 2YWJA 3AP1A 4C0BA 1T9GR 3IA2A 1HNXB 1JX6A 1R0LA 5JG7A 4EG7A 3FFTA 1ZR4A 4W5OA 2E6UX 1KORA 3P19A 4C0LA 2G5CA 3KWLA 3W9UA 2UXCB 1AA9A 5T41A 4TV9A 1G4UR 4IP0A 1TYCA 4ACAA 2H4XA 1Z0JA 5BWCA 1UXIA 2IE0A 4ZRDA 3VNRA 3FNIA 1EG7A 4DJ5X 1HDIA 1AB5A 2DRIA 3EXFA 1W52X 4TVBA 2GESA 3MUNA 3LT0A 3ZWAA 1K7CA 3SC4A 2IK8A 1YFLA 4WZ6A 4FMPA 3JSXA 4OXIA 5GZ3A 1CJUC 1GCGA 1ADGA 2HO5A 1KYWA 4MKFA 3MTBA 3K0CC 2IYUA 3RRZA 1L4NA 3MELA 3BGIA 5P21A 1XTUA 3EBOA 1ZD2P 2GRJA 1BGXT 1E3DA 1GOTA 2PUTA 4QJIA 1AQIA 2PA0A 4TQGA 4EI7A 2FUKA 4KITB 2FW8A 3GOHA 3KJZA 3GLTA 5K3FA 3NBXX 1C9KA 4QBHA 2WJWA 3T52A 3PRHA 5AKYA 4NMWA 4OP2A 4DB4A 4YCDA 4EUHA 2GTPA 3D54D 4ZEVA 4LJSA 4YUWA 3TUZC 1YS7A 4B0PA 5IVPA 1M10A 3ORRA 4M6WB 2BTQA 2PVSA 1ZHHA 4KDEA 2AZDA 2XZDA 1MFZA 5E9AA 4CG3A 1A7JA 1GNPA 1N5DA 2EJVA 2PGJA 2I7CA 4K9QA 4LXTA 4CF7A 1T13A 4KACA 4WBNF 1KWKA 1PLJA 3O0TA 1NN3A 4A0QA 2PSJA 2OQVA 3MCTA 4QU5A 3O9ZA 3SNKA 3GJZA 5LZ7A 4M53A 2OQ2A 3DNFA 4UCXA 3NHZA 3JQ8B 5DNAA 3SC2B 1E2BA 1ZCJA 4XE5A 4MKHA 2IZZA 2B7BA 3L8YA 4UBKA 2BMAA 4MB6A 4DHEA 3U4DA 1W4BA 2H7CA 2ZBDA 2YQ4A 2V8BA 2OYCA 4YASA 3CH7A 2V7VA 1QDLB 2DPXA 2EC5A 4DSUA 3A04A 3GLFE 2Q3MA 1UC5B 2PX5A 3ISJA 2GBGA 4I5IA 3WMWA 3LT1A 4M4SA 1E5XA 1P5HA 1YCFA 2WZBA 2YYSA 4RMJA 4N7JA 1WEKA 1YB2A 2W2PA 3IDQA 5LNK1 5E6RA 3SJBA 2LBPA 5BSRA 3WLQA 4NHOA 2X5XA 1XZDA 3I83A 1U0NA 1IC6A 3L6EA 2WG1A 2OXRA 1H2HA 3HM2A 1O5OA 2JZCA 2PRIA 3DKIA 3ZZNA 1UKVY 5I8WA 4ISBA 3A32A 3CLSD 5A05A 2QRVB 4YAJA 5BT9A 3BH7A 5DHRA 3ABSB 4M9UA 4JDUA 1II8A 5DBFA 2IE8A 3TUJC 4F7DA 1MQAA 3M89A 5TE9A 1LY1A 2JLSA 3CZMA 3IH5A 1PKEA 1KVSA 1E61A 1H2AS 1MVLA 1XZEA 2NZ8A 3PDUA 4E33A 3VO1A 1P4GA 3F7NA 3U7QA 2PAAA 3Q85A 4A82A 3NVMB 1SBCA 3LZ6A 4C4RA 3Q7SA 2YZGA 4JXKA 5ALYA 2ZWIA 4H0NA 1P5ZB 1VZ3A 4F8JA 5G2OA 1RI4A 3HH8A 5FFNA 2AFHE 3HUUA 3BT7A 3OZFA 1E1NA 1MDFA 2B6NA 1VL0A 1IUNA 1YIDA 3B8HA 4UM9D 3MD0A 4YAIA 2C5FA 5B1DA 3ZN2A 1W88A 1Y4AE 3P52A 4FZRA 4PV7A 1QB7A 5KTSA 1FU8A 4ZXPA 5CTJA 1J00A 2ZWOA 4C06A 4LYDA 1HMPA 1WVMA 1YDMA 4M55A 5A06A 4RTQA 5LKRA 3PGJA 4Z0TA 3VPAA 3SYNA 3OFKA 2IELA 4KWIA 2XUIA 4GEKA 5ELLA 4ZVQA 3RSSA 1GN8A 2HCRA 2Q49A 3DC7A 3KP1A 2JKVA 1LVUA 1XCGB 2HIHA 4P6VF 1YI8A 4AK9A 4MP6A 4DV6B 3TM5A 4TGLA 1L3CA 4RZUA 5HKBA 1FE8A 5JAOA 5AHOA 1VL5A 5KQLA 1UOEA 4O02B 3EVBA 3QWHA 1Z62A 2ZIWB 3A0UA 3CF4G 5JS8A 2RHWA 1AUOA 4X62B 5J4KA 3ENVA 4DABA 3IEIA 3P96A 4N8SA 4F6CA 2XYHA 1A77A 3AB8A 1WXWA 1Z2NX 3KB1A 5I7EA 1RWWA 3ZZ1A 1SCDA 4MS1B 3PNVA 1JNYA 1IH8A 4N12A 2WSSA 2SECE 3K20A 3ROFA 1QONA 3ORQA 3JPWA 3CX8A 1RWBA 4ZJPA 3DOFA 5DLYA 2IHBA 4W1RA 3FCOA 1XRPA 2B82A 2HLDD 4NMLA 3TCKA 3RU2A 3IPXA 2MYUA 5B3JC 1U8UA 4LZPA 2C77A 4H7IA 3K4QA 3N2KB 2FSVC 4FDTA 4IHJF 4NPCA 3PNQA 3Q6NA 1FFHA 4HMQA 4JWKA 4ZA2A 5F4BA 3RASA 3TTSA 1YSCA 3F4BA 3W6NA 4X3OA 1NBMA 2J3LA 3ROMA 5IAKA 4YDQA 4PXYA 1DWOA 3BHMA 1O87A 1OBVA 2XGMA 1QFJA 1SY7A 3KOXA 4XYLA 2CXHA 4DLBA 3OEWA 4B8ZA 2P67A 3B5IA 4ZVPA 3D0OA 1J5PA 2AOTB 3DOHA 3O4GA 4M1KA 2VPWA 1MX9A 4UVIA 2EP7A 3L1UA 1LJLA 3FOFC 1R0YA 2GDJA 4XDGA 5TMBA 2YZ2A 1TT5A 2PK3A 1P2FA 4YQZA 2C5EA 4EZEA 4JI4B 1GCAA 3H9CA 4UCWA 5TJ9A 5FNVF 1TUEA 1SA0B 1TKAA 2A5LA 2J3HA 3WLIA 5FBZA 3LDUA 4Z7QB 5GJVC 1ONOA 1G2OA 5ANRB 3U4GA 3WHKA 3C8MA 4QXRA 3WV5A 3BYZA 3S4YA 4CKXA 1YV9A 4JI6B 1NU6A 1BW9A 1NKTA 1AHIA 1EFPA 5A71A 2ZJ5A 4UPVA 5L3QB 1SUIA 2IXTA 2P11A 2WG0A 4OHWA 4REMA 5FHQA 2RHRA 3W5HA 3HMQA 2X15A 5BRJA 4TKMA 4BWYA 4JK3A 1PFUA 3KVVA 2H08A 4PIPA 3WKDA 4F3NA 4Z4CA 1CUBA 2DXIA 4JLUA 5TVKA 2QY9A 4K28A 1F38A 5HBGA 3RRXA 3HKCA 4ZTBA 2NSLA 1WP4A 3R6WA 4WK0B 3CWQA 1BCRA 4Q3KA 2DP4E 3NW9A 2RHHA 2JHFA 1AIPA 4NMHA 2CY0A 4UMEA 2PXAA 4H15A 4I99A 3DMTA 2RI6A 3ORHA 1Y1RA 2OHXA 4BNHA 2A6PA 2K6GA 3ZJYA 1OGJA 1ONSA 4Q82A 2P35A 5DCYA 3W05A 4CM6A 3OJFA 2XUFA 3B48A 2ZRMA 4X5OA 3UPDA 1M6EX 5HP4A 1OT5A 1OA0A 1XC7A 1QIMA 4N76A 2AKYA 3JQCA 4KUHA 4E6EA 1Y6GA 1G38A 1F4LA 4EM6A 2ZIXA 3AOEC 3ML1A 4WFQA 3FDXA 3SC6A 4WBNB 2HTEA 3CNEA 2IYQA 1IQ0A 3FGOA 2GR9A 3IHWA 4QOHA 4JJIA 1H1LA 4XRRA 4RU1A 2GAOA 1TCAA 2OZLB 4GLOA 1LF5A 4G5YA 1X3SA 4IMIB 1GITA 5EERA 2BI8A 4NI5A 2PANA 3D0KA 3OOJA 2O20A 4JU8A 3RB8A 3FGPA 4EF4A 1O89A 5E9QA 2VF4X 5C1BA 1MPXA 3RYCA 2PUEA 1GUFA 3FDFA 4XXHA 4BUJA 3T6KA 1LH0A 3UHAA 4EWLA 2VHXA 3V8NA 4QOSA 1VBKA 4ZZ2A 2WD9A 3ZLUA 3MJSA 3EFOB 5IYZA 3AJEA 1G5FA 2OZPA 3BXFA 1N7JA 1Q0QA 3ZCSA 4MHTA 4CM8A 4CLHA 4R3WA 5IX8A 4L7VA 4ZJUA 2CDBA 9MHTA 3N39C 3GLSA 3VV3A 4Q9KA 1ZMOA 2WFZA 3L0PA 3DF7A 3VVBA 1I7PA 1MIHA 4OB6A 5FV7A 4TUYA 5A4AA 4QU0A 2F3SA 6NULA 1O77A 1RWNA 3AIKA 4HBZA 4PX5A 1P9WA 3RDPA 4EJ2A 1XZQA 3J81k 3ZY5A 2GD6A 2OSVA 2PCLA 3AR2A 5KSZA 3HABA 2AT1A 2MDTA 4OHYA 2VNAA 4BJHB 3DEIA 4DLTA 1ZM7A 2Z2YA 1MB9A 1AGYA 1Y8AA 4D0GA 3PQ5A 1SQGA 5IAJA 3K6KA 3Q7RA 3V80A 4C88A 4O2RA 2R11A 4RWZA 3GN1A 1B93A 3RG2A 4O4LF 2PTGA 4N6OA 2IS4A 2QVBA 5I9MA 1VYVA 1JSLA 3AEKA 4RQAA 3DTTA 3UHFA 3LBAA 1FOEB 1NA5A 3LU1A 1J0XO 1ENOA 2V0NA 1T5BA 3Q88A 4MVJG 3O3CA 5JT1A 1UKAA 1JG3A 4CWAA 3ABQB 1V1RA 3C3JA 3CVVA 5K45A 3TDMA 3Q7QA 1YTLA 4NYMR 4WZZA 5EWJB 1EGVB 4LF8B 2FW7A 5AM2A 4NV1A 4K40A 1UC4B 4U7JA 4PQEA 1ZWKA 1CDEA 3LPMA 5EXTA 3TYXA 2CMFA 3P2YA 4BYGA 3BCSA 4G97A 4KWTA 3W8FA 2YMLA 3KG2A 3QLJA 1JIUA 1R6DA 2H1CA 3PCRB 5GPBA 3V1LA 5A5FA 3U17A 1Y81A 3L4BA 2JEZA 3DT8A 2OHVA 3O26A 5HG0A 3ZU6A 1FNNA 4NCBA 2ERYA 3L79A 1E79D 1XVAA 1OU4A 2XE8A 3KXKA 4C0HA 4YAUA 1AH2A 4JMLA 2NYUA 1KO5A 3V4LA 1LDNA 4G25A 2ZM5A 2XUZA 2GHRA 3MHTA 1IHYA 1PR1A 3F74A 4LSMA 4PCUA 1PT7A 4ZI7B 2UU9B 5J1TB 2XIJA 3DBLA 2I4RA 2PTHA 3E82A 3RVSA 3WIVA 1N75A 1VE9A 4PU0A 2B6HA 4MS4B 3ANLA 3FUVA 4Y0VA 1NBHA 2VJPA 2HXGA 5BYBA 5IF9A 4BO7A 4GR4A 3USZA 2VQSA 3ZY2A 3FPAA 2OL4A 3ONEA 4OFBA 3VUFA 4LXUA 2Q3HA 3BIFA 3VA7A 3ETGA 4AZ0B 2HN9A 3ANTA 4V0MA 2HF2A 3HN6A 5AR1A 3VOSA 3F71A 1YC5A 4JHXA 1VIYA 1JLMA 4E31A 3BMXA 1E4YA 1QFZA 1CY6A 3MRSA 3GMDA 4IO1A 3EXFB 4KBFA 4LRUA 4LKOA 1R0BA 3UK7A 3MHPA 3UGKA 2VKTA 2ZIZA 2BMJA 1NAIA 3KS9A 5IJ0A 2X2PA 3DOJA 1TMYA 3QJGA 1FYDA 4FC7A 5H1YA 4J0CA 2PXCA 3PD7A 3HY3A 3L40A 2D2EA 4L6IA 2JW5A 1HLPA 4QNNA 1TA0A 3RUAA 3TFOA 5SYNA 1D3AA 2YRXA 3GV0A 1M34A 3HV0A 5ALWA 3A6KA 3NOXA 1GCIA 2YN2A 3GR6A 3O1LA 4YDHB 1NT4A 4LFCB 4NK5A 1NWHA 1D2GA 1J7KA 4X92A 1RJEA 2JI4A 1MHTA 1TI7A 2LUOA 2O2IA 3DLIA 3FCCA 5KBYA 5DYWA 1AN9A 1BVYF 5H8WA 4N8EA 5BYKA 3OWOA 4ENTA 1KYZA 4PYOA 4TTRA 2ZDHA 1T1GA 1N3LA 1J9ZA 3L49A 3DWIA 4M0LA 4UATA 1JJAA 3IIJA 3T3DA 3PE4A 1I32A 1E79A 1H93A 1TT7A 3D5EA 3GUUA 3INNA 2WYUA 1U04A 2FZCA 5I8ZA 4E3ZA 1A71A 2NV6A 3OO1A 4D9NA 1QPZA 4RHTA 3FCAA 2VHWA 3LX4A 3NHFA 1CJMA 5FD8A 1OI3A 1AV7A 1JXOA 2ID9A 2BWJA 2AIRA 1WU8A 4W1QA 3AR3A 2KQUA 4UMFA 3NFRA 4FOPA 2CYCA 5ER9A 2FOLA 4MQ6A 1JR6A 3I92A 1NASA 2DGDA 1V35A 4WSOA 1PR6A 3TSAA 3VR2A 4LSWA 1GDTA 1C3LA 1TK9A 2A1UB 4RKRA 1S5PA 1EB9A 3BHJA 2Z95A 4TYQA 3KD2A 3Q3JB 2WJJA 2Z83A 4JB8A 5EHQA 1T1IA 2PUWA 2IYFA 1KDPA 4JBXA 3MJRA 4O5AA 3EWSA 2G40A 1Q22A 3FKJA 5E6SB 4DLNA 1XZJA 5K6AC 3OOSA 5KHOC 3NWOA 3OIYA 4OF4A 3K9QO 2ZB2A 4HMOA 1M2WA 1YQDA 4EW2A 3CWZA 1LA2A 1YRWA 3TE7A 5JSQA 1E6EA 5KHAA 2R7LA 2Q1TA 4DV1B 3KWFA 4M0FA 4Q4HB 4D4JA 4MDFA 2QL6A 5MF6A 1IYZA 3DA8A 3P5BA 4Y6SA 1IZ7A 2R4UA 3EZ9A 1HQDA 2AW5A 4Q05A 4XCXA 4YMWA 1A04A 1KYIA 2YUIA 2I2BA 2PQ0A 3IHTA 4ACBA 4CFSA 4YCSA 1CEYA 1B41A 5EP3A 1RZRD 2PQ2A 3MJHA 1S1MA 4U3JA 5LA6A 1KY2A 4FINA 5E1OA 4I4NA 4JLMA 1ZS9A 3OJEA 2F1OA 4GOJA 3IS3A 3LYUA 5LQKA 1P3Y1 2XB4A 3VMFA 3EMKA 4KW7A 3I12A 4M7WA 1XZCA 3TLJA 2Q5JA 2RBKA 3ZVRA 5JTTA 1SM4A 1QCZA 4PAMA 1OGIA 2Q0HA 4OQPA 3A9RA 1HA3A 1CNMA 1X15A 3OHPA 4MUBA 2C3MA 3FTDA 1G63A 1RQXA 2C1EA 4MQFB 4NE7A 2I1QA 1QFSA 2QTNA 3SR4A 4DT1B 4EELA 1CG6A 4BNDA 4MVJA 2DPGA 5KOHB 1XRRA 3DT9A 3VTAA 3K1AA 3AX6A 1A9SA 2CL0X 5K2OA 1HI9A 3UK2A 3C7TA 4NZYA 1JHDA 1I4OA 3H7IA 4L50A 3X1WA 2Z6QA 1RPTA 1JHMA 2GQ0A 4GQIA 1Y7PA 4D5EA 1TAUA 3C15C 4HQOA 1W8IA 4WNAA 5DYIA 3NTVA 3B20A 3TR0A 2CCKA 2QTHA 3VNSA 4JOQA 4GT1A 1E7MA 3ABZA 2XRZA 5C46F 2DH5A 2ZJYA 2IJGX 4U1RA 2AG8A 3WGQA 4LXQA 3VC2A 2QBYA 1WF6A 2GBPA 4QPPA 4GOLD 3NT4A 1SCKA 1Y6QA 5KWIA 3U5ZB 2GTHA 3AK4A 2WJ6A 1OBHA 1BFUA 5F73A 1OTXA 5D2CA 3ECCA 3BKWA 2VN8A 4NULA 4R31A 1QCDA 4OXRA 3ELYA 3VOTA 2CK3A 4IMPA 2HCTA 3PQ4A 1UBNA 4DIFA 2XZLA 2A5FA 1BE1A 3TTXA 1W0JD 1O95C 3O38A 4AZTA 4LHZA 1NVVR 1NZDA 2OXIA 5FDFA 1LLCA 2FMFA 2W4QA 3CM0A 2HGZA 1KNXA 5AW8A 1HNWB 1H4SA 3EJWA 1SKQA 1MJFA 1QFMA 1Z4KA 2IDMA 4D9GA 1NHWA 1VI6A 1TPZA 1XCBA 3ADCA 3K1TA 1QVAA 2J0VA 3UA3A 3KSAC 1A76A 4PSUA 3JVEA 2GGSA 7REQA 1VIMA 2ATXA 4BX3A 2HMSA 3IP9A 4ZYXA 4YT8A 1KMHA 4LQLA 2YFKA 4FTWA 2AE1A 2VBFA 2G82A 3OEHD 1IY0A 4ZQCB 2IEGA 1WXHA 2D3TA 3CWCA 3QEMB 3MSXA 2B4AA 3C70A 1OILA 3OMXA 2ZRPA 3PB3A 4BLSA 4TKVA 1OASA 4MVJE 3WDLA 3HBAA 4F60A 5IMBA 2P90A 2G6BA 4Q3LA 4BNUA 5KTRA 1JG4A 1PZEA 1V48A 1W2WB 3KKLA 4OMUA 1YZ3A 5F1PA 4C22A 5LJIA 4XGRA 4Z7JA 3ELUA 1SVIA 2CUZA 4BQEA 4EYGA 2PZFA 1NYQA 2OCLA 2QUZA 4IMJB 3WJ2A 3ZQ4A 2PU7A 2QD2A 3LKDA 5BP7A 5IK2D 2AL7A 3E4DA 2ECOA 1A96A 3CE6A 2BM9A 1GV1A 4HB0A 4M22A 1KSFX 2WOOA 2CVQA 1ZR2A 1BEUB 3D7LA 4OB7A 4YFYA 2Y0BA 1T3HA 1Q0LA 1YBVA 2VJYA 1WKCA 3I6QA 1TAQA 4MS4A 1PNRA 2PBLA 1P1FA 3WL4A 2X0KA 3DBLB 4DCOA 4O1IA 4XX0B 1Y42X 5L3VA 3C87A 1KRHA 1DU4A 4ZVTA 2IS6A 3GNLA 3TBHA 1NTRA 2YBDA 2C4TA 1QG2A 3BXGA 3BD8A 4TMWA 4L0DA 1W36D 4Q3DA 3LCVB 3RFVA 5HTOA 4HQRA 1DAEA 3T99A 2TS1A 5DSZA 2GVZC 4LDJA 1XQWA 4RQTA 3U13A 1W0JA 1AMNA 1VPEA 4Q3EA 1TZMA 4AW9A 4GVXA 2XCRB 1A4IA 3IQIX 9LDBA 4HQNA 2WSLA 2P1RA 1N5JA 3A9CA 1JWLA 3ANNA 1M72A 1UMCB 1IE3A 4Y2TA 1UPFA 2V6IA 3REQA 1CUVA 5BNTA 3ED1A 2ZK7A 2O50A 5HVNA 2NYVA 5D1HA 1TFUA 1UADA 4QU8A 2V74B 3EAFA 4EHHA 1RM4A 1YASA 4DDHA 2AMVA 4FW9A 4P3XA 4H7DA 4LY0A 2RG7A 3V55A 2CMGA 3ZVNA 1YOVA 2QL7A 3KJIA 2GSDA 1ZUIA 1EE9A 1J70A 1THZA 3PHIA 5TSDA 4Y3UA 1H3NA 4B31A 5F7ZA 4OUDA 4NOJA 5GADl 3U7FB 1E3IA 4YJ3F 5J2TB 2I1VB 1K3TA 2H1IA 4KAJA 3UW1A 1HMYA 5FOVA 1KAHA 4M7OA 2JGDA 2DM6A 2JRLA 5AOBA 3PGKA 4Q4CA 4B2LA 1KERA 3OLVA 3T4UA 1CTQA 1U7DA 4JQYA 1RACA 3PEWA 1VFPA 2I3GA 2OECA 3K0CA 4TLLB 4P5PA 2Y1EA 4ZQHA 3FOWA 4FFVA 3DZCA 4LNAA 1KEPA 3DKRA 3OBIA 1O95A 1GA4A 1TK3A 3E7PA 1TDJA 2QTZA 3OQPA 2FK7A 1GAQA 3K0FB 2AFIE 3EGIA 4IDOA 5GONF 1C41A 1Z07A 2JATA 3EXG2 5CLFA 2R68A 5BN5B 1E6UA 1Q1NA 3PUIA 1MZVA 1XZGA 2GLTA 3DMNA 4HLDA 1I94B 2POQX 2JPDA 1W44A 1PR5A 3KUDA 4WFIA 2Y0DA 1JEEA 4X6UA 4EY5A 4JV5B 1USIA 3I30X 4H1VA 4KRXA 3A8TA 3UKDA 1IY9A 4GLJA 5D6OA 1V47A 1ADJA 2QZPA 5FADA 2DKFA 1APBA 3CKYA 1EESA 2FP4A 1ECJA 2I2CA 3JD0A 4C4YA 4QYIB 1IAQA 4RY9A 3LI2A 1U9CA 1J1ZA 4ZPJA 3WLMA 1XMSA 3GELA 2HA6A 3D3QA 3QV2A 2PVPA 4LRWA 4CLXA 1VBNA 2VOEA 3BRWA 4Q21A 3F73A 1EUDA 1KI4A 5FUWA 3VJLA 2A30A 3ILVA 2E4YA 2PUDA 4GRAA 3VU3A 1JSCA 2YXPX 2FMHA 2QN9A 2OV1A 1ULBA 3AVQA 3PTAA 3E2PA 2GLUA 4B6EA 4DCSA 5M34A 1AMUA 3AHGA 4O4JF 2OZEA 4DV4B 2P1DA 4HDAA 5DB4A 5JNRA 4OU4A 1TLFA 2CNNA 5GJBA 1M33A 4BNMA 4TLMB 1JG2A 4AAYA 3NB0A 4CKWA 3T7RA 3LUAA 4B3RB 3OPVA 4EGQA 4DA7A 3JV7A 1Y1LA 5A3QA 4L9AA 5FLXA 3CGWA 2EVWX 3K70B 4NPAA 3UTDA 3I6IA 4TOIA 3VOAA 4C01A 4UFPA 3O83A 3GCZA 2OPBA 1YBFA 2WSYB 3EPKA 1DB3A 3EZLA 3SG0A 3DFIA 3WTBA 4BFLA 1P7VA 4BJ5A 3VKUA 3E35A 4PC2A 1O0CA 3QYPA 2RHBA 3E2MA 2QM7A 4Z7NB 1EMDA 4DMCA 4AO6A 4PN3A 3UOGA 1J22A 1XDBA 5LL6P 4KAFA 1TEZA 1DAGA 3I6ZA 3A27A 1R8XA 4UUMA 5BW8A 2YIMA 1L5LA 3FDZA 3AVYA 2ZRJA 2ZITA 3GUYA 4DXHA 4D46A 2BCGY 2CD7A 2RGWA 4QUAA 5LQJA 2N1BA 5T4HA 3CRNA 4MUJA 4ZAFA 3WNVA 4EJSC 2I91A 1S1CA 4Z0NA 2G4CA 4LZOA 4X8HA 4I3GA 2AR0A 3RTAA 4RPCA 1O58A 1R50A 4YRPA 3TQOA 4ALMA 1N34B 2GK3A 2O8EB 1GGFA 2FDRA 5BQFA 2L18A 4I66A 3R4VA 3ND5A 3BX1A 3QUTA 2VXBA 3VR6H 3LZDA 1VLMA 2OD7A 3RFCA 2WKPA 1H69A 1B0PA 2YNMA 3KJXA 1XL1A 4MKIA 4CKEA 4RAOA 4FUQA 4QEDA 5CK4A 5CTAA 3WR5A 1HZZA 4D96A 2O2ZA 5JI2E 5CITA 4PLHA 5EESA 2XNHA 3EG9B 3RFFA 4GZ3A 5K05A 2PYIA 2HJWA 2DOKA 5FPPA 2C9DA 1JPJA 2WE7A 3K6SB 4PO8A 5A0FA 1QLWA 1M0TA 3CNOA 2RC6A 1WDWB 1JH9A 4DB2A 3U7EB 3EA0A 4N3AA 5HX7A 2B7LA 2DAPA 2QR2A 3OJLA 3QENA 4OQEA 4TQUS 3ROGA 3ZLVA 3WSTA 4NABA 2WFLB 4PINA 2DCMA 4AXXA 5IHXA 3AHIA 3EZFA 2BMWA 2YOGA 3AI7A 4GX5A 1RRMA 4E15A 5EHZA 5JD6A 2O57A 5K0SA 2O0HA 3D4OA 3JWGA 4AYWA 2QXYA 1M8FA 2W90A 2Z56A 4IQGA 3WLHA 2D3WA 4CLRA 3FKSA 1L5QA 1GNSA 1NZJA 3GL9A 3WGYA 2D06A 3H19A 1GGMA 1U3DA 1FC0A 1SZJG 4M37A 4RPHA 2RMKA 5E6RB 4D9JA 2ISQA 1BIFA 2BISA 5E7IA 1L7OA 2UAGA 1NT2A 1ZNQO 2ORVA 2X2EA 4NYJQ 4CEIA 1N0IA 3UCFA 1V5IA 2ARKA 2Z09A 3CJTA 2PMDA 3PZBA 1SR8A 1UOOA 1HDGO 1I4WA 4KIGA 1IHDA 5K8CA 1KR5A 4J03A 2FRXA 1MORA 1YBAA 4M89A 4DM3A 4C2UA 1ORRA 1EUZA 3M2PA 2F90A 4EEXA 4IXWA 3HEMA 1C1DA 1K27A 3DFFA 4KV7A 5C8DA 3T5PA 4RORA 2FF5A 2R4QA 2O1WA 2YASA 4XH9B 4CLRB 2Q4BA 3WXBA 3F1LA 1HLFA 4CQNA 3D02A 3CRVA 4Y6OA 3KQNA 2HGSA 2R6HA 3B5EA 4NBRA 2OKGA 1RQ7A 4BV9A 2NWQA 2JH9A 3DLCA 2JAQA 5HDQA 3LQ4A 2HC9A 4XIFA 3AILA 1T3GA 3D2LA 3NOVA 1YD7A 5I01A 1OXBB 1T9HA 3L6BA 2W6JD 3STUA 3WMRA 1MO2A 2JC3A 4TRNA 2Q6VA 1BAPA 1OIVA 4FHEA 2WAYA 5IVIA 3PS9A 3RC2A 1ZPDA 1NG1A 4C21A 4W9NA 5BUSA 3FJYA 3Q8WA 4K7JA 4BX0A 4CMGA 3EG9A 5CVTA 2C07A 5E2BA 1XZBA 4HSEA 5FXMA 3U7QB 3TJRA 3Q0IA 4HN4B 3IHKA 5FR1A 2O8DA 4RXMA 4N5DA 5TMEA 4YCJA 2ZYVX 1YR1A 1YDFA 2B1RA 2B61A 4CBVA 4RX1A 1PU2A 2I1LA 2OOKA 4N8DA 3G2HA 1QGZA 4D9IA 2XBMA 2V54A 5FR2A 4CF4A 2KE5A 5BSEA 5FX2A 1YJ5A 5LZ9A 2BHLA 2W37A 3RUDA 4NV0A 4GG1A 2G4VA 4ZCPA 1KDYA 4GUAA 4O4HA 4GEGA 3QLVA 2XT9A 4I1PA 1VL6A 2XB2A 2P0AA 2VDWB 3DHWC 1EB8A 3CUVA 3GEBA 5FI1B 4YR9A 4DPMA 4FILA 5JS7A 4RJJA 5J2TA 1G66A 3GDGA 4CKWB 4MCAA 3RO7A 5AHXA 4F6RB 5FBVB 1QP0A 3A2MA 1L8LA 2PAFA 4QOGA 5LQMA 2F2TA 1B8UA 1R64A 2QL9A 3SD7A 3VX4A 1QP4A 4NS4A 4ZMSA 4R0VA 1T3SA 4BC1A 5DXJA 4B5LA 1EXMA 4Q7LA 1FRQA 1RI3A 4RNCA 4UDYX 2OV4A 4GSYA 3WYEA 5JH7B 4KR3A 1Y9ZA 3TF5A 5DNEA 2HQBA 3SBXA 3TW6A 1UBKS 2H3HA 5J23A 2WF9A 4Q9AA 2PYDA 4JQZA 1S2LA 3BB3A 1PYOA 1RP1A 4UXJA 1NNSA 3CPJB 1X92A 2HWKA 3KLOA 3AB3A 1VMIA 4WH0A 4WQMA 5F2EA 5CAEB 5ICGA 5EIXA 2WFLA 3W7VA 1E9BA 2JLQA 3WBFA 5F64A 3SE0A 2A7XA 3FG9A 3WL6A 4ZYTA 5JU6A 4V1CA 4FYVA 4S0XA 3HWWA 4TZTA 1ZN2A 4KPFC 2UYCA 2IF2A 3ZDZB 3DXFA 1Y9JA 2EWVA 2JARA 4TZ0A 1PX2A 3C3WA 3TSWA 1O08A 4KR7A 3DV0B 2J1LA 1SKBA 1TD9A 3K6SA 4GGOA 1BRTA 2GJ8A 2PU5A 1H5NA 4OGKA 1CVRA 2YC4C 4O25A 1UBLS 2PKQO 3EY4A 4WVLA 1PWHA 1EBUA 2G9RA 4EA7A 3P94A 5GZ6A 3NVKI 1VB5A 3LRPA 4CVNA 4ZYZA 2RCNA 3E5HA 2GF0A 3C6QA 1X8JA 2X4DA 4MI6A 4QPJC 3U3MA 3ZDDA 4ZDKA 1VE3A 3WGUA 3PXGA 2EL9A 4FX2A 5LPNA 3TD2A 4H27A 1KEWA 3VH2A 2EZ4A 1YB1A 2V6FA 1REQA 3HDGA 2BSQA 2C1ZA 5A3JA 2PD4A 2J9XB 1N2IA 3KSUA 4MA0A 2Q1XA 4BQRA 4M1MA 5TPWA 3HU1A 2R62A 4BB0A 1IHOA 1KQOA 4QELA 3H83A 2X40A 5COQA 1U2DC 4A8JC 4JB2A 4DIDA 4Q18A 4Q9NA 1HSZA 4Q48A 1R6XA 1A2OA 3I4CA 1U8CB 2XOKA 1TUGA 1V7ZA 4YRRA 2GJKA 1Z6PA 1F6WA 4NYIR 3ZWOA 1L1EA 3GJ0A 4RHEA 2CE7A 4D8WA 1GEEA 4EZIA 3MOIA 3MB8A 5HILA 4TVSA 1MB3A 2WTUA 2IL1A 3DTVB 1TQDA 3WNQA 3O4JA 1R0CA 2QW8A 4A23A 5ICCA 1QPBA 2J4DA 4GWKA 1ISJA 1RWKA 1DXHA 1SK8A 2FMIA 1F06A 2NVWA 2EKBA 2P7IA 3BWVA 2QOEA 3FYSA 3GFBA 3N07A 3PDCA 1UMCA 1BOOA 3BF7A 2K7ZA 3JPYA 5DULA 5EN4A 3CCCA 4BAGA 3TX6A 3KWJA 4QT0A 3WK5A 2Z57A 1D4OA 3R3XA 1BHJA 1MMFB 4PHCA 5AFSA 3ZHVA 3FMPB 1Q0UA 2DMRA 2P69A 3QFHA 4RS4A 2FHPA 3BFPA 3H5RA 1DCKA 3KQMA 4MP8A 3TLXA 2G63A 3WGNA 5KYUB 4PFQA 3SY8A 2QROA 2I1WA 1H0KA 5CT9A 3R74A 3F6YA 1T9BA 3ENZA 4M54A 4UHCA 4JYZA 5EE9A 3RUHA 2Y9MB 5LQDA 1PD1A 1PT9A 3AUKA 4BWVA 4LXXA 2ZGVA 1TGVA 3W3AD 2QYSA 1SCUA 1IATA 5DOZA 1DQNA 2G7MC 3AM3A 1JQ5A 1NVTA 1X1EA 2EKQA 4GYKA 5EUBA 1US8B 3LUHA 4KK3A 3RWBA 3SFTA 1YA8A 4KH1A 1V95A 2KMLA 4N5LA 4EUEA 4CHTA 1BS9A 3T1VA 5FWAA 3R6TA 3P7MA 4CIYA 1CJVC 2LTAA 1LK5A 3AMVA 2WMOB 2ZTLA 5EKXA 1X39A 5FOWA 4ETNA 1J99A 2OQIA 2I76A 3BJEA 4FX5A 1CUDA 1K9VF 4IHAA 5DSXA 2GN9A 4ZU3A 3H13A 3LLVA 2QVGA 1JFRA 3RT7A 2A78A 5KKAA 3AI3A 2BM0A 4TYYA 1HURA 2V3CC 4E07A 4XPIA 3GJTA 5G0SA 4PC3A 3DFUA 3QELB 1P45A 4X84A 3W34A 2DUNA 1PR4A 2NTYC 4M0MA 1FS4A 1Z4NA 5EIWA 1F20A 1IWOA 5TV2A 5JW6A 3NNDA 1ADYA 1EWYA 1C7IA 4DSTA 4F92B 1E98A 3FCYA 4KQ6A 5FUYA 5KTNA 4J4BA 3N0RA 4Y2XA 3QIAA 4IXTA 4I08A 4JC5A 4AROA 4UQLA 5IKEA 1AHNA 3CBGA 2W4IA 4MCHA 1BEZA 5YASA 3OEYA 2WV7A 2YJ6A 4HT3B 1QF7A 5TF0A 2I3DA 1QHFA 4GL4A 2JHCA 3VC7A 3TH5A 5I7SA 3ONFA 2YIJA 1DRKA 1TQHA 2Z4RA 1T26A 2HMWA 2ETVA 1ADBA 2MR6A 4OM8A 4TPKA 2INGX 1QFYA 3KXLA 1T35A 5DNYB 1RM5A 1HY3A 1SHTX 1Q0RA 4I5DA 2X2FA 4P4SB 4RO0A 1EK1A 5FBKA 5LCXA 3COVA 2BDTA 1FSGA 4YROA 5ALFA 4H1TA 5FWYA 2NXEA 5JXWA 4BOYA 4BKRA 2PLRA 5JWOA 1VMKA 1Y5MA 2Y05A 4ER3A 1G6Q1 5FB3A 1BJRE 3RG8A 3IEKA 3L8DA 3WLSA 5BXYA 5G4KA 2C9CA 1TC2A 3PBKA 1E9AA 4RBNA 1NFRA 3BFKA 1SCBA 2R1ZA 1AKMA 1FTNA 2RAVA 4GICA 4MKRA 3U2QA 3ZX5A 4CG0A 5CFPA 4JLNA 1L4UA 2WZQA 3JX9A 3L18A 5J58A 1NXWA 1IUPA 2XB8A 4FWBA 3S8MA 4N3CA 4CNBA 5U1PA 1E96A 1TIKA 2CN1A 1N3YA 1BHSA 2ZSIA 3E81A 1SOMA 1UBMS 3JQQA 4PR0A 4NWIA 1P1CA 2JB9A 3ACBA 3L01A 2WY2D 3KJFA 4AZSA 2VUTA 1CUUA 2CFIA 2J0UB 2W00A 4OHCA 5K3SA 4B82A 3IKTA 3H1TA 5KYGA 4QRIA 1UXJA 5J5VA 2EG9A 1RQPA 4KKVA 4ZD6A 4NU6A 4FMDB 2XQIA 2AJCA 2JFXA 4R51A 1DBVO 3WIEA 1I3CA 5K0CA 3WLAA 5DYYA 2LV8A 3NAMA 3O94A 2C96A 4FOTA 4MQFA 3GGGA 5TQ0A 5BR8B 2FR8A 1NONA 4M87A 4XUEA 4ZT5A 3JWHA 2FWIA 1JKJB 1OU0A 1RRFA 3CX6A 3OI7A 4IV5A 4MPPA 4ZOLB 4P54A 5BO5A 1CW2B 1G1MA 3DAPA 3L3BA 3RSZA 2JJ1A 4P38A 3H9JA 2VT7A 1DKPA 1D1PA 4LZJA 2D2VA 4YRLA 3FNHA 3SX4A 4Z0PA 2QP9X 1QHGA 2RHGB 4FFRA 2DG2A 3DTVA 3AVPA 1GM5A 3OZ7A 2GJ4A 1TA4A 2X77A 4MW9A 4N9WA 3HKEB 5DKFA 5JSZB 3M6MD 3C6ZA 1JHOA 4K9SA 4QFDA 4C2TA 2UKDA 2PDAA 1D0SA 1K7EB 4NNJA 1CYEA 1PJAA 4BRWA 3GRUA 2PUFA 3E3LA 3M5WA 3NM5A 3BMCA 1BD3A 4ND8B 2Q2VA 4HTFB 4ZEWA 3KKNA 2ZVJA 2NUPB 1IZ8A 1X0VA 2CLKB 3ZI4A 2VJMB 3B6IA 3ASZA 3NBYC 1P19A 4MTLA 3EC7A 4BKQA 3COWA 1GD1O 4EYKA 5KSOA 1KQFA 4U02A 2GRAA 2Z8XA 4NBTA 4G09A 5B6JA 5FO1A 2BFPA 1PWYE 2ZJ6A 4K81B 1ZY2A 3ENQA 3FZNA 1BTOA 1BX0A 1E8NA 4KO4S 3HZZA 4M9CA 2QTWB 4OIFA 2WM3A 2FZGA 3ZXIA 3GGDA 3RVQA 2EFEB 3B6ZA 3H9EO 2AEFA 3WQHA 5AW7A 3LXUX 1DAIA 1ISSA 4DIOA 3EDYA 1WDLA 1HE4A 3GCGA 3INYA 1USGA 4OHBA 3TLYA 3KZ1E 2ZJOA 3LO8A 4ZOAA 4IY1A 4DYHA 1HYHA 3E8MA 3PHLA 1KI2A 5KPDA 5LB4A 4DVGA 4FT4A 2EEZA 3QVGA 2ZETA 4JVOA 4KC0A 4A16A 4EA8A 3Q7IA 3A2NA 4DEYA 3ANYB 4HMPA 2HNAA 1NE7A 3CZ5A 3K9CA 4IHJA 4OG2A 5A5DA 1Y5LA 5ALEA 3MJVA 1NW8A 2NPFA 4BDTA 1CIVA 4DMKA 1G5TA 2IYZA 4G85A 1YIOA 1ZZGA 1KU0A 1WHSA 2HUPA 1EYZA 3K5PA 4OHFA 4JXJA 1E20A 4YH1A 3KPVA 4WHMA 5FOQA 1Z5UA 3L1KA 4LZLA 1DLJA 3DL0A 4F8YA 4U39A 1ZSVA 1Z33A 4JVNA 3U1VA 1DQPA 1R18A 5KJEA 4LDNA 1JLRA 4OMDA 2PL9A 4XWKA 3U49A 5JSZA 4UAVA 5J4LA 1FRZA 1E63A 4D26A 4QJ3A 4OXYA 1A9XA 1PG5A 5M5BA 3LHIA 2ORYA 4ZDWA 2FLVA 3WVNA 1D8AA 3I01M 4BB5A 2GCGA 4F6RA 1AK1A 2O2XA 1NUAA 4YNBA 3ZHBA 5B7PA 4TLBA 5KQGA 3QU2A 3ZXSA 1W85A 4FK8A 2HH9A 2P9HA 2WINI 1JAIA 2JAWA 4UTZA 2W70A 4PO3X 1B26A 2GF2A 1KK2A 1Y4UA 2FPIB 2W6IA 3I6BA 4O4HB 3S2EA 4GMHA 2VJCA 1JU9A 1LNZA 3E1GA 3BGSA 3IX7A 3QQ5A 4RD6A 4RY2A 3H4TA 5C5IA 5IAOA 4DRYA 1OYVA 1S2NA 2MYTA 2BOVA 3A1TA 1CUHA 3M8KA 3NTOA 1RD4A 3CISA 2JS7A 3UWDA 3C14C 4PG7A 4Z54A 1MFPA 3OF3A 4QGFA 4N3NA 1G6HA 4FNGA 1QZXA 2DEUA 4JCCA 1DXOA 2BRUA 1N9GB 1QOZA 3B7PA 3ZQUA 4IFEA 5C8ZA 3EF0A 3TECE 1BQEA 1LQ2A 3ZK8A 2R5FA 2Z5VA 4QUHA 2P2NA 5HCUA 1TM4E 2BJHA 2XUHA 3DE4X 4G0ZA 4IDBA 4LX0A 3U48A 4F3KA 1JNXX 4F21A 5L4SA 2ZE6A 2Q62A 3A1VA 4G26A 4RY0A 4DA8A 4OBWA 1PSZA 4M0CA 4KFCA 1GVHA 1DPFA 2G08A 2H54A 2WYOA 3IFSA 3K5WA 2PM8A 5T3UA 1GZ4A 1VDZA 2IODA 4AX4A 2BW0A 4TT3D 5HS4A 1U5CA 5IH3A 2JHAA 1ZJ5A 4X1OA 2VPXA 3BL5A 3B9PA 1A5ZA 3DEHA 3EIWA 1N2CA 3OT5A 3T8YA 1WBJB 2JIOA 5ADHA 1QQBA 3R3WA 3HJFA 1I30A 2YWCA 2G1KA 1Z36A 3GRCA 4P3KA 3S5UA 5ERGB 1QANA 3WLTA 2R8PA 3QQPA 2GEFA 2H65A 5AYVA 5KI6A 4ENUA 5JCJA 2HDOA 4LOAA 2AI3A 2I2WA 5B2ZA 3P9XA 5ABPA 1Y0BA 4TS3A 1OFVA 4YS6A 3ZHRA 1QU2A 1K89A 1BX3A 3AHJA 3TZKA 4IZOA 1H85A 1IG0A 4JS0A 4IO0A 3C39A 4EFDA 1N2SA 3SJUA 1XLWA 1FLAA 4M98A 4BAUA 1B4DA 1F1JA 4PO9A 5MHTA 1PFQA 5ALIA 2IYWA 2QRLA 3FNBA 4GKVA 2FFJA 3GUCA 3Q5GA 4BO5A 3UJAA 2VDWA 3RW9A 3TG8A 4TS4A 2AQ8A 1MGPA 2QTCA 3GFQA 3STTA 5FOSA 2AEJA 5ICFA 2CW5A 1QQ7A 1K3FA 4FDMA 3S2FA 2QTVA 4JDPA 3BL6A 3ZLJA 2H4JA 4B6QA 3GLGE 1PKXA 1BMTA 3FNRA 1H2BA 2RGNA 4PG6A 4PVCA 1AT1A 1BU8A 4PX3A 4AUEA 1AMOA 3RIHA 4DDUA 4W99A 3DAYA 2RJOA 4KXQA 1J39A 4MV0A 1DG9A 4R2XA 4RDHA 3KL4A 2DQYA 5FLEX 1E92A 2QRUA 1JT2A 1JU4A 1Z2EA 2EHDA 2QPLA 4DBLE 4O59O 4YYZA 1SOWA 2C2BA 3U3RA 2Y92A 2NO6A 5ALXA 2NQ2C 3PX3A 3A1FA 3TGPA 1OXXK 4M0KA 1WLYA 1CPYA 2XY4A 4K2HA 4PG5A 3KAJA 1U9IC 2KBFA 2VT3A 4LV6A 4D6YA 4GKJB 5A6VA 2AK3A 2IU6A 2AXQA 3OPNA 4AY3A 2PWBA 2QTLA 3RROA 1O2DA 3HPRA 4MYUA 2WJIA 2VSNA 2B5WA 3ILSA 4M8NE 2M6LA 3D8RA 4PZCA 3IUNA 4AMZA 2WAMA 3LVRE 2HF9A 4JJ4A 1G17A 1NF3A 4PZYA 4DF3A 1N8KA 3QKSA 4RUKA 4J0GA 4B4KA 4FB5A 4MWTA 2HB6A 5ES3A 1GRNA 2B3TA 1EQUA 4B87A 4E4RA 5KSYA 4C1NA 1XI2A 1EWQA 3CKMA 4HUJA 4BLUA 3LY7A 3WJ1A 2ETXA 3WOHA 2ZUDA 1UPUA 1XA0A 3RUIA 5JAPA 2R7NA 1ZGHA 3O9MA 2E4VA 1H9CA 1VKZA 2OLEA 1X42A 2J30A 4KFSA 2XMBA 4IICA 2EDCA 5LP6C 1ZCBA 2AVNA 4DIKA 2F8SA 2JFHA 4UZFA 5AKXA 4FEAA 2H0QA 4D9HA 4QZVA 2GN1A 3MQ4A 4C6TA 3FYDA 3CLTD 1L6RA 3GA0A 3VNUA 3IVMA 1TW2A 2DCUA 2FWJA 4M1OA 5CAEA 2OFOA 2QI9F 1DHTA 2PX8A 2VXYA 4Z2YA 1XFDA 4CCAA 1KF0A 1ZI9A 5CH8A 3U81A 1X7XB 4F2DA 1KFBB 4CPDA 2ERCA 4BRUA 1E5VA 5CHYA 1E9CA 4Z3DA 4M1WA 1CZOA 3OKFA 3VMMA 1L5OA 4AP9A 3BRWD 4P1ZA 4P0QB 4AQ7A 2W2KA 3HKCB 2P9EA 2VZLA 1R12A 1XLTA 2GK7A 3AUJB 3FUXA 3P4UA 4JASB 3JZDA 4LGMA 5FUXA 3V7YA 4F4UA 2Y1KA 2A9RA 4LSZA 4ZFNA 1VP3A 1M83A 4G8DA 4ER5A 2RH9B 2QUHA 2PX4A 5CEEA 3PEUA 2NV0A 1ST2A 3I0MA 4LE0A 1KTIA 3QYJA