3MVFA

Crystal structure of nitrophorin 4 from rhodnius prolixus complexed with nitrite at ph 7.4
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
184
structure length
184
Chain Sequence
ACTKNAIAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQVESLGKYTANFKKVDKNGNVKVAVTAGNYYTFTVMYADDSSALIHTCLHKGNKDLGDLYAVLNRNKDAAAGDKVKSAVSAATLEFSKFISTKENNCAYDNDSLKSLLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrophorin-4
publication title Formation of the complex of nitrite with the ferriheme b beta-barrel proteins nitrophorin 4 and nitrophorin 7.
pubmed doi rcsb
source organism Rhodnius prolixus
molecule tags Transport protein
total genus 48
structure length 184
sequence length 184
ec nomenclature ec 1.7.6.1: Nitrite dismutase.
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3mvfA00
2HZQA 3HK1A 4BVMA 1P6PA 1A18A 4AZPA 1KT3A 4I3CA 4GH7A 1D2UA 1GX9A 4K19A 2QO6A 3OJYC 4IBAA 2OFMX 1KGLA 4PSQA 3D95A 1FENA 4A60A 4DQ3A 1OEKA 1A2DA 2RD7C 4GRJA 4ZH6A 1GT1A 3CWKA 4ZHHA 1HBQA 3KFIA 5EEEA 1HN2A 2FLJA 4ZHGA 1OBQA 1X71A 2CZTA 3TGBA 3UEWA 2ANSA 3I17A 2Q2PA 3UEXA 2OZQA 2CM4A 5HWZA 1NP4A 1E06A 2JOZA 2LBVA 3WJGA 1YP6A 5LJBA 1FDQA 4OMXA 3VG6A 2IFBA 1ZNDA 4TKHA 1DF3A 1CBRA 3AKMA 3C76X 1I04A 3VG2A 4XMCA 4OS3A 1KOIA 4QGXA 1ADLA 1TOWA 4LKTA 1IFCA 4O9SA 1JJJA 1IKEA 3U9PC 5HZ9A 2ACOA 5K06A 4N7CA 3EMMA 2A2GA 5KICA 4TKBA 1AVGI 1X89A 2A2UA 4NNSA 2LB6A 1XCAA 4NYQA 4ZJ0A 1CBIA 1YWAA 4HPCA 2XSTA 1R0UA 1N0SA 2KTDA 4ARHA 1EIOA 5IO7A 3HWFA 1ZNHA 1BWYA 1YWCA 1MVGA 3QKGA 4Y0RA 1BJ7A 1DFVA 2GTFX 1BM5A 5HZ8A 3IA8A 3FA9A 1UZ2X 2G78A 5D48A 1DZJA 3WJEA 2QOSC 3B2HA 4Y0PA 1LIDA 2LFOA 3HWEA 3WJBA 1HQPA 5H9LA 1ML7A 4ZR2A 5HBSA 1DV9A 1ERBA 1XKIA 2KT4B 1DZPA 4XMFA 1EPAA 3U03A 3ZUOA 4HFOA 2PY1A 1KZXA 5L8NA 1KQXA 1O1UA 2JU8A 4QZTA 4CK4A 1SXYA 1SY1A 5JR8A 3EYCA 3BRNA 1HMTA 1SY0A 1H91A 3HWGA 3FA7A 3P6FA 1U0XA 4ZCBA 1IIUA 3KFGA 2OVEA 1EW3A 1MX8A 4YDAA 4OS0A 3EM0A 2RCTA 1S2PA 5C0NA 4WFUA 3FEKA 1I4UA 3MVFA 3FA8A 1S7DA 2DM5A 3UEUA 1RBPA 4DQ4A 3NPOA 3HWDA 5HCDC 2WEXA 1ACDA 4QAEA 1KT7A 4M7MA 3CQRA 3DSZA 4YBUA 2QM9A 1IFBA 5H8TA 1BSOA 5D45A 2R74A 4ODDA 1ERXA 1LF7A 5KHPA 1L6MA 3BDRA 2LBAA 4ORYA 2X45A 4NP1A 4YCHA 1E00A 2HMBA 4IB7A 3WXQA 1ZNGA 3WBGA 4XMHA 1B56A 1X8UA 3B2JA 3D96A 3FW4A 1T68X 1HMRA 1FE3A 5LJHA 5DPQA 5F6ZA 5HCEC 4I3BA 3BSZE 4QYNA 5FAZA 1D3SA 3GAQA 2FR2A 1QY0A 1BRQA 4XMEA 1LFOA 1U18A 4IMOA 2CBRA 4YBPA 4I9SA 1GKAA 1ICNA 1CRBA 1LIFA 1I06A 5CE4A 3FMZA 1JJXA 2L9CA 1OPAA 2OVDA 4ORRA 3MBTA 4IAXA 1LIEA 3WJFA 2HZRA 1GGLA 1BRPA 5H9KA 2BLGA 3BLGA 3EBWA 3WJDA 1HMSA 1YUPA 4EXZA 4NYRA 1GX8A 3F9DA 3ELXA 3ZUIA 5FFHA 4HPAA 5L8OA 5H9NA 3RSWA 1QWDA 3STNA 3CBCA 4AZRA 4I9RA 1T0VA 3FELA 1OEEA 3PECA 3U0DA 1O1VA 3KQ0A 5IO5A 2HYSA 3CR6A 5LKEA 3CQNA 2NNQA 1EPBA 4YGGA 2L68A 2RCQA 1I05A 4EDEA 4RUUA 4IAWA 2RA6A 2NNEA 1U17A 2CZUA 1IW2A 2X46A 5HTEA 2E4JA 4KIIA 1B0OA 1SXWA 3TGCA 1IKJA 3STKA 3STMX 1ZNLA 1AQBA 4HPBA 3PEDA 4YFQA 1O8VA 4N7DA 4ZGUA 2A13A 2FR3A 2WR6A 3I0AA 3VG7A 3KZAA 1QFVA 1QQSA 3BX8A 3O19A 1LICA 1YP7A 4YGHA 1OBPA 4NNTA 2AMMX 2XKLA 1QG5A 1MUPA 4MVKA 5D4AA 4YH0A 2GC9A 2F73A 1KQWA 4YFPA 5BVSA 1CJ5A 4EEJA 3B2KA 1X8PA 2LKKA 4ORUA 3NQ3A 5EZ2A 1G85A 1BBPA 1X8QA 2ALLX 1KZWA 2FT9A 1BLRA 3SAOA 5HA1A 3NQ9A 1AB0A 1JZUA 3KFFA 4XMDA 1VYGA 3FIQA 2G79A 4ALOA 5FENA 4BQUA 1S44A 5EPQA 2AH7X 5HZ5A 2AT0X 4XMGA 1BSYA 5F6BA 4ZHFA 4NLIA 1JV4A 3CMPA 1MDCA 3APUA 4QGWA 4TQ2A 2N93A 1AELA 2AKQA 2W2AA 4GE1A 1TVQA 3VG4A 1DZKA 2FTBA 1JYJA 2K62A 2WSJA 3BY0A 1VPRA 3P6EA 2FWVA 4A1HA 2JU3A 1YIVA 2WEWA 4GETA 3B2IA 1Z24A 3DTQA 4OMWA 1T8VA 3CBSA 1LIBA 2A0AA 5AQ6A 2ASNX 1A57A 4ALBA 3S26A 3EBKA 4ZHCA 1UREA 1PMPA 2CM9A 4IB6A 1PM1X 2QO5A 4QGVA 2A3FX 5HA0A 2P8GA 2POAA 2FS7A 1GM6A 3FENA 4IMNA 3UEVA 4IB8A 1EUOA 4NLJA 1JYDA 1A3YA 5DG4A 2OVAA 5H9AA 1SXXA 1YWBA 3F8AA 5HZ6A 4ORXA 3WVMA 4YKOA 4YKMA 3JS1A 5EDBA 3PH6A 3O22A 2NNDA 5LJDA 2QO4A 1OPBA 4LKPA 4RUNA 5IO6A 3G7XA 2Q2MA 2W2FA 4QZUA 4BOEA 1PBOA 2EU7X 3TF6A 2JU7A 2WQ9A 3NX2A 5LJGA 2WQAE 4WFVA 4D6BA 3PH5A 3BU1A 1X8OA 4A8ZA 1G7NA 2AT3X 4D6AA 2MJIA 1GKAB 1TW4A 4UU3A 1SY2A 1VYFA 3P6GA 1EIIA 3RZYA 3Q6LA 4AZOA 1NGLA 1GT4A 1ALBA 1FEMA 1NP1A 2G7BA 2O62A 2L5PA 4HPDA 2R73A 3TGAA 4TLJA 3C78X 1QFTA 2CBSA 4OS8A 1LNMA 1KT6A 1OBUA 3FW5A 4EFGA 4ZFXA 5HAEA 1TOUA 3IFBA 3NR3A 4YMYA 3KFHA 1SXUA 3BS2A 5F58A 3PPTA 1CBQA 4ZH9A 3TZSA 4ORWA 3VG5A 5L8IA 2MM3A 1EXSA 1SA8A 1B4MA 1FTPA 3P6HA 2R56A 1B8EA 1E02A 5B29A 1LPJA 3P6DA 4QYPA 3PP6A 2Q39A 4A1YA 4YCEA 1ZNEA 5EEDA 4AZMA 4MVLA 4Y0QA 1GXAA 1E5PA 3BU9A 3B2LA 1G74A 5LKFA 2YG2A 1KT5A 2Q4NA 3FR5A 5HZQA 1JBHA 1EQDA 4I3DA 2W2BA 2FS6A 1QY1A 1ZRYA 3L4RA 4ZHDA 1FELA 2L67A 2JN3A 2WWPA 4GNYA 5B27A 5F1EA 3ZQ3A 3APXA 3APWA 3BX7A 5LJEA 4ORSA 4WBKA 5HCCC 4UU2A 3T1DA 5HTDA 5F7GA 1KT4A 1X8NA 4R0BA 3FR4A 1QY2A 2K23A 3NP1A 2Q9SA 1PEEA 3P6CA 1LKEA 1ICMA 3FR2A 2AL0X 1RLBE 2FRSA 2ACPX 1EALA 2AT8X 3ELZA 4TNNA 1CBSA 3O2YA 3K3LA 4LZVA 3AKNA 4ES7A 2NP1A 2OFRX 1DZMA 3FLLA 5KIDA 5EDCA 5BVQA 3D97A 4AZQA 5D47A 4AW8A 1KXOA 2GJ5A 1SY3A 1G5WA 4LZUA 3C77X 4YFRA 5LJKA 1HBPA 3WJCA 2HLVA 2AT6X 4Y0SA 3JSQA 1OEJA 4MVIA 4AYHA 4IB9A 1GT5A 2HNXA 4AZNA 3NX1A 4M6SA 1BSQA 4TKJA 4GKCA 2WUTA 1ZNKA 1MX7A 2RQ0A 2MO5A 5D8JA 1GT3A 4GNWA 2AT5X 4TJZA 5LJCA 3NADA 3APVA 1DC9A 4YGZA 3FA6A 3FEPA 3VG3A 1YWDA 1TXLA 1BEBA 5BVTA 1QABE 4YDBA
chains in the Genus database with same CATH superfamily
2HZQA 3HK1A 4BVMA 5FQ7E 1P6PA 1A18A 2BT9A 4AZPA 4KC7A 1KT3A 3E3CA 4I3CA 4GH7A 1D2UA 1GX9A 2C1SA 4U8UN 4K19A 2QO6A 3OJYC 4IBAA 3LTWA 2OFMX 1KGLA 4PSQA 3D95A 1FENA 5IRWA 2G5LA 4A60A 4DQ3A 3RWXA 1OEKA 2A5BA 1A2DA 2RD7C 2X8TA 4GRJA 1GT1A 1LELA 3CWKA 4ZH6A 4KT5A 4DCBA 4ZHHA 1HBQA 3KFIA 5EEEA 1SWSA 1HN2A 3RDXA 2Z4IA 2FLJA 4ZHGA 1OBQA 1X71A 1VWJB 2CZTA 5FQ6E 4IRWA 1VWAB 2FHNX 2ANSA 3UEWA 3TGBA 3I17A 2Q2PA 3UEXA 2OZQA 3WXQA 2CM4A 2A5CA 2RTBB 5HWZA 1NP4A 1E06A 2IZBA 2JOZA 4IABA 2LBVA 5BYPA 3WJGA 4YVBA 1YP6A 1NBXA 1FDQA 4OMXA 3VG6A 2GH7A 1ZNDA 2IFBA 3OE3A 4TKHA 2C1QA 1DF3A 3OBLA 2KW1A 2OY5O 5FQ8E 1CBRA 3HOEA 4U8UO 3AKMA 3S5XA 3C76X 1I04A 3VG2A 4XMCA 4OS3A 1KOIA 4QGXA 1ADLA 1TOWA 4LKTA 1IFCA 4O9SA 2OL8O 4NW4A 1SRIA 1IKEA 1JJJA 1GX3A 3U9PC 2ACOA 5HZ9A 2OVSA 4N7CA 5K06A 3EMMA 2A2GA 3RE6A 2X4MA 5KICA 3ZW1B 4TKBA 1VWNB 1VWLB 2IZGB 3ZW2A 4QNIA 1AVGI 1X89A 2A2UA 4NNSA 2I5VO 2LB6A 1XCAA 4NYQA 3AUMO 1SWKA 4ZJ0A 3S60A 2IZDB 1CBIA 1YWAA 3CKFA 4HPCA 2XSTA 1R0UA 4BX7A 1N0SA 2KTDA 3ZZVA 4ARHA 4Z27A 3HWFA 5IO7A 1EIOA 1ZNHA 1BWYA 1YWCA 1MVGA 3QKGA 4Y0RA 4CDDA 1BJ7A 1DFVA 2F01A 2GTFX 4KH8A 4MIRA 5HZ8A 3OD9A 3IA8A 3FA9A 1LCWA 1UZ2X 3ZWEA 2G78A 5B3MO 5D48A 3EW1A 1DZJA 2F09A 5B5GA 3WJEA 4A8ZA 4CDEA 2QOSC 4FQBB 1LUQA 2Z4HA 3B2HA 4Y0PA 1LIDA 2LFOA 3HWEA 4GZVA 3WJBA 1HQPA 5H9LA 1ML7A 4ZR2A 5HBSA 5B5FA 1JMXA 1DV9A 3NQKA 2X8FA 1ERBA 1XKIA 2KT4B 1DZPA 2RN4A 2RTGB 2DJGA 3EC5A 4XMFA 1EPAA 3U03A 1SLGB 1RAVA 1VWRB 3ZUOA 4DNEA 4HFOA 4BJ8A 2RTFB 2PY1A 1KZXA 5L8NA 3PQSA 4OEMA 1KQXA 3UAQA 1O1UA 2JU8A 1SWRA 4MISA 4QZTA 4CK4A 1SXYA 1SY1A 5JR8A 3EYCA 2RTDB 3BRNA 4BGFA 1HMTA 2C4IA 1SY0A 2OF9A 1H91A 1SWEA 3HWGA 2I5ZO 3FA7A 4CPHA 2BC3A 3P6FA 1U0XA 4QRLA 1SWFA 4CPFA 4ZCBA 1IIUA 3KFGA 2OVEA 1EW3A 1MX8A 4O4OA 4YDAA 4CPIA 1Y0GA 4OS0A 4BX6B 3EM0A 2RCTA 1S2PA 3VHHA 5C0NA 4WFUA 3FEKA 1I4UA 3MVFA 3FA8A 3HTYA 1S7DA 2DM5A 2YMSA 3UEUA 1RBPA 1WBIA 5IRUA 1NDJA 4DQ4A 3NPOA 3HWDA 5HCDC 2WEXA 1ACDA 4QAEA 1KT7A 1VWDB 2JGSA 2Y3FA 2BHVA 2OFAA 4M7MA 3CQRA 3DSZA 4YBUA 2QM9A 4GGRA 1IFBA 5H8TA 3SLJA 1BSOA 1RXKA 5D45A 1NC9A 2R74A 4JO6A 4ODDA 1ERXA 3LV4A 1LF7A 4B55A 1L6MA 5KHPA 1KL3A 3PK2A 3BDRA 2OYBO 2LBAA 1LDQA 4ORYA 2X45A 2Y32A 4NP1A 1E00A 1EI5A 2HMBA 4IB7A 1ZNGA 1VWFB 4YCHA 4XMHA 1B56A 1X8UA 1N9YA 3B2JA 3RY2A 3WBGA 3D96A 2WPUA 4O3XB 3RDOA 3FW4A 4BX5B 5IXGA 1T68X 1HMRA 5IRAA 3RDSA 1HY2A 1FE3A 3MM0A 5LJHA 4EQAC 2IZJA 4Y59A 5DPQA 4KC8A 5F6ZA 1SWHA 5B10O 4I3BA 3BSZE 4QYNA 5FAZA 1D3SA 1SLFB 1Y55X 1VWEB 1QY0A 1BRQA 2FR2A 3F6ZB 3GAQA 1LFOA 4XMEA 1U18A 2CAMA 4IMOA 2CBRA 3VE1A 3WZQA 4YBPA 4Z2PA 1KL5A 4I9SA 1GKAA 3WYQA 1ICNA 4PJ2A 1CRBA 3T2XA 3T6FA 1LIFA 1I06A 5CE4A 2QCBA 2AVIA 1VWKB 3FMZA 1JJXA 2L9CA 1OPAA 3RDMA 2OVDA 4Z2VA 3FYFA 4ORRA 5B2AO 4CDFA 3T2WA 3SZHA 3MBTA 4GD9A 4IAXA 1KL4A 1JMZA 1LIEA 3WJFA 2HZRA 1GGLA 1BRPA 5H9KA 2BLGA 3BLGA 3EBWA 3WJDA 4EKVA 1HMSA 1OSPO 1YUPA 4EXZA 2IZEB 4NYRA 1GX8A 3F9DA 4U3QA 3ELXA 3ZUIA 5FFHA 4HPAA 4GGTA 4Z2OA 5L8OA 5H9NA 3RSWA 1QWDA 2FHLA 3STNA 3CBCA 1UYOX 4AZRA 3N91A 1MEPA 4I9RA 1SWOA 1T0VA 3FELA 1UYNX 1OEEA 3PECA 3U0DA 1O1VA 2HKDA 2IZHB 1HXLA 1E2TA 3KQ0A 5IO5A 2HYSA 3CR6A 1LDOA 5LKEA 3CQNA 2NNQA 1SMPI 1EPBA 4YGGA 2L68A 2RCQA 3FDCA 1I05A 2IZFB 4EDEA 1SWTA 4RUUA 4IAWA 2IZCB 2RA6A 3GE2A 2NNEA 1U17A 2CZUA 3VGWA 1IW2A 4C5PA 2X46A 5HTEA 2E4JA 4KIIA 1MK5A 1B0OA 2IZLB 3V8UA 2G8CO 4NV7A 1SXWA 3TGCA 1IKJA 3STKA 1DF8A 3S5VA 2QOMA 3STMX 1ZNLA 1AQBA 4HPBA 3PEDA 4YFQA 1O8VA 3SLOA 2KTSA 4N7DA 2RTOB 4ZGUA 1FJ1E 2A13A 2FR3A 4JGLA 1IJ8A 2MHDA 2WR6A 2BSZA 3I0AA 3VG7A 1SWUA 1QFVA 2FGSA 3KZAA 1LCZA 1QQSA 3BX8A 1SWAA 3O19A 1LICA 1YP7A 4YGHA 1OBPA 1W4TA 4NNTA 2AMMX 3HOLA 2XKLA 1QG5A 1MUPA 4MVKA 5D4AA 4CV7A 4YH0A 2GC9A 1W6FA 2F73A 2OY7A 1HXZA 2IZIA 1KQWA 3MX7A 4YFPA 5BVSA 1CJ5A 4EEJA 3B2KA 1JJUA 1SLEB 1X8PA 2JMBA 2LKKA 3NQ3A 4ORUA 5EZ2A 4QQ1A 1SWBA 1G85A 1BBPA 1X8QA 2ALLX 2X56A 5B11O 4BX7B 1KZWA 2FT9A 1BLRA 3MG5A 5HA1A 3NQ9A 1AB0A 3AEHA 3SAOA 3KFFA 1JZUA 5AJCA 4XMDA 1VYGA 2BS5A 3FIQA 1NQMA 1WUBA 1SWDA 2RTQB 2G79A 1SWJA 1VWPB 4ALOA 5FENA 3RE5A 4BQUA 1S44A 5EPQA 2AH7X 5HZ5A 3LHNA 1N43A 2AT0X 4XMGA 4Z6JA 1BSYA 2OF8A 5F6BA 4ZHFA 4NLIA 1AVDA 1JV4A 3CMPA 4LQZA 4OKAA 2OFBA 3RY1A 1MDCA 3APUA 4QGWA 4TQ2A 2N93A 1AELA 2AKQA 2W2AA 1SREA 4GE1A 1TVQA 2JW1A 4CSBA 3ZW0A 3VG4A 1SWLA 1DZKA 3CKGA 2FTBA 4GJSA 1JYJA 1Y9TA 2K62A 2WSJA 3BY0A 1VPRA 3P6EA 2FWVA 4A1HA 2JU3A 1QABE 1YIVA 2RTJA 2RTPB 4L1NA 2WEWA 2VFBA 3KVNA 4GETA 3B2IA 4JHQA 1RSTB 1STSB 4CPHB 4FBRA 1Z24A 1SWCA 3DTQA 4OMWA 4BCSA 1T8VA 3CBSA 1RSUB 1LIBA 2A0AA 1SWPA 3P24A 5AQ6A 3SOTA 2ASNX 3WZOA 1A57A 2FKJA 4ALBA 3S26A 3EBKA 4O4UA 2X32A 4ZHCA 1UREA 3HPEA 1PMPA 2CM9A 4IB6A 1PM1X 5HAEA 2QO5A 1SRFA 2A3FX 4QGVA 4CPEA 5HA0A 2P8GA 2UYWA 1LCVA 1Y53X 3VE2A 2POAA 2RTMA 2FS7A 2GTLM 2IZAA 4I95A 1GM6A 5AEOA 4U9CA 3FENA 4IMNA 1SWNA 3SZJA 5CYBA 3UEVA 3VPJE 2DJFA 4IB8A 1VWGB 1EUOA 3RDUA 4GGZA 1JYDA 4NLJA 1A3YA 5DG4A 2OVAA 2QMIA 3H3IA 5H9AA 3ZW0B 4CDCA 2ZSCA 2LA7A 1SXXA 3RKGA 1YWBA 3F8AA 4L3RA 5HZ6A 4ORXA 4GJVA 4ON1A 4YKOA 1VWMB 3WVMA 4FGIB 1SRJA 4YKMA 3JS1A 5EDBA 2M4LA 3O22A 2NNDA 3PH6A 5K68A 5LJDA 2QO4A 1OPBA 4LKPA 4RUNA 5IO6A 3G7XA 2Q2MA 2W2FA 3PQUA 4QZUA 3ZI8A 3ZW1A 1PBOA 2EU7X 3TF6A 4BOEA 1SRGA 2JU7A 2WQ9A 4O3ZA 3NX2A 5LJGA 3WZNA 2WQAE 2OY8A 5JD2A 4WFVA 4D6BA 3PH5A 3BU1A 1X8OA 3T6LA 1G7NA 2AT3X 3X00A 2GTLN 2MJIA 4Z28A 4D6AA 1GKAB 1RXHA 1TW4A 4GDAA 1SY2A 1VYFA 3P6GA 2X55A 4GK9A 4GU8A 4OELA 4UU3A 5F2BA 3RDQA 3Q6LA 3RZYA 1K24A 1NGLA 4AZOA 1GT4A 1ALBA 1FEMA 1NP1A 2G7BA 2O62A 2RTAA 2L5PA 3NBXX 4HPDA 2RTNB 4COTA 2R73A 3TGAA 5K67A 4TLJA 3C78X 1QFTA 2CBSA 4OS8A 3SZIA 1I9HA 2OL6O 1LNMA 1KT6A 1OBUA 3FW5A 3JQOA 4ID2A 4EFGA 4ZFXA 1TOUA 2OL7A 2X8SA 3IFBA 3NR3A 4YMYA 5L3YA 4FBOA 2X34A 1SXUA 3BS2A 2PI3O 3KFHA 5F58A 3PPTA 1CBQA 3P02A 4ZH9A 2RTLA 2RTKA 4O4XA 3TZSA 4ORWA 3VG5A 2MWHA 3QQ2A 5L8IA 1VWHB 2MM3A 1EXSA 1SA8A 1B4MA 4U46A 1FTPA 1MM9A 2AF5A 3P6HA 2R56A 1B8EA 1E02A 4MEEA 1MOYA 1LPJA 5B29A 3P6DA 2GTLO 4QYPA 1VYOA 2Q39A 1NQNA 2UZ2A 3PP6A 2KD2A 4YCEA 4A1YA 1ZNEA 5EEDA 4AZMA 4MVLA 2A8GA 4O3WA 4Y0QA 1STPA 1GXAA 1E5PA 3BU9A 1VWIB 4O3YA 5CHKA 3B2LA 1K3BA 1G74A 4O49A 1KFFA 2YG2A 5LKFA 1KT5A 1STRB 2Q4NA 3FR5A 5HZQA 1JBHA 1EQDA 4I3DA 2W2BA 4I60A 2FS6A 2RTCB 2RTEB 1QY1A 1ZRYA 3L4RA 4ZHDA 1FELA 2L67A 2JN3A 2WWPA 4GNYA 4WHIA 5B27A 2VFCA 5F1EA 3ZQ3A 3APXA 4BX6A 3APWA 5LJBA 1VWOB 1HQQA 3BX7A 4ML7B 1PTSA 5LJEA 4ORSA 4WBKA 5HCCC 4UU2A 3T1DA 5HTDA 5F7GA 1KT4A 1N9MA 1X8NA 4R0BA 3FR4A 1JIWI 1QY2A 2K23A 3NP1A 2Q9SA 1PEEA 1SWGA 3P6CA 1SLDB 4HWMA 1LKEA 3PDFA 1ICMA 4GUZA 3FR2A 2AL0X 1RLBE 3WOVA 2FRSA 2ACPX 4MVEA 1EALA 4I6SA 2AT8X 3ELZA 4O4SA 1EIIA 4TNNA 1N4JA 1CBSA 5HCEC 4KCAA 1AVEA 3O2YA 3K3LA 4GDZA 3AKNA 3FIDA 4LZVA 3RBYA 1JQPA 4ES7A 2NP1A 2OFRX 3D4RA 5AJBA 1RXJA 2Y3EA 1DZMA 3VHIA 3FLLA 5KIDA 1PBYA 5EDCA 5BVQA 3D97A 4AZQA 5CSEA 5D47A 4AW8A 1KXOA 3WZPA 4BX5A 2GJ5A 1SY3A 4ZGFA 1G5WA 2RTRB 4LZUA 3C77X 4YFRA 2ZAIA 1HBPA 4JNJA 5LJKA 1Y52X 3WJCA 2HLVA 3D9WA 3WYPA 2AT6X 4Y0SA 2OY1O 3JSQA 2BS6A 3VHMA 1Y9LA 1OEJA 1VWCB 4MVIA 4Y5DA 4AYHA 3Q34A 1I78A 4IB9A 1GT5A 2HNXA 4AZNA 1SRHA 3NX1A 4M6SA 2VDFA 1BSQA 4TKJA 4U8UM 1BM5A 4GKCA 3SLTA 2WUTA 4INNA 1ZNKA 1MX7A 2RQ0A 2ZAGA 1N7YA 2MO5A 4BBOA 2IZKA 2RTHB 5D8JA 1GT3A 4GNWA 2AT5X 4TJZA 5LJCA 3NADA 3APVA 2FKGA 3VU1A 4NV8A 1DC9A 2MF6A 4YGZA 3FA6A 3FEPA 3EW2A 3VG3A 1VWQB 1YWDA 2RTIB 1TXLA 1BEBA 5BVTA 1SWQA 4FBVA 1W5RA 1VWBB 4YDBA
chains in the Genus database with same CATH topology
2HZQA 3HK1A 4BVMA 5FQ7E 1P6PA 1A18A 2BT9A 4AZPA 4KC7A 1KT3A 3E3CA 4I3CA 4GH7A 1D2UA 1GX9A 4U8UN 4K19A 2QO6A 3OJYC 4IBAA 2OFMX 1KGLA 4PSQA 3D95A 1FENA 4A60A 4DQ3A 3RWXA 1OEKA 1A2DA 2RD7C 2X8TA 4GRJA 1GT1A 3CWKA 4ZH6A 4ZHHA 4KT5A 1HBQA 3KFIA 5EEEA 1HN2A 2Z4IA 2FLJA 4ZHGA 1OBQA 1X71A 2CZTA 5FQ6E 3UEWA 3TGBA 2ANSA 3I17A 2Q2PA 3UEXA 2OZQA 2CM4A 5HWZA 1NP4A 1E06A 2JOZA 4IABA 2LBVA 5BYPA 3WJGA 1YP6A 5LJBA 1FDQA 4OMXA 3VG6A 2IFBA 1ZNDA 4TKHA 3OE3A 1DF3A 3OBLA 2KW1A 5FQ8E 1CBRA 3HOEA 4U8UO 3AKMA 3S5XA 3C76X 1I04A 3VG2A 4XMCA 4OS3A 1KOIA 4QGXA 1ADLA 1TOWA 4LKTA 1IFCA 4O9SA 4NW4A 1JJJA 1IKEA 3U9PC 5HZ9A 2ACOA 5K06A 2OVSA 4N7CA 3EMMA 2A2GA 5KICA 3ZW1B 4TKBA 3ZW2A 4QNIA 1AVGI 1X89A 2A2UA 4NNSA 2LB6A 1XCAA 4NYQA 4ZJ0A 3S60A 1CBIA 1YWAA 4HPCA 2XSTA 1R0UA 1N0SA 2KTDA 3ZZVA 4ARHA 5IO7A 3HWFA 1EIOA 1ZNHA 1BWYA 1YWCA 1MVGA 3QKGA 4Y0RA 1BJ7A 1DFVA 2GTFX 4KH8A 1BM5A 4MIRA 5HZ8A 3OD9A 3IA8A 3FA9A 1UZ2X 3ZWEA 2G78A 5D48A 1DZJA 2F09A 3WJEA 2QOSC 4FQBB 2Z4HA 3B2HA 4Y0PA 1LIDA 2LFOA 3HWEA 4GZVA 3WJBA 1HQPA 5H9LA 1ML7A 4ZR2A 5HBSA 1DV9A 3NQKA 2X8FA 1ERBA 1XKIA 2KT4B 1DZPA 2RN4A 4XMFA 1EPAA 3U03A 3ZUOA 4HFOA 2PY1A 1KZXA 5L8NA 3PQSA 1KQXA 3UAQA 1O1UA 2JU8A 4MISA 4QZTA 4CK4A 1SXYA 1SY1A 5JR8A 3EYCA 3BRNA 1HMTA 1SY0A 1H91A 3HWGA 3FA7A 3P6FA 1U0XA 4QRLA 4ZCBA 1IIUA 3KFGA 2OVEA 1EW3A 1MX8A 4O4OA 4YDAA 4OS0A 3EM0A 2RCTA 1S2PA 5C0NA 4WFUA 3FEKA 1I4UA 3MVFA 3FA8A 3HTYA 1S7DA 2DM5A 2YMSA 3UEUA 1RBPA 4DQ4A 3NPOA 3HWDA 5HCDC 2WEXA 1ACDA 4QAEA 1KT7A 2BHVA 4M7MA 3CQRA 3DSZA 4YBUA 2QM9A 1IFBA 5H8TA 1BSOA 5D45A 2R74A 4ODDA 1ERXA 3LV4A 1LF7A 5KHPA 1L6MA 3BDRA 2LBAA 4ORYA 3ZW0A 2X45A 4NP1A 4YCHA 1E00A 1EI5A 2HMBA 4IB7A 1ZNGA 3WBGA 3WXQA 4XMHA 1B56A 1X8UA 3B2JA 3D96A 4O3XB 3FW4A 1T68X 1HMRA 1FE3A 5LJHA 4EQAC 5DPQA 4KC8A 5F6ZA 5HCEC 4I3BA 3BSZE 4QYNA 5FAZA 1D3SA 3F6ZB 3GAQA 2FR2A 1QY0A 1BRQA 4O4XA 4XMEA 1LFOA 1U18A 4IMOA 2CBRA 3VE1A 4YBPA 4I9SA 1GKAA 1ICNA 4PJ2A 1CRBA 1LIFA 1I06A 5CE4A 3FMZA 1JJXA 2L9CA 1OPAA 2OVDA 3FYFA 4ORRA 3MBTA 4IAXA 1LIEA 3WJFA 2HZRA 1GGLA 1BRPA 5H9KA 2BLGA 3BLGA 3EBWA 3WJDA 1HMSA 1YUPA 4EXZA 4NYRA 1GX8A 3F9DA 4U3QA 3ELXA 3ZUIA 5FFHA 4HPAA 5L8OA 5H9NA 3RSWA 1QWDA 3STNA 3CBCA 4AZRA 3N91A 4I9RA 1T0VA 3FELA 1OEEA 3PECA 3U0DA 1O1VA 3KQ0A 5IO5A 2HYSA 3CR6A 5LKEA 3CQNA 2NNQA 1SMPI 1EPBA 4YGGA 2L68A 2RCQA 1I05A 4EDEA 4RUUA 4IAWA 2RA6A 3GE2A 2NNEA 1U17A 2CZUA 1IW2A 2X46A 5HTEA 2E4JA 4KIIA 1B0OA 3V8UA 1SXWA 3TGCA 1IKJA 3STKA 3S5VA 3STMX 1ZNLA 1AQBA 4HPBA 3PEDA 4YFQA 1O8VA 2KTSA 4N7DA 4ZGUA 2A13A 2FR3A 4JGLA 2MHDA 2WR6A 3I0AA 3VG7A 3KZAA 1QFVA 1QQSA 3BX8A 3O19A 1LICA 1YP7A 4YGHA 1OBPA 4NNTA 2AMMX 3HOLA 2XKLA 1QG5A 1MUPA 4MVKA 5D4AA 4CV7A 4YH0A 2GC9A 2F73A 1KQWA 3MX7A 4YFPA 5BVSA 1CJ5A 4EEJA 3B2KA 1X8PA 2JMBA 2LKKA 4ORUA 3NQ3A 5EZ2A 4QQ1A 1G85A 1BBPA 1X8QA 2ALLX 1KZWA 2FT9A 1BLRA 3SAOA 5HA1A 3NQ9A 1AB0A 1JZUA 3KFFA 5AJCA 4XMDA 1VYGA 2BS5A 3FIQA 2G79A 4ALOA 5FENA 4BQUA 1S44A 5EPQA 2AH7X 5HZ5A 3LHNA 2AT0X 4XMGA 1BSYA 5F6BA 4ZHFA 4NLIA 1JV4A 3CMPA 4LQZA 1MDCA 3APUA 4QGWA 4TQ2A 2N93A 1AELA 2AKQA 2W2AA 4GE1A 1TVQA 2JW1A 4CSBA 3VG4A 1DZKA 2FTBA 1JYJA 1Y9TA 2K62A 2WSJA 3BY0A 1VPRA 3P6EA 2FWVA 4A1HA 2JU3A 1YIVA 4L1NA 2WEWA 4GETA 3B2IA 4FBRA 1Z24A 3DTQA 4OMWA 1T8VA 3CBSA 1LIBA 2A0AA 3P24A 5AQ6A 3SOTA 2ASNX 1A57A 4ALBA 3S26A 3EBKA 4O4UA 4ZHCA 1UREA 1PMPA 2CM9A 4IB6A 1PM1X 2QO5A 4QGVA 2A3FX 5HA0A 2P8GA 3VE2A 2POAA 2FS7A 2GTLM 4I95A 5AEOA 1GM6A 4U9CA 3FENA 4IMNA 3VPJE 5CYBA 3UEVA 4IB8A 1EUOA 4NLJA 1JYDA 1A3YA 5DG4A 2OVAA 2QMIA 3H3IA 5H9AA 3ZW0B 2LA7A 1SXXA 3RKGA 1YWBA 3F8AA 4L3RA 5HZ6A 4ORXA 4ON1A 4YKOA 3WVMA 4FGIB 4YKMA 3JS1A 5EDBA 2M4LA 3O22A 2NNDA 3PH6A 5LJDA 2QO4A 1OPBA 4LKPA 4RUNA 5IO6A 3G7XA 2Q2MA 2W2FA 3PQUA 4QZUA 3ZI8A 3ZW1A 1PBOA 2EU7X 3TF6A 4BOEA 2JU7A 2WQ9A 4O3ZA 3NX2A 5LJGA 2WQAE 4WFVA 4D6BA 3PH5A 3BU1A 1X8OA 4A8ZA 1G7NA 2AT3X 4D6AA 2GTLN 2MJIA 1GKAB 1TW4A 4UU3A 1SY2A 1VYFA 3P6GA 4GK9A 4GU8A 3RZYA 1EIIA 3Q6LA 4AZOA 1NGLA 1GT4A 1ALBA 1FEMA 1NP1A 2G7BA 2O62A 3NBXX 2L5PA 4HPDA 4COTA 2R73A 3TGAA 4TLJA 3C78X 1QFTA 2CBSA 4OS8A 3JQOA 1LNMA 1KT6A 1OBUA 3FW5A 4EFGA 4ID2A 4ZFXA 5HAEA 1TOUA 3IFBA 2X8SA 3NR3A 4YMYA 4FBOA 3KFHA 1SXUA 3BS2A 5F58A 3PPTA 1CBQA 3P02A 4ZH9A 3TZSA 4ORWA 3VG5A 2MWHA 5L8IA 2MM3A 1EXSA 1SA8A 1B4MA 1FTPA 3P6HA 2R56A 1B8EA 1E02A 5B29A 1LPJA 3P6DA 2GTLO 4QYPA 3PP6A 2Q39A 4A1YA 4YCEA 2KD2A 1ZNEA 5EEDA 4AZMA 4MVLA 4Y0QA 4O3WA 1GXAA 1E5PA 3BU9A 4O3YA 3B2LA 4O49A 1G74A 5LKFA 2YG2A 1KT5A 2Q4NA 3FR5A 5HZQA 1JBHA 1EQDA 4I3DA 2W2BA 2FS6A 1QY1A 1ZRYA 3L4RA 4ZHDA 1FELA 2L67A 2JN3A 2WWPA 4GNYA 4WHIA 5B27A 5F1EA 3ZQ3A 3APXA 3APWA 4ML7B 3BX7A 5LJEA 4ORSA 4WBKA 5HCCC 4UU2A 3T1DA 5HTDA 5F7GA 1KT4A 1X8NA 4R0BA 3FR4A 1JIWI 1QY2A 2K23A 3NP1A 2Q9SA 1PEEA 3P6CA 4HWMA 1LKEA 1ICMA 3FR2A 2AL0X 1RLBE 3WOVA 2FRSA 2ACPX 4MVEA 1EALA 4I6SA 2AT8X 3ELZA 4O4SA 4TNNA 1CBSA 4KCAA 3O2YA 3K3LA 4GDZA 3AKNA 4LZVA 3RBYA 4ES7A 2NP1A 2OFRX 3D4RA 5AJBA 1DZMA 3FLLA 5KIDA 5EDCA 5BVQA 3D97A 4AZQA 5D47A 4AW8A 1KXOA 2GJ5A 1SY3A 4ZGFA 1G5WA 4LZUA 3C77X 4YFRA 2ZAIA 1HBPA 5LJKA 3WJCA 2HLVA 2AT6X 4Y0SA 3JSQA 2BS6A 1Y9LA 1OEJA 4MVIA 4AYHA 4IB9A 1GT5A 2HNXA 4AZNA 3NX1A 4M6SA 1BSQA 4TKJA 4U8UM 4GKCA 2WUTA 4INNA 1ZNKA 1MX7A 2RQ0A 2ZAGA 2MO5A 5D8JA 1GT3A 4GNWA 2AT5X 4TJZA 5LJCA 3NADA 3APVA 3VU1A 1DC9A 4YGZA 3FA6A 3FEPA 3VG3A 1YWDA 1TXLA 1BEBA 5BVTA 1QABE 4FBVA 4YDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZQ A;  3HK1 A;  4BVM A;  1P6P A;  1A18 A;  4AZP A;  1KT3 A;  4I3C A;  4GH7 A;  1D2U A;  1GX9 A;  4K19 A;  2QO6 A;  3OJY C;  4IBA A;  2OFM X;  1KGL A;  4PSQ A;  3D95 A;  1FEN A;  4A60 A;  4DQ3 A;  1OEK A;  1A2D A;  2RD7 C;  4GRJ A;  4ZH6 A;  1GT1 A;  3CWK A;  4ZHH A;  1HBQ A;  3KFI A;  5EEE A;  1HN2 A;  2FLJ A;  4ZHG A;  1OBQ A;  1X71 A;  2CZT A;  3TGB A;  3UEW A;  2ANS A;  3I17 A;  2Q2P A;  3UEX A;  2OZQ A;  2CM4 A;  5HWZ A;  1NP4 A;  1E06 A;  2JOZ A;  2LBV A;  3WJG A;  1YP6 A;  5LJB A;  1FDQ A;  4OMX A;  3VG6 A;  2IFB A;  1ZND A;  4TKH A;  1DF3 A;  1CBR A;  3AKM A;  3C76 X;  1I04 A;  3VG2 A;  4XMC A;  4OS3 A;  1KOI A;  4QGX A;  1ADL A;  1TOW A;  4LKT A;  1IFC A;  4O9S A;  1JJJ A;  1IKE A;  3U9P C;  5HZ9 A;  2ACO A;  5K06 A;  4N7C A;  3EMM A;  2A2G A;  5KIC A;  4TKB A;  1AVG I;  1X89 A;  2A2U A;  4NNS A;  2LB6 A;  1XCA A;  4NYQ A;  4ZJ0 A;  1CBI A;  1YWA A;  4HPC A;  2XST A;  1R0U A;  1N0S A;  2KTD A;  4ARH A;  1EIO A;  5IO7 A;  3HWF A;  1ZNH A;  1BWY A;  1YWC A;  1MVG A;  3QKG A;  4Y0R A;  1BJ7 A;  1DFV A;  2GTF X;  1BM5 A;  5HZ8 A;  3IA8 A;  3FA9 A;  1UZ2 X;  2G78 A;  5D48 A;  1DZJ A;  3WJE A;  2QOS C;  3B2H A;  4Y0P A;  1LID A;  2LFO A;  3HWE A;  3WJB A;  1HQP A;  5H9L A;  1ML7 A;  4ZR2 A;  5HBS A;  1DV9 A;  1ERB A;  1XKI A;  2KT4 B;  1DZP A;  4XMF A;  1EPA A;  3U03 A;  3ZUO A;  4HFO A;  2PY1 A;  1KZX A;  5L8N A;  1KQX A;  1O1U A;  2JU8 A;  4QZT A;  4CK4 A;  1SXY A;  1SY1 A;  5JR8 A;  3EYC A;  3BRN A;  1HMT A;  1SY0 A;  1H91 A;  3HWG A;  3FA7 A;  3P6F A;  1U0X A;  4ZCB A;  1IIU A;  3KFG A;  2OVE A;  1EW3 A;  1MX8 A;  4YDA A;  4OS0 A;  3EM0 A;  2RCT A;  1S2P A;  5C0N A;  4WFU A;  3FEK A;  1I4U A;  3MVF A;  3FA8 A;  1S7D A;  2DM5 A;  3UEU A;  1RBP A;  4DQ4 A;  3NPO A;  3HWD A;  5HCD C;  2WEX A;  1ACD A;  4QAE A;  1KT7 A;  4M7M A;  3CQR A;  3DSZ A;  4YBU A;  2QM9 A;  1IFB A;  5H8T A;  1BSO A;  5D45 A;  2R74 A;  4ODD A;  1ERX A;  1LF7 A;  5KHP A;  1L6M A;  3BDR A;  2LBA A;  4ORY A;  2X45 A;  4NP1 A;  4YCH A;  1E00 A;  2HMB A;  4IB7 A;  3WXQ A;  1ZNG A;  3WBG A;  4XMH A;  1B56 A;  1X8U A;  3B2J A;  3D96 A;  3FW4 A;  1T68 X;  1HMR A;  1FE3 A;  5LJH A;  5DPQ A;  5F6Z A;  5HCE C;  4I3B A;  3BSZ E;  4QYN A;  5FAZ A;  1D3S A;  3GAQ A;  2FR2 A;  1QY0 A;  1BRQ A;  4XME A;  1LFO A;  1U18 A;  4IMO A;  2CBR A;  4YBP A;  4I9S A;  1GKA A;  1ICN A;  1CRB A;  1LIF A;  1I06 A;  5CE4 A;  3FMZ A;  1JJX A;  2L9C A;  1OPA A;  2OVD A;  4ORR A;  3MBT A;  4IAX A;  1LIE A;  3WJF A;  2HZR A;  1GGL A;  1BRP A;  5H9K A;  2BLG A;  3BLG A;  3EBW A;  3WJD A;  1HMS A;  1YUP A;  4EXZ A;  4NYR A;  1GX8 A;  3F9D A;  3ELX A;  3ZUI A;  5FFH A;  4HPA A;  5L8O A;  5H9N A;  3RSW A;  1QWD A;  3STN A;  3CBC A;  4AZR A;  4I9R A;  1T0V A;  3FEL A;  1OEE A;  3PEC A;  3U0D A;  1O1V A;  3KQ0 A;  5IO5 A;  2HYS A;  3CR6 A;  5LKE A;  3CQN A;  2NNQ A;  1EPB A;  4YGG A;  2L68 A;  2RCQ A;  1I05 A;  4EDE A;  4RUU A;  4IAW A;  2RA6 A;  2NNE A;  1U17 A;  2CZU A;  1IW2 A;  2X46 A;  5HTE A;  2E4J A;  4KII A;  1B0O A;  1SXW A;  3TGC A;  1IKJ A;  3STK A;  3STM X;  1ZNL A;  1AQB A;  4HPB A;  3PED A;  4YFQ A;  1O8V A;  4N7D A;  4ZGU A;  2A13 A;  2FR3 A;  2WR6 A;  3I0A A;  3VG7 A;  3KZA A;  1QFV A;  1QQS A;  3BX8 A;  3O19 A;  1LIC A;  1YP7 A;  4YGH A;  1OBP A;  4NNT A;  2AMM X;  2XKL A;  1QG5 A;  1MUP A;  4MVK A;  5D4A A;  4YH0 A;  2GC9 A;  2F73 A;  1KQW A;  4YFP A;  5BVS A;  1CJ5 A;  4EEJ A;  3B2K A;  1X8P A;  2LKK A;  4ORU A;  3NQ3 A;  5EZ2 A;  1G85 A;  1BBP A;  1X8Q A;  2ALL X;  1KZW A;  2FT9 A;  1BLR A;  3SAO A;  5HA1 A;  3NQ9 A;  1AB0 A;  1JZU A;  3KFF A;  4XMD A;  1VYG A;  3FIQ A;  2G79 A;  4ALO A;  5FEN A;  4BQU A;  1S44 A;  5EPQ A;  2AH7 X;  5HZ5 A;  2AT0 X;  4XMG A;  1BSY A;  5F6B A;  4ZHF A;  4NLI A;  1JV4 A;  3CMP A;  1MDC A;  3APU A;  4QGW A;  4TQ2 A;  2N93 A;  1AEL A;  2AKQ A;  2W2A A;  4GE1 A;  1TVQ A;  3VG4 A;  1DZK A;  2FTB A;  1JYJ A;  2K62 A;  2WSJ A;  3BY0 A;  1VPR A;  3P6E A;  2FWV A;  4A1H A;  2JU3 A;  1YIV A;  2WEW A;  4GET A;  3B2I A;  1Z24 A;  3DTQ A;  4OMW A;  1T8V A;  3CBS A;  1LIB A;  2A0A A;  5AQ6 A;  2ASN X;  1A57 A;  4ALB A;  3S26 A;  3EBK A;  4ZHC A;  1URE A;  1PMP A;  2CM9 A;  4IB6 A;  1PM1 X;  2QO5 A;  4QGV A;  2A3F X;  5HA0 A;  2P8G A;  2POA A;  2FS7 A;  1GM6 A;  3FEN A;  4IMN A;  3UEV A;  4IB8 A;  1EUO A;  4NLJ A;  1JYD A;  1A3Y A;  5DG4 A;  2OVA A;  5H9A A;  1SXX A;  1YWB A;  3F8A A;  5HZ6 A;  4ORX A;  3WVM A;  4YKO A;  4YKM A;  3JS1 A;  5EDB A;  3PH6 A;  3O22 A;  2NND A;  5LJD A;  2QO4 A;  1OPB A;  4LKP A;  4RUN A;  5IO6 A;  3G7X A;  2Q2M A;  2W2F A;  4QZU A;  4BOE A;  1PBO A;  2EU7 X;  3TF6 A;  2JU7 A;  2WQ9 A;  3NX2 A;  5LJG A;  2WQA E;  4WFV A;  4D6B A;  3PH5 A;  3BU1 A;  1X8O A;  4A8Z A;  1G7N A;  2AT3 X;  4D6A A;  2MJI A;  1GKA B;  1TW4 A;  4UU3 A;  1SY2 A;  1VYF A;  3P6G A;  1EII A;  3RZY A;  3Q6L A;  4AZO A;  1NGL A;  1GT4 A;  1ALB A;  1FEM A;  1NP1 A;  2G7B A;  2O62 A;  2L5P A;  4HPD A;  2R73 A;  3TGA A;  4TLJ A;  3C78 X;  1QFT A;  2CBS A;  4OS8 A;  1LNM A;  1KT6 A;  1OBU A;  3FW5 A;  4EFG A;  4ZFX A;  5HAE A;  1TOU A;  3IFB A;  3NR3 A;  4YMY A;  3KFH A;  1SXU A;  3BS2 A;  5F58 A;  3PPT A;  1CBQ A;  4ZH9 A;  3TZS A;  4ORW A;  3VG5 A;  5L8I A;  2MM3 A;  1EXS A;  1SA8 A;  1B4M A;  1FTP A;  3P6H A;  2R56 A;  1B8E A;  1E02 A;  5B29 A;  1LPJ A;  3P6D A;  4QYP A;  3PP6 A;  2Q39 A;  4A1Y A;  4YCE A;  1ZNE A;  5EED A;  4AZM A;  4MVL A;  4Y0Q A;  1GXA A;  1E5P A;  3BU9 A;  3B2L A;  1G74 A;  5LKF A;  2YG2 A;  1KT5 A;  2Q4N A;  3FR5 A;  5HZQ A;  1JBH A;  1EQD A;  4I3D A;  2W2B A;  2FS6 A;  1QY1 A;  1ZRY A;  3L4R A;  4ZHD A;  1FEL A;  2L67 A;  2JN3 A;  2WWP A;  4GNY A;  5B27 A;  5F1E A;  3ZQ3 A;  3APX A;  3APW A;  3BX7 A;  5LJE A;  4ORS A;  4WBK A;  5HCC C;  4UU2 A;  3T1D A;  5HTD A;  5F7G A;  1KT4 A;  1X8N A;  4R0B A;  3FR4 A;  1QY2 A;  2K23 A;  3NP1 A;  2Q9S A;  1PEE A;  3P6C A;  1LKE A;  1ICM A;  3FR2 A;  2AL0 X;  1RLB E;  2FRS A;  2ACP X;  1EAL A;  2AT8 X;  3ELZ A;  4TNN A;  1CBS A;  3O2Y A;  3K3L A;  4LZV A;  3AKN A;  4ES7 A;  2NP1 A;  2OFR X;  1DZM A;  3FLL A;  5KID A;  5EDC A;  5BVQ A;  3D97 A;  4AZQ A;  5D47 A;  4AW8 A;  1KXO A;  2GJ5 A;  1SY3 A;  1G5W A;  4LZU A;  3C77 X;  4YFR A;  5LJK A;  1HBP A;  3WJC A;  2HLV A;  2AT6 X;  4Y0S A;  3JSQ A;  1OEJ A;  4MVI A;  4AYH A;  4IB9 A;  1GT5 A;  2HNX A;  4AZN A;  3NX1 A;  4M6S A;  1BSQ A;  4TKJ A;  4GKC A;  2WUT A;  1ZNK A;  1MX7 A;  2RQ0 A;  2MO5 A;  5D8J A;  1GT3 A;  4GNW A;  2AT5 X;  4TJZ A;  5LJC A;  3NAD A;  3APV A;  1DC9 A;  4YGZ A;  3FA6 A;  3FEP A;  3VG3 A;  1YWD A;  1TXL A;  1BEB A;  5BVT A;  1QAB E;  4YDB A; 
#chains in the Genus database with same CATH topology
 2HZQ A;  3HK1 A;  4BVM A;  5FQ7 E;  1P6P A;  1A18 A;  2BT9 A;  4AZP A;  4KC7 A;  1KT3 A;  3E3C A;  4I3C A;  4GH7 A;  1D2U A;  1GX9 A;  2C1S A;  4U8U N;  4K19 A;  2QO6 A;  3OJY C;  4IBA A;  3LTW A;  2OFM X;  1KGL A;  4PSQ A;  3D95 A;  1FEN A;  5IRW A;  2G5L A;  4A60 A;  4DQ3 A;  3RWX A;  1OEK A;  2A5B A;  1A2D A;  2RD7 C;  2X8T A;  4GRJ A;  1GT1 A;  1LEL A;  3CWK A;  4ZH6 A;  4KT5 A;  4DCB A;  4ZHH A;  1HBQ A;  3KFI A;  5EEE A;  1SWS A;  1HN2 A;  3RDX A;  2Z4I A;  2FLJ A;  4ZHG A;  1OBQ A;  1X71 A;  1VWJ B;  2CZT A;  5FQ6 E;  4IRW A;  1VWA B;  2FHN X;  2ANS A;  3UEW A;  3TGB A;  3I17 A;  2Q2P A;  3UEX A;  2OZQ A;  3WXQ A;  2CM4 A;  2A5C A;  2RTB B;  5HWZ A;  1NP4 A;  1E06 A;  2IZB A;  2JOZ A;  4IAB A;  2LBV A;  5BYP A;  3WJG A;  4YVB A;  1YP6 A;  1NBX A;  1FDQ A;  4OMX A;  3VG6 A;  2GH7 A;  1ZND A;  2IFB A;  3OE3 A;  4TKH A;  2C1Q A;  1DF3 A;  3OBL A;  2KW1 A;  2OY5 O;  5FQ8 E;  1CBR A;  3HOE A;  4U8U O;  3AKM A;  3S5X A;  3C76 X;  1I04 A;  3VG2 A;  4XMC A;  4OS3 A;  1KOI A;  4QGX A;  1ADL A;  1TOW A;  4LKT A;  1IFC A;  4O9S A;  2OL8 O;  4NW4 A;  1SRI A;  1IKE A;  1JJJ A;  1GX3 A;  3U9P C;  2ACO A;  5HZ9 A;  2OVS A;  4N7C A;  5K06 A;  3EMM A;  2A2G A;  3RE6 A;  2X4M A;  5KIC A;  3ZW1 B;  4TKB A;  1VWN B;  1VWL B;  2IZG B;  3ZW2 A;  4QNI A;  1AVG I;  1X89 A;  2A2U A;  4NNS A;  2I5V O;  2LB6 A;  1XCA A;  4NYQ A;  3AUM O;  1SWK A;  4ZJ0 A;  3S60 A;  2IZD B;  1CBI A;  1YWA A;  3CKF A;  4HPC A;  2XST A;  1R0U A;  4BX7 A;  1N0S A;  2KTD A;  3ZZV A;  4ARH A;  4Z27 A;  3HWF A;  5IO7 A;  1EIO A;  1ZNH A;  1BWY A;  1YWC A;  1MVG A;  3QKG A;  4Y0R A;  4CDD A;  1BJ7 A;  1DFV A;  2F01 A;  2GTF X;  4KH8 A;  4MIR A;  5HZ8 A;  3OD9 A;  3IA8 A;  3FA9 A;  1LCW A;  1UZ2 X;  3ZWE A;  2G78 A;  5B3M O;  5D48 A;  3EW1 A;  1DZJ A;  2F09 A;  5B5G A;  3WJE A;  4A8Z A;  4CDE A;  2QOS C;  4FQB B;  1LUQ A;  2Z4H A;  3B2H A;  4Y0P A;  1LID A;  2LFO A;  3HWE A;  4GZV A;  3WJB A;  1HQP A;  5H9L A;  1ML7 A;  4ZR2 A;  5HBS A;  5B5F A;  1JMX A;  1DV9 A;  3NQK A;  2X8F A;  1ERB A;  1XKI A;  2KT4 B;  1DZP A;  2RN4 A;  2RTG B;  2DJG A;  3EC5 A;  4XMF A;  1EPA A;  3U03 A;  1SLG B;  1RAV A;  1VWR B;  3ZUO A;  4DNE A;  4HFO A;  4BJ8 A;  2RTF B;  2PY1 A;  1KZX A;  5L8N A;  3PQS A;  4OEM A;  1KQX A;  3UAQ A;  1O1U A;  2JU8 A;  1SWR A;  4MIS A;  4QZT A;  4CK4 A;  1SXY A;  1SY1 A;  5JR8 A;  3EYC A;  2RTD B;  3BRN A;  4BGF A;  1HMT A;  2C4I A;  1SY0 A;  2OF9 A;  1H91 A;  1SWE A;  3HWG A;  2I5Z O;  3FA7 A;  4CPH A;  2BC3 A;  3P6F A;  1U0X A;  4QRL A;  1SWF A;  4CPF A;  4ZCB A;  1IIU A;  3KFG A;  2OVE A;  1EW3 A;  1MX8 A;  4O4O A;  4YDA A;  4CPI A;  1Y0G A;  4OS0 A;  4BX6 B;  3EM0 A;  2RCT A;  1S2P A;  3VHH A;  5C0N A;  4WFU A;  3FEK A;  1I4U A;  3MVF A;  3FA8 A;  3HTY A;  1S7D A;  2DM5 A;  2YMS A;  3UEU A;  1RBP A;  1WBI A;  5IRU A;  1NDJ A;  4DQ4 A;  3NPO A;  3HWD A;  5HCD C;  2WEX A;  1ACD A;  4QAE A;  1KT7 A;  1VWD B;  2JGS A;  2Y3F A;  2BHV A;  2OFA A;  4M7M A;  3CQR A;  3DSZ A;  4YBU A;  2QM9 A;  4GGR A;  1IFB A;  5H8T A;  3SLJ A;  1BSO A;  1RXK A;  5D45 A;  1NC9 A;  2R74 A;  4JO6 A;  4ODD A;  1ERX A;  3LV4 A;  1LF7 A;  4B55 A;  1L6M A;  5KHP A;  1KL3 A;  3PK2 A;  3BDR A;  2OYB O;  2LBA A;  1LDQ A;  4ORY A;  2X45 A;  2Y32 A;  4NP1 A;  1E00 A;  1EI5 A;  2HMB A;  4IB7 A;  1ZNG A;  1VWF B;  4YCH A;  4XMH A;  1B56 A;  1X8U A;  1N9Y A;  3B2J A;  3RY2 A;  3WBG A;  3D96 A;  2WPU A;  4O3X B;  3RDO A;  3FW4 A;  4BX5 B;  5IXG A;  1T68 X;  1HMR A;  5IRA A;  3RDS A;  1HY2 A;  1FE3 A;  3MM0 A;  5LJH A;  4EQA C;  2IZJ A;  4Y59 A;  5DPQ A;  4KC8 A;  5F6Z A;  1SWH A;  5B10 O;  4I3B A;  3BSZ E;  4QYN A;  5FAZ A;  1D3S A;  1SLF B;  1Y55 X;  1VWE B;  1QY0 A;  1BRQ A;  2FR2 A;  3F6Z B;  3GAQ A;  1LFO A;  4XME A;  1U18 A;  2CAM A;  4IMO A;  2CBR A;  3VE1 A;  3WZQ A;  4YBP A;  4Z2P A;  1KL5 A;  4I9S A;  1GKA A;  3WYQ A;  1ICN A;  4PJ2 A;  1CRB A;  3T2X A;  3T6F A;  1LIF A;  1I06 A;  5CE4 A;  2QCB A;  2AVI A;  1VWK B;  3FMZ A;  1JJX A;  2L9C A;  1OPA A;  3RDM A;  2OVD A;  4Z2V A;  3FYF A;  4ORR A;  5B2A O;  4CDF A;  3T2W A;  3SZH A;  3MBT A;  4GD9 A;  4IAX A;  1KL4 A;  1JMZ A;  1LIE A;  3WJF A;  2HZR A;  1GGL A;  1BRP A;  5H9K A;  2BLG A;  3BLG A;  3EBW A;  3WJD A;  4EKV A;  1HMS A;  1OSP O;  1YUP A;  4EXZ A;  2IZE B;  4NYR A;  1GX8 A;  3F9D A;  4U3Q A;  3ELX A;  3ZUI A;  5FFH A;  4HPA A;  4GGT A;  4Z2O A;  5L8O A;  5H9N A;  3RSW A;  1QWD A;  2FHL A;  3STN A;  3CBC A;  1UYO X;  4AZR A;  3N91 A;  1MEP A;  4I9R A;  1SWO A;  1T0V A;  3FEL A;  1UYN X;  1OEE A;  3PEC A;  3U0D A;  1O1V A;  2HKD A;  2IZH B;  1HXL A;  1E2T A;  3KQ0 A;  5IO5 A;  2HYS A;  3CR6 A;  1LDO A;  5LKE A;  3CQN A;  2NNQ A;  1SMP I;  1EPB A;  4YGG A;  2L68 A;  2RCQ A;  3FDC A;  1I05 A;  2IZF B;  4EDE A;  1SWT A;  4RUU A;  4IAW A;  2IZC B;  2RA6 A;  3GE2 A;  2NNE A;  1U17 A;  2CZU A;  3VGW A;  1IW2 A;  4C5P A;  2X46 A;  5HTE A;  2E4J A;  4KII A;  1MK5 A;  1B0O A;  2IZL B;  3V8U A;  2G8C O;  4NV7 A;  1SXW A;  3TGC A;  1IKJ A;  3STK A;  1DF8 A;  3S5V A;  2QOM A;  3STM X;  1ZNL A;  1AQB A;  4HPB A;  3PED A;  4YFQ A;  1O8V A;  3SLO A;  2KTS A;  4N7D A;  2RTO B;  4ZGU A;  1FJ1 E;  2A13 A;  2FR3 A;  4JGL A;  1IJ8 A;  2MHD A;  2WR6 A;  2BSZ A;  3I0A A;  3VG7 A;  1SWU A;  1QFV A;  2FGS A;  3KZA A;  1LCZ A;  1QQS A;  3BX8 A;  1SWA A;  3O19 A;  1LIC A;  1YP7 A;  4YGH A;  1OBP A;  1W4T A;  4NNT A;  2AMM X;  3HOL A;  2XKL A;  1QG5 A;  1MUP A;  4MVK A;  5D4A A;  4CV7 A;  4YH0 A;  2GC9 A;  1W6F A;  2F73 A;  2OY7 A;  1HXZ A;  2IZI A;  1KQW A;  3MX7 A;  4YFP A;  5BVS A;  1CJ5 A;  4EEJ A;  3B2K A;  1JJU A;  1SLE B;  1X8P A;  2JMB A;  2LKK A;  3NQ3 A;  4ORU A;  5EZ2 A;  4QQ1 A;  1SWB A;  1G85 A;  1BBP A;  1X8Q A;  2ALL X;  2X56 A;  5B11 O;  4BX7 B;  1KZW A;  2FT9 A;  1BLR A;  3MG5 A;  5HA1 A;  3NQ9 A;  1AB0 A;  3AEH A;  3SAO A;  3KFF A;  1JZU A;  5AJC A;  4XMD A;  1VYG A;  2BS5 A;  3FIQ A;  1NQM A;  1WUB A;  1SWD A;  2RTQ B;  2G79 A;  1SWJ A;  1VWP B;  4ALO A;  5FEN A;  3RE5 A;  4BQU A;  1S44 A;  5EPQ A;  2AH7 X;  5HZ5 A;  3LHN A;  1N43 A;  2AT0 X;  4XMG A;  4Z6J A;  1BSY A;  2OF8 A;  5F6B A;  4ZHF A;  4NLI A;  1AVD A;  1JV4 A;  3CMP A;  4LQZ A;  4OKA A;  2OFB A;  3RY1 A;  1MDC A;  3APU A;  4QGW A;  4TQ2 A;  2N93 A;  1AEL A;  2AKQ A;  2W2A A;  1SRE A;  4GE1 A;  1TVQ A;  2JW1 A;  4CSB A;  3ZW0 A;  3VG4 A;  1SWL A;  1DZK A;  3CKG A;  2FTB A;  4GJS A;  1JYJ A;  1Y9T A;  2K62 A;  2WSJ A;  3BY0 A;  1VPR A;  3P6E A;  2FWV A;  4A1H A;  2JU3 A;  1QAB E;  1YIV A;  2RTJ A;  2RTP B;  4L1N A;  2WEW A;  2VFB A;  3KVN A;  4GET A;  3B2I A;  4JHQ A;  1RST B;  1STS B;  4CPH B;  4FBR A;  1Z24 A;  1SWC A;  3DTQ A;  4OMW A;  4BCS A;  1T8V A;  3CBS A;  1RSU B;  1LIB A;  2A0A A;  1SWP A;  3P24 A;  5AQ6 A;  3SOT A;  2ASN X;  3WZO A;  1A57 A;  2FKJ A;  4ALB A;  3S26 A;  3EBK A;  4O4U A;  2X32 A;  4ZHC A;  1URE A;  3HPE A;  1PMP A;  2CM9 A;  4IB6 A;  1PM1 X;  5HAE A;  2QO5 A;  1SRF A;  2A3F X;  4QGV A;  4CPE A;  5HA0 A;  2P8G A;  2UYW A;  1LCV A;  1Y53 X;  3VE2 A;  2POA A;  2RTM A;  2FS7 A;  2GTL M;  2IZA A;  4I95 A;  1GM6 A;  5AEO A;  4U9C A;  3FEN A;  4IMN A;  1SWN A;  3SZJ A;  5CYB A;  3UEV A;  3VPJ E;  2DJF A;  4IB8 A;  1VWG B;  1EUO A;  3RDU A;  4GGZ A;  1JYD A;  4NLJ A;  1A3Y A;  5DG4 A;  2OVA A;  2QMI A;  3H3I A;  5H9A A;  3ZW0 B;  4CDC A;  2ZSC A;  2LA7 A;  1SXX A;  3RKG A;  1YWB A;  3F8A A;  4L3R A;  5HZ6 A;  4ORX A;  4GJV A;  4ON1 A;  4YKO A;  1VWM B;  3WVM A;  4FGI B;  1SRJ A;  4YKM A;  3JS1 A;  5EDB A;  2M4L A;  3O22 A;  2NND A;  3PH6 A;  5K68 A;  5LJD A;  2QO4 A;  1OPB A;  4LKP A;  4RUN A;  5IO6 A;  3G7X A;  2Q2M A;  2W2F A;  3PQU A;  4QZU A;  3ZI8 A;  3ZW1 A;  1PBO A;  2EU7 X;  3TF6 A;  4BOE A;  1SRG A;  2JU7 A;  2WQ9 A;  4O3Z A;  3NX2 A;  5LJG A;  3WZN A;  2WQA E;  2OY8 A;  5JD2 A;  4WFV A;  4D6B A;  3PH5 A;  3BU1 A;  1X8O A;  3T6L A;  1G7N A;  2AT3 X;  3X00 A;  2GTL N;  2MJI A;  4Z28 A;  4D6A A;  1GKA B;  1RXH A;  1TW4 A;  4GDA A;  1SY2 A;  1VYF A;  3P6G A;  2X55 A;  4GK9 A;  4GU8 A;  4OEL A;  4UU3 A;  5F2B A;  3RDQ A;  3Q6L A;  3RZY A;  1K24 A;  1NGL A;  4AZO A;  1GT4 A;  1ALB A;  1FEM A;  1NP1 A;  2G7B A;  2O62 A;  2RTA A;  2L5P A;  3NBX X;  4HPD A;  2RTN B;  4COT A;  2R73 A;  3TGA A;  5K67 A;  4TLJ A;  3C78 X;  1QFT A;  2CBS A;  4OS8 A;  3SZI A;  1I9H A;  2OL6 O;  1LNM A;  1KT6 A;  1OBU A;  3FW5 A;  3JQO A;  4ID2 A;  4EFG A;  4ZFX A;  1TOU A;  2OL7 A;  2X8S A;  3IFB A;  3NR3 A;  4YMY A;  5L3Y A;  4FBO A;  2X34 A;  1SXU A;  3BS2 A;  2PI3 O;  3KFH A;  5F58 A;  3PPT A;  1CBQ A;  3P02 A;  4ZH9 A;  2RTL A;  2RTK A;  4O4X A;  3TZS A;  4ORW A;  3VG5 A;  2MWH A;  3QQ2 A;  5L8I A;  1VWH B;  2MM3 A;  1EXS A;  1SA8 A;  1B4M A;  4U46 A;  1FTP A;  1MM9 A;  2AF5 A;  3P6H A;  2R56 A;  1B8E A;  1E02 A;  4MEE A;  1MOY A;  1LPJ A;  5B29 A;  3P6D A;  2GTL O;  4QYP A;  1VYO A;  2Q39 A;  1NQN A;  2UZ2 A;  3PP6 A;  2KD2 A;  4YCE A;  4A1Y A;  1ZNE A;  5EED A;  4AZM A;  4MVL A;  2A8G A;  4O3W A;  4Y0Q A;  1STP A;  1GXA A;  1E5P A;  3BU9 A;  1VWI B;  4O3Y A;  5CHK A;  3B2L A;  1K3B A;  1G74 A;  4O49 A;  1KFF A;  2YG2 A;  5LKF A;  1KT5 A;  1STR B;  2Q4N A;  3FR5 A;  5HZQ A;  1JBH A;  1EQD A;  4I3D A;  2W2B A;  4I60 A;  2FS6 A;  2RTC B;  2RTE B;  1QY1 A;  1ZRY A;  3L4R A;  4ZHD A;  1FEL A;  2L67 A;  2JN3 A;  2WWP A;  4GNY A;  4WHI A;  5B27 A;  2VFC A;  5F1E A;  3ZQ3 A;  3APX A;  4BX6 A;  3APW A;  5LJB A;  1VWO B;  1HQQ A;  3BX7 A;  4ML7 B;  1PTS A;  5LJE A;  4ORS A;  4WBK A;  5HCC C;  4UU2 A;  3T1D A;  5HTD A;  5F7G A;  1KT4 A;  1N9M A;  1X8N A;  4R0B A;  3FR4 A;  1JIW I;  1QY2 A;  2K23 A;  3NP1 A;  2Q9S A;  1PEE A;  1SWG A;  3P6C A;  1SLD B;  4HWM A;  1LKE A;  3PDF A;  1ICM A;  4GUZ A;  3FR2 A;  2AL0 X;  1RLB E;  3WOV A;  2FRS A;  2ACP X;  4MVE A;  1EAL A;  4I6S A;  2AT8 X;  3ELZ A;  4O4S A;  1EII A;  4TNN A;  1N4J A;  1CBS A;  5HCE C;  4KCA A;  1AVE A;  3O2Y A;  3K3L A;  4GDZ A;  3AKN A;  3FID A;  4LZV A;  3RBY A;  1JQP A;  4ES7 A;  2NP1 A;  2OFR X;  3D4R A;  5AJB A;  1RXJ A;  2Y3E A;  1DZM A;  3VHI A;  3FLL A;  5KID A;  1PBY A;  5EDC A;  5BVQ A;  3D97 A;  4AZQ A;  5CSE A;  5D47 A;  4AW8 A;  1KXO A;  3WZP A;  4BX5 A;  2GJ5 A;  1SY3 A;  4ZGF A;  1G5W A;  2RTR B;  4LZU A;  3C77 X;  4YFR A;  2ZAI A;  1HBP A;  4JNJ A;  5LJK A;  1Y52 X;  3WJC A;  2HLV A;  3D9W A;  3WYP A;  2AT6 X;  4Y0S A;  2OY1 O;  3JSQ A;  2BS6 A;  3VHM A;  1Y9L A;  1OEJ A;  1VWC B;  4MVI A;  4Y5D A;  4AYH A;  3Q34 A;  1I78 A;  4IB9 A;  1GT5 A;  2HNX A;  4AZN A;  1SRH A;  3NX1 A;  4M6S A;  2VDF A;  1BSQ A;  4TKJ A;  4U8U M;  1BM5 A;  4GKC A;  3SLT A;  2WUT A;  4INN A;  1ZNK A;  1MX7 A;  2RQ0 A;  2ZAG A;  1N7Y A;  2MO5 A;  4BBO A;  2IZK A;  2RTH B;  5D8J A;  1GT3 A;  4GNW A;  2AT5 X;  4TJZ A;  5LJC A;  3NAD A;  3APV A;  2FKG A;  3VU1 A;  4NV8 A;  1DC9 A;  2MF6 A;  4YGZ A;  3FA6 A;  3FEP A;  3EW2 A;  3VG3 A;  1VWQ B;  1YWD A;  2RTI B;  1TXL A;  1BEB A;  5BVT A;  1SWQ A;  4FBV A;  1W5R A;  1VWB B;  4YDB A; 
#chains in the Genus database with same CATH homology
 2HZQ A;  3HK1 A;  4BVM A;  5FQ7 E;  1P6P A;  1A18 A;  2BT9 A;  4AZP A;  4KC7 A;  1KT3 A;  3E3C A;  4I3C A;  4GH7 A;  1D2U A;  1GX9 A;  4U8U N;  4K19 A;  2QO6 A;  3OJY C;  4IBA A;  2OFM X;  1KGL A;  4PSQ A;  3D95 A;  1FEN A;  4A60 A;  4DQ3 A;  3RWX A;  1OEK A;  1A2D A;  2RD7 C;  2X8T A;  4GRJ A;  1GT1 A;  3CWK A;  4ZH6 A;  4ZHH A;  4KT5 A;  1HBQ A;  3KFI A;  5EEE A;  1HN2 A;  2Z4I A;  2FLJ A;  4ZHG A;  1OBQ A;  1X71 A;  2CZT A;  5FQ6 E;  3UEW A;  3TGB A;  2ANS A;  3I17 A;  2Q2P A;  3UEX A;  2OZQ A;  2CM4 A;  5HWZ A;  1NP4 A;  1E06 A;  2JOZ A;  4IAB A;  2LBV A;  5BYP A;  3WJG A;  1YP6 A;  5LJB A;  1FDQ A;  4OMX A;  3VG6 A;  2IFB A;  1ZND A;  4TKH A;  3OE3 A;  1DF3 A;  3OBL A;  2KW1 A;  5FQ8 E;  1CBR A;  3HOE A;  4U8U O;  3AKM A;  3S5X A;  3C76 X;  1I04 A;  3VG2 A;  4XMC A;  4OS3 A;  1KOI A;  4QGX A;  1ADL A;  1TOW A;  4LKT A;  1IFC A;  4O9S A;  4NW4 A;  1JJJ A;  1IKE A;  3U9P C;  5HZ9 A;  2ACO A;  5K06 A;  2OVS A;  4N7C A;  3EMM A;  2A2G A;  5KIC A;  3ZW1 B;  4TKB A;  3ZW2 A;  4QNI A;  1AVG I;  1X89 A;  2A2U A;  4NNS A;  2LB6 A;  1XCA A;  4NYQ A;  4ZJ0 A;  3S60 A;  1CBI A;  1YWA A;  4HPC A;  2XST A;  1R0U A;  1N0S A;  2KTD A;  3ZZV A;  4ARH A;  5IO7 A;  3HWF A;  1EIO A;  1ZNH A;  1BWY A;  1YWC A;  1MVG A;  3QKG A;  4Y0R A;  1BJ7 A;  1DFV A;  2GTF X;  4KH8 A;  1BM5 A;  4MIR A;  5HZ8 A;  3OD9 A;  3IA8 A;  3FA9 A;  1UZ2 X;  3ZWE A;  2G78 A;  5D48 A;  1DZJ A;  2F09 A;  3WJE A;  2QOS C;  4FQB B;  2Z4H A;  3B2H A;  4Y0P A;  1LID A;  2LFO A;  3HWE A;  4GZV A;  3WJB A;  1HQP A;  5H9L A;  1ML7 A;  4ZR2 A;  5HBS A;  1DV9 A;  3NQK A;  2X8F A;  1ERB A;  1XKI A;  2KT4 B;  1DZP A;  2RN4 A;  4XMF A;  1EPA A;  3U03 A;  3ZUO A;  4HFO A;  2PY1 A;  1KZX A;  5L8N A;  3PQS A;  1KQX A;  3UAQ A;  1O1U A;  2JU8 A;  4MIS A;  4QZT A;  4CK4 A;  1SXY A;  1SY1 A;  5JR8 A;  3EYC A;  3BRN A;  1HMT A;  1SY0 A;  1H91 A;  3HWG A;  3FA7 A;  3P6F A;  1U0X A;  4QRL A;  4ZCB A;  1IIU A;  3KFG A;  2OVE A;  1EW3 A;  1MX8 A;  4O4O A;  4YDA A;  4OS0 A;  3EM0 A;  2RCT A;  1S2P A;  5C0N A;  4WFU A;  3FEK A;  1I4U A;  3MVF A;  3FA8 A;  3HTY A;  1S7D A;  2DM5 A;  2YMS A;  3UEU A;  1RBP A;  4DQ4 A;  3NPO A;  3HWD A;  5HCD C;  2WEX A;  1ACD A;  4QAE A;  1KT7 A;  2BHV A;  4M7M A;  3CQR A;  3DSZ A;  4YBU A;  2QM9 A;  1IFB A;  5H8T A;  1BSO A;  5D45 A;  2R74 A;  4ODD A;  1ERX A;  3LV4 A;  1LF7 A;  5KHP A;  1L6M A;  3BDR A;  2LBA A;  4ORY A;  3ZW0 A;  2X45 A;  4NP1 A;  4YCH A;  1E00 A;  1EI5 A;  2HMB A;  4IB7 A;  1ZNG A;  3WBG A;  3WXQ A;  4XMH A;  1B56 A;  1X8U A;  3B2J A;  3D96 A;  4O3X B;  3FW4 A;  1T68 X;  1HMR A;  1FE3 A;  5LJH A;  4EQA C;  5DPQ A;  4KC8 A;  5F6Z A;  5HCE C;  4I3B A;  3BSZ E;  4QYN A;  5FAZ A;  1D3S A;  3F6Z B;  3GAQ A;  2FR2 A;  1QY0 A;  1BRQ A;  4O4X A;  4XME A;  1LFO A;  1U18 A;  4IMO A;  2CBR A;  3VE1 A;  4YBP A;  4I9S A;  1GKA A;  1ICN A;  4PJ2 A;  1CRB A;  1LIF A;  1I06 A;  5CE4 A;  3FMZ A;  1JJX A;  2L9C A;  1OPA A;  2OVD A;  3FYF A;  4ORR A;  3MBT A;  4IAX A;  1LIE A;  3WJF A;  2HZR A;  1GGL A;  1BRP A;  5H9K A;  2BLG A;  3BLG A;  3EBW A;  3WJD A;  1HMS A;  1YUP A;  4EXZ A;  4NYR A;  1GX8 A;  3F9D A;  4U3Q A;  3ELX A;  3ZUI A;  5FFH A;  4HPA A;  5L8O A;  5H9N A;  3RSW A;  1QWD A;  3STN A;  3CBC A;  4AZR A;  3N91 A;  4I9R A;  1T0V A;  3FEL A;  1OEE A;  3PEC A;  3U0D A;  1O1V A;  3KQ0 A;  5IO5 A;  2HYS A;  3CR6 A;  5LKE A;  3CQN A;  2NNQ A;  1SMP I;  1EPB A;  4YGG A;  2L68 A;  2RCQ A;  1I05 A;  4EDE A;  4RUU A;  4IAW A;  2RA6 A;  3GE2 A;  2NNE A;  1U17 A;  2CZU A;  1IW2 A;  2X46 A;  5HTE A;  2E4J A;  4KII A;  1B0O A;  3V8U A;  1SXW A;  3TGC A;  1IKJ A;  3STK A;  3S5V A;  3STM X;  1ZNL A;  1AQB A;  4HPB A;  3PED A;  4YFQ A;  1O8V A;  2KTS A;  4N7D A;  4ZGU A;  2A13 A;  2FR3 A;  4JGL A;  2MHD A;  2WR6 A;  3I0A A;  3VG7 A;  3KZA A;  1QFV A;  1QQS A;  3BX8 A;  3O19 A;  1LIC A;  1YP7 A;  4YGH A;  1OBP A;  4NNT A;  2AMM X;  3HOL A;  2XKL A;  1QG5 A;  1MUP A;  4MVK A;  5D4A A;  4CV7 A;  4YH0 A;  2GC9 A;  2F73 A;  1KQW A;  3MX7 A;  4YFP A;  5BVS A;  1CJ5 A;  4EEJ A;  3B2K A;  1X8P A;  2JMB A;  2LKK A;  4ORU A;  3NQ3 A;  5EZ2 A;  4QQ1 A;  1G85 A;  1BBP A;  1X8Q A;  2ALL X;  1KZW A;  2FT9 A;  1BLR A;  3SAO A;  5HA1 A;  3NQ9 A;  1AB0 A;  1JZU A;  3KFF A;  5AJC A;  4XMD A;  1VYG A;  2BS5 A;  3FIQ A;  2G79 A;  4ALO A;  5FEN A;  4BQU A;  1S44 A;  5EPQ A;  2AH7 X;  5HZ5 A;  3LHN A;  2AT0 X;  4XMG A;  1BSY A;  5F6B A;  4ZHF A;  4NLI A;  1JV4 A;  3CMP A;  4LQZ A;  1MDC A;  3APU A;  4QGW A;  4TQ2 A;  2N93 A;  1AEL A;  2AKQ A;  2W2A A;  4GE1 A;  1TVQ A;  2JW1 A;  4CSB A;  3VG4 A;  1DZK A;  2FTB A;  1JYJ A;  1Y9T A;  2K62 A;  2WSJ A;  3BY0 A;  1VPR A;  3P6E A;  2FWV A;  4A1H A;  2JU3 A;  1YIV A;  4L1N A;  2WEW A;  4GET A;  3B2I A;  4FBR A;  1Z24 A;  3DTQ A;  4OMW A;  1T8V A;  3CBS A;  1LIB A;  2A0A A;  3P24 A;  5AQ6 A;  3SOT A;  2ASN X;  1A57 A;  4ALB A;  3S26 A;  3EBK A;  4O4U A;  4ZHC A;  1URE A;  1PMP A;  2CM9 A;  4IB6 A;  1PM1 X;  2QO5 A;  4QGV A;  2A3F X;  5HA0 A;  2P8G A;  3VE2 A;  2POA A;  2FS7 A;  2GTL M;  4I95 A;  5AEO A;  1GM6 A;  4U9C A;  3FEN A;  4IMN A;  3VPJ E;  5CYB A;  3UEV A;  4IB8 A;  1EUO A;  4NLJ A;  1JYD A;  1A3Y A;  5DG4 A;  2OVA A;  2QMI A;  3H3I A;  5H9A A;  3ZW0 B;  2LA7 A;  1SXX A;  3RKG A;  1YWB A;  3F8A A;  4L3R A;  5HZ6 A;  4ORX A;  4ON1 A;  4YKO A;  3WVM A;  4FGI B;  4YKM A;  3JS1 A;  5EDB A;  2M4L A;  3O22 A;  2NND A;  3PH6 A;  5LJD A;  2QO4 A;  1OPB A;  4LKP A;  4RUN A;  5IO6 A;  3G7X A;  2Q2M A;  2W2F A;  3PQU A;  4QZU A;  3ZI8 A;  3ZW1 A;  1PBO A;  2EU7 X;  3TF6 A;  4BOE A;  2JU7 A;  2WQ9 A;  4O3Z A;  3NX2 A;  5LJG A;  2WQA E;  4WFV A;  4D6B A;  3PH5 A;  3BU1 A;  1X8O A;  4A8Z A;  1G7N A;  2AT3 X;  4D6A A;  2GTL N;  2MJI A;  1GKA B;  1TW4 A;  4UU3 A;  1SY2 A;  1VYF A;  3P6G A;  4GK9 A;  4GU8 A;  3RZY A;  1EII A;  3Q6L A;  4AZO A;  1NGL A;  1GT4 A;  1ALB A;  1FEM A;  1NP1 A;  2G7B A;  2O62 A;  3NBX X;  2L5P A;  4HPD A;  4COT A;  2R73 A;  3TGA A;  4TLJ A;  3C78 X;  1QFT A;  2CBS A;  4OS8 A;  3JQO A;  1LNM A;  1KT6 A;  1OBU A;  3FW5 A;  4EFG A;  4ID2 A;  4ZFX A;  5HAE A;  1TOU A;  3IFB A;  2X8S A;  3NR3 A;  4YMY A;  4FBO A;  3KFH A;  1SXU A;  3BS2 A;  5F58 A;  3PPT A;  1CBQ A;  3P02 A;  4ZH9 A;  3TZS A;  4ORW A;  3VG5 A;  2MWH A;  5L8I A;  2MM3 A;  1EXS A;  1SA8 A;  1B4M A;  1FTP A;  3P6H A;  2R56 A;  1B8E A;  1E02 A;  5B29 A;  1LPJ A;  3P6D A;  2GTL O;  4QYP A;  3PP6 A;  2Q39 A;  4A1Y A;  4YCE A;  2KD2 A;  1ZNE A;  5EED A;  4AZM A;  4MVL A;  4Y0Q A;  4O3W A;  1GXA A;  1E5P A;  3BU9 A;  4O3Y A;  3B2L A;  4O49 A;  1G74 A;  5LKF A;  2YG2 A;  1KT5 A;  2Q4N A;  3FR5 A;  5HZQ A;  1JBH A;  1EQD A;  4I3D A;  2W2B A;  2FS6 A;  1QY1 A;  1ZRY A;  3L4R A;  4ZHD A;  1FEL A;  2L67 A;  2JN3 A;  2WWP A;  4GNY A;  4WHI A;  5B27 A;  5F1E A;  3ZQ3 A;  3APX A;  3APW A;  4ML7 B;  3BX7 A;  5LJE A;  4ORS A;  4WBK A;  5HCC C;  4UU2 A;  3T1D A;  5HTD A;  5F7G A;  1KT4 A;  1X8N A;  4R0B A;  3FR4 A;  1JIW I;  1QY2 A;  2K23 A;  3NP1 A;  2Q9S A;  1PEE A;  3P6C A;  4HWM A;  1LKE A;  1ICM A;  3FR2 A;  2AL0 X;  1RLB E;  3WOV A;  2FRS A;  2ACP X;  4MVE A;  1EAL A;  4I6S A;  2AT8 X;  3ELZ A;  4O4S A;  4TNN A;  1CBS A;  4KCA A;  3O2Y A;  3K3L A;  4GDZ A;  3AKN A;  4LZV A;  3RBY A;  4ES7 A;  2NP1 A;  2OFR X;  3D4R A;  5AJB A;  1DZM A;  3FLL A;  5KID A;  5EDC A;  5BVQ A;  3D97 A;  4AZQ A;  5D47 A;  4AW8 A;  1KXO A;  2GJ5 A;  1SY3 A;  4ZGF A;  1G5W A;  4LZU A;  3C77 X;  4YFR A;  2ZAI A;  1HBP A;  5LJK A;  3WJC A;  2HLV A;  2AT6 X;  4Y0S A;  3JSQ A;  2BS6 A;  1Y9L A;  1OEJ A;  4MVI A;  4AYH A;  4IB9 A;  1GT5 A;  2HNX A;  4AZN A;  3NX1 A;  4M6S A;  1BSQ A;  4TKJ A;  4U8U M;  4GKC A;  2WUT A;  4INN A;  1ZNK A;  1MX7 A;  2RQ0 A;  2ZAG A;  2MO5 A;  5D8J A;  1GT3 A;  4GNW A;  2AT5 X;  4TJZ A;  5LJC A;  3NAD A;  3APV A;  3VU1 A;  1DC9 A;  4YGZ A;  3FA6 A;  3FEP A;  3VG3 A;  1YWD A;  1TXL A;  1BEB A;  5BVT A;  1QAB E;  4FBV A;  4YDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...