3MVFA

Crystal structure of nitrophorin 4 from rhodnius prolixus complexed with nitrite at ph 7.4
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
184
structure length
184
Chain Sequence
b'ACTKNAIAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQVESLGKYTANFKKVDKNGNVKVAVTAGNYYTFTVMYADDSSALIHTCLHKGNKDLGDLYAVLNRNKDAAAGDKVKSAVSAATLEFSKFISTKENNCAYDNDSLKSLLTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrophorin-4
publication title Formation of the complex of nitrite with the ferriheme b beta-barrel proteins nitrophorin 4 and nitrophorin 7.
pubmed doi rcsb
source organism Rhodnius prolixus
molecule tags Transport protein
total genus 48
structure length 184
sequence length 184
ec nomenclature ec 1.7.6.1: Nitrite dismutase.
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3mvfA00
4I9RA 3Q6LA 3EM0A 4HPAA 3IA8A 1DC9A 1LFOA 2G7BA 4AYHA 4ORRA 1SY0A 2FWVA 2OVDA 1X8QA 2Q2MA 3TZSA 1KZWA 5D4AA 1G7NA 3MBTA 3PP6A 4ZHFA 5BVQA 5LKFA 3VG3A 1FENA 5HZ6A 2L9CA 3B2IA 1CJ5A 1I4UA 5LJHA 3U9PC 2W2BA 1EPBA 1ACDA 1OEJA 2A2GA 3ZUOA 5D8JA 4LZVA 5K06A 2K23A 1S7DA 1X89A 4ORSA 2WQ9A 2AT5X 1CRBA 1ML7A 1GT1A 4M7MA 1EXSA 4MVKA 3AKNA 4XMCA 1ERXA 5FFHA 2AH7X 1QY0A 4YDBA 2RD7C 4YFQA 1ALBA 5HA0A 3HWDA 4NNTA 2A0AA 2GJ5A 3NQ9A 3D95A 1FEMA 3VG7A 4EXZA 1MX8A 3FW4A 3RSWA 1EW3A 3QKGA 1BEBA 4BVMA 4HPDA 4YFRA 1O1VA 2POAA 1X8UA 1JJXA 4TLJA 1TW4A 5LJCA 3WJGA 3HWEA 3NP1A 3NADA 3VG4A 5AQ6A 3O22A 3KFHA 2RQ0A 3BX8A 4ZR2A 4A8ZA 4Y0SA 3FLLA 1H91A 2JU8A 2QO4A 4TKBA 3CMPA 2CZTA 4I9SA 1A18A 1ZNKA 5EEEA 1PEEA 1RLBE 1SA8A 3ELXA 2OFMX 3KFFA 2ASNX 2X45A 1YIVA 2R56A 4ZGUA 1LIBA 4IB7A 3TGAA 3L4RA 1D3SA 3C78X 3CBCA 3D96A 2LB6A 4GNWA 1DV9A 1U0XA 1ZNDA 2WQAE 1LPJA 5BVSA 1P6PA 1AELA 5LJEA 4Y0QA 4D6BA 1JYJA 1AB0A 1YWAA 3FR5A 3CWKA 5LJGA 4XMGA 3STKA 3UEVA 2OVAA 3JSQA 4BQUA 5HZ9A 2KTDA 4OMXA 1EIOA 1SXWA 3KQ0A 4N7DA 4DQ3A 3PH6A 4ODDA 3ZQ3A 4KIIA 3B2LA 3K3LA 3FA7A 2N93A 1HBPA 1B0OA 5DG4A 1YUPA 1XCAA 1MDCA 4YCHA 3CBSA 5F7GA 3WJDA 4YH0A 2AT3X 1E02A 2W2AA 2G78A 5HCEC 5HA1A 4ZHCA 1G85A 1GKAA 4ALBA 1YWBA 4QAEA 5L8IA 1KT4A 5HCDC 3VG6A 2RA6A 1B4MA 4NYRA 2Q39A 4Y0RA 2AKQA 2CZUA 4TKJA 4OS8A 4QGXA 1KGLA 1KT3A 2NNEA 2MO5A 3IFBA 5HZ5A 3TGBA 4TQ2A 1LICA 4NNSA 4AZQA 1QY1A 4R0BA 3EBKA 1EPAA 2A3FX 2MJIA 3STNA 1FTPA 3TGCA 1GT3A 2AT0X 3NR3A 1TOUA 2MM3A 1LIEA 3WJEA 3T1DA 1U17A 2IFBA 3NQ3A 1TVQA 1EALA 4YGZA 4A1YA 1X8OA 3WXQA 1X8PA 5EEDA 3BY0A 2Q4NA 4ZHHA 1T68X 4QZTA 5EDBA 4LKTA 1HBQA 4ARHA 2G79A 4O9SA 3WJFA 3KZAA 4IB9A 2HNXA 2JN3A 3PH5A 3OJYC 2DM5A 5JR8A 4GETA 2WEXA 1VYGA 1OBQA 4OS3A 3D97A 1DZMA 4UU3A 1LKEA 3APWA 1HMRA 1TXLA 1JZUA 3ZUIA 4TKHA 1D2UA 3FEKA 4I3CA 5B29A 1ZNLA 2AT6X 3JS1A 4YKMA 1AVGI 1EUOA 1OPBA 1YWCA 4AZNA 1O1UA 1FDQA 2CBRA 3FR2A 4HPBA 1BSOA 1ZNEA 4I3BA 1EQDA 3FA9A 3S26A 1DZPA 4GNYA 1KOIA 1OBUA 1YP6A 2L67A 2HLVA 3BU9A 3FENA 2OZQA 5L8OA 1ZRYA 3UEUA 3P6CA 2P8GA 1GGLA 2NNQA 4A1HA 1CBIA 1S44A 4XMEA 1DFVA 1KZXA 1IFCA 2OVEA 1IIUA 4ORYA 3APXA 2O62A 3PECA 1NGLA 3HWFA 1IKEA 4UU2A 1BSYA 4MVIA 5EPQA 1BJ7A 3CQNA 3EBWA 3P6GA 3F9DA 4EEJA 2ALLX 5L8NA 1NP4A 4OMWA 5FAZA 1SY1A 1JBHA 3FEPA 2F73A 4BOEA 4IAWA 5HTEA 1I05A 5F6BA 2YG2A 2Q9SA 3FELA 4ZHDA 2CM9A 1R0UA 5LJDA 3ELZA 4PSQA 2FLJA 1OPAA 4TJZA 1DF3A 4AZPA 3VG2A 1S2PA 1UZ2X 1Z24A 1BWYA 1QY2A 4IB8A 5H9KA 1LF7A 3WJCA 4XMFA 4QGVA 4YKOA 5F58A 4YBUA 2R73A 5BVTA 1ICNA 1EIIA 1NP1A 4ZJ0A 5D45A 3UEWA 1KT5A 3BSZE 1KT6A 4YCEA 5DPQA 1QABE 4TNNA 1PM1X 2L5PA 1E06A 1E5PA 2EU7X 4HPCA 4RUUA 3FIQA 3TF6A 2FR2A 4NYQA 2E4JA 1O8VA 2AT8X 5H9AA 2QO5A 1LIFA 3SAOA 3O2YA 3HWGA 2XKLA 4NLIA 2FTBA 3BS2A 4QZUA 1CBRA 3P6EA 4N7CA 3KFIA 4YDAA 3BU1A 1ICMA 3GAQA 1BSQA 5IO7A 4AZRA 3FW5A 2WR6A 3APUA 2CBSA 4Y0PA 5H9LA 4RUNA 5EZ2A 5D48A 4QYPA 4AZOA 4XMHA 3MVFA 2A2UA 3FR4A 3UEXA 1IKJA 3P6DA 1MUPA 5CE4A 1I06A 1BLRA 5HAEA 1BBPA 3STMX 5FENA 4ZFXA 3I0AA 2R74A 1SY2A 1G74A 4LZUA 3EMMA 1XKIA 2GTFX 1GX8A 3BDRA 3FMZA 5KHPA 2Q2PA 1ZNHA 2CM4A 1ERBA 2FS7A 2GC9A 3NX2A 2JU3A 3EYCA 1B56A 1N0SA 3NPOA 4GE1A 3C77X 4K19A 3BLGA 1AQBA 4DQ4A 2FS6A 2QM9A 2HZRA 1GT4A 4NLJA 3FA6A 2LBVA 1QWDA 1MVGA 1UREA 2HMBA 3B2KA 3P6HA 5KIDA 4WFUA 5B27A 1JV4A 2X46A 3G7XA 3PPTA 2WEWA 4OS0A 1A2DA 3B2JA 4YGHA 4YGGA 1ZNGA 2FR3A 4MVLA 1QFTA 2AMMX 5LKEA 1QQSA 4IB6A 2AL0X 1HMSA 2BLGA 2LKKA 3CQRA 3PEDA 5F1EA 1QFVA 1DZJA 4GRJA 1SXYA 1YP7A 4NP1A 3BX7A 1ADLA 3VG5A 1PMPA 1QG5A 2PY1A 1FELA 4ALOA 2W2FA 4EDEA 2A13A 4ORUA 2WUTA 4ZH6A 3C76X 2ACPX 1VPRA 4I3DA 1CBQA 1T8VA 1A57A 4YBPA 4ORWA 3CR6A 3FA8A 4GKCA 5HBSA 4ZH9A 5HZQA 5HZ8A 1U18A 3U03A 3F8AA 3BRNA 1LIDA 1BRQA 4WBKA 1BRPA 1X8NA 1KXOA 3RZYA 5IO6A 2ACOA 3APVA 4WFVA 4ZHGA 1CBSA 3NX1A 1BM5A 1HQPA 4IMNA 5HTDA 5LJKA 5EDCA 2KT4B 3O19A 2HZQA 1TOWA 1SY3A 3WJBA 4IAXA 2L68A 1HMTA 1GKAB 3KFGA 5IO5A 2QO6A 3DTQA 4ES7A 1GT5A 1GX9A 3B2HA 3WBGA 4D6AA 2QOSC 1OEEA 5H9NA 2NNDA 4QYNA 1JYDA 4GH7A 1DZKA 1IFBA 2ANSA 2JU7A 1OEKA 4ORXA 1A3YA 1T0VA 2OFRX 3P6FA 2HYSA 1KT7A 2WSJA 2NP1A 1I04A 3WVMA 5LJBA 4LKPA 3U0DA 4EFGA 1GM6A 4ZCBA 4XMDA 4CK4A 2WWPA 3HK1A 2FRSA 1RBPA 5HCCC 2FT9A 2LFOA 1MX7A 2JOZA 1LNMA 1X71A 4HFOA 3I17A 1HN2A 1GXAA 5H8TA 5KICA 4AZMA 1IW2A 4IBAA 4M6SA 1VYFA 1KQXA 2K62A 4IMOA 1B8EA 1JJJA 3AKMA 1SXXA 5D47A 1G5WA 1E00A 4QGWA 1SXUA 4YMYA 1PBOA 5HWZA 2RCQA 1YWDA 4A60A 4AW8A 2LBAA 1L6MA 3DSZA 1FE3A 2XSTA 5F6ZA 2RCTA 4YFPA 1KQWA 1OBPA 5C0NA
chains in the Genus database with same CATH superfamily
3FIDA 1VWCB 4I9RA 3Q6LA 3VHMA 5IRWA 3EM0A 1W5RA 4HPAA 3IA8A 4COTA 1DC9A 1LFOA 2X32A 2IZBA 2G7BA 2X8SA 4ORRA 4AYHA 1SY0A 3WOVA 2FWVA 3S60A 3PDFA 2OVDA 5L3YA 1X8QA 1KL5A 5F2BA 2Q2MA 3TZSA 1KZWA 2RTAA 1I9HA 5D4AA 1G7NA 3MBTA 3PP6A 4BX5B 4BJ8A 1VWEB 4ZHFA 5BVQA 5LKFA 3VG3A 1FENA 5CSEA 5HZ6A 2L9CA 2X56A 3B2IA 4Y5DA 1SLDB 3ZW2A 1CJ5A 1I4UA 3VPJE 5LJHA 3U9PC 2W2BA 1EPBA 4BX6A 4JNJA 1ACDA 1OEJA 1N9MA 2A2GA 4MIRA 5D8JA 4LZVA 3ZUOA 5K06A 2K23A 1S7DA 1X89A 3RDXA 2GTLM 2KD2A 4ORSA 2BT9A 4I6SA 2WQ9A 2AT5X 1CRBA 1ML7A 1SLEB 1GT1A 4M7MA 1WUBA 1EXSA 2I5ZO 3RDQA 4MVKA 3AKNA 4CDFA 3RDSA 1UYOX 4XMCA 4BX7A 1ERXA 1LELA 5FFHA 1JMZA 1OSPO 1QY0A 1VWKB 4YDBA 2AH7X 2RTMA 2RD7C 3RDUA 4YFQA 4DCBA 3T2WA 1ALBA 2AF5A 3VE1A 3OD9A 3HWDA 4NNTA 5HA0A 4Z28A 2A0AA 2IZJA 4MVEA 2FHNX 3KVNA 5KICA 2GJ5A 3NQ9A 3D95A 1FEMA 3VG7A 1STPA 1MX8A 3SLJA 3FW4A 4OKAA 4EXZA 1SWEA 3RSWA 1EW3A 3QKGA 1BEBA 4BVMA 4FBOA 4HPDA 4YFRA 1O1VA 2HKDA 2POAA 4QQ1A 1X8UA 5CHKA 2IZDB 1JJXA 1SWPA 4TLJA 4O3ZA 1SWQA 1TW4A 5LJCA 3WJGA 3HWEA 3NP1A 3NADA 4WHIA 1DF8A 3VG4A 5AQ6A 3O22A 3KFHA 3PQUA 2RQ0A 2A5BA 3BX8A 4ZR2A 2GTLO 2OVSA 4A8ZA 4Y0SA 1VWQB 3FLLA 4C5PA 1H91A 2F09A 3MM0A 4Z2VA 2JU8A 2QO4A 4TKBA 4MEEA 3CMPA 2CZTA 4I9SA 5B11O 1A18A 1ZNKA 2QMIA 2RTJA 1RLBE 1SA8A 5EEEA 2RTRB 2OFMX 3ELXA 3KFFA 1PEEA 2ASNX 4GZVA 3RY2A 5B2AO 2X45A 1YIVA 4EQAC 2JMBA 2R56A 3F6ZB 5AJCA 4ZGUA 1LIBA 3FYFA 4IB7A 3TGAA 3L4RA 1D3SA 3C78X 3CBCA 3D4RA 1VWIB 3D96A 4Z27A 2OY8A 4TNNA 2LB6A 3P02A 4GNWA 1DV9A 4ZGFA 4Z6JA 1NBXA 1U0XA 1ZNDA 1N9YA 2WQAE 1LPJA 4I60A 1P6PA 4U3QA 5BVSA 1AELA 2FKJA 3TF6A 5LJEA 4Y0QA 4D6BA 1JYJA 1AB0A 1YWAA 3FR5A 2IZKA 3CWKA 5LJGA 1HQQA 1JMXA 4XMGA 3STKA 3H3IA 4CPHB 3UEVA 2OVAA 2IZFB 1VWHB 3JSQA 4BQUA 1SWFA 2KTDA 4OMXA 3ZW1B 5HZ9A 1SXWA 1WBIA 1EIOA 3SZJA 3KQ0A 4N7DA 3EW2A 1SRIA 4DQ3A 4L1NA 4CDEA 2QCBA 3PH6A 4RUUA 4ODDA 3ZQ3A 4KIIA 3B2LA 3K3LA 3FA7A 2N93A 1HBPA 2YMSA 4FGIB 2ZAGA 1B0OA 5DG4A 3EC5A 1FJ1E 1YUPA 2RTDB 3MX7A 1XCAA 1Y55X 3FDCA 1MDCA 4YCHA 2MWHA 3CBSA 5F7GA 4YH0A 4IRWA 5AJBA 3WJDA 2AT3X 1E02A 2W2AA 2G78A 2DJFA 3AEHA 5HA1A 5HCEC 4ZHCA 2QOMA 3NBXX 4BBOA 4GJVA 2BC3A 1G85A 1GKAA 4ALBA 1YWBA 4QAEA 5L8IA 1KT4A 5HCDC 1IJ8A 5K68A 2IZLB 2RA6A 3VG6A 1VWDB 4NYRA 1B4MA 2Q39A 2RTBB 4GUZA 4Y0RA 2AKQA 2OL7A 1SWAA 2CZUA 2G5LA 2IZGB 4TKJA 2OF9A 4OS8A 4QGXA 3S5XA 1KT3A 1KGLA 3HPEA 2NNEA 2MO5A 2X4MA 3IFBA 3WZQA 3LV4A 5HZ5A 3TGBA 4OELA 1SWTA 4TQ2A 1MM9A 1LICA 4NNSA 4AZQA 1QY1A 1JJUA 4R0BA 3EBKA 2KTSA 1I78A 1SWRA 3RDMA 1EPAA 2A3FX 2MJIA 3SZIA 1K3BA 3STNA 1FTPA 2MF6A 4BX7B 3TGCA 1GT3A 2AT0X 3NR3A 1TOUA 2MM3A 1LIEA 3WJEA 3T1DA 4GD9A 1U17A 2IFBA 3NQ3A 3RE6A 1SRJA 1TVQA 2A8GA 1EALA 4YGZA 4A1YA 1X8OA 2RTFB 4ID2A 2OY5O 1SWOA 4U8UM 3WXQA 1X8PA 5EEDA 3VHHA 2FHLA 4CSBA 2GTLN 4KT5A 3BY0A 3Q34A 2Q4NA 4ZHHA 1T68X 2JGSA 2ZAIA 3ZI8A 1VWOB 4O49A 4QZTA 5EDBA 4LKTA 1HBQA 4ARHA 2G79A 4O9SA 3WJFA 3KZAA 4IB9A 2HNXA 2JN3A 3PH5A 4O4UA 1RSUB 1Y9LA 5IRUA 4U46A 3VE2A 3OJYC 4NV7A 3P24A 2DM5A 3VHIA 5JD2A 5JR8A 4GETA 2WEXA 1VYGA 1OBQA 4OS3A 3AUMO 1NQNA 1RXKA 1DZMA 3D97A 4PJ2A 4UU3A 1LKEA 3APWA 3S5VA 1HMRA 1TXLA 2OFBA 3ZUIA 4TKHA 1D2UA 1JZUA 3FEKA 4I3CA 5B29A 1HXLA 1PBYA 1ZNLA 2AT6X 3JS1A 4YKMA 1AVGI 3JQOA 1EUOA 1OPBA 1YWCA 1Y9TA 4AZNA 2LA7A 1O1UA 1FDQA 2CBRA 1SWSA 1N43A 3FR2A 4HPBA 1BSOA 2C1SA 2WPUA 4LQZA 1ZNEA 4I3BA 4O3WA 1EQDA 3T6FA 3FA9A 3S26A 1DZPA 1SRHA 1KOIA 1OBUA 4GNYA 1N4JA 1YP6A 2L67A 4U8UO 2RTQB 2HLVA 2RTCB 1HY2A 2Y3EA 2OZQA 3BU9A 3FENA 4KC8A 1ZRYA 4GK9A 3UEUA 5L8OA 2X8TA 3P6CA 1GGLA 2P8GA 2NNQA 4A1HA 1CBIA 1S44A 4XMEA 1DFVA 1KZXA 1JQPA 2X8FA 5B10O 1IFCA 1VWNB 2OVEA 3ZZVA 3HOEA 1IIUA 4ORYA 3APXA 2O62A 3PECA 1NGLA 3HWFA 1IKEA 4UU2A 1BSYA 4MVIA 5EPQA 3WZNA 1BJ7A 3CQNA 2JW1A 3EBWA 3F9DA 3P6GA 4EEJA 2ALLX 3CKFA 5L8NA 1NP4A 4OMWA 5FAZA 1SY1A 5B5FA 1JBHA 4GJSA 3FEPA 4OEMA 2F73A 4BOEA 4GGZA 2RTGB 1KL4A 4I95A 3NQKA 4IAWA 3WZOA 2VDFA 5HTEA 1I05A 5F6BA 5FQ8E 2Y3FA 2Q9SA 2YG2A 2RTHB 3PK2A 4EKVA 3FELA 4ZHDA 2CM9A 1R0UA 5LJDA 3ELZA 1RXJA 4PSQA 2FLJA 1OPAA 4GDAA 4TJZA 2X55A 1DF3A 1KL3A 4AZPA 1GX3A 4FBVA 5IXGA 3VG2A 2RTOB 1S2PA 4CV7A 1UZ2X 3T2XA 2Z4IA 1Z24A 1BWYA 1QY2A 4IB8A 5H9KA 1LF7A 2RTNB 4HWMA 4XMFA 3WJCA 4QGVA 4YKOA 5F58A 3SLTA 4L3RA 4YBUA 2R73A 3WYQA 1ICNA 5BVTA 1NP1A 1EIIA 2OL8O 3RE5A 4ZJ0A 2C4IA 1HXZA 1LDOA 2VFCA 5D45A 3UEWA 3LHNA 1KT5A 1LDQA 3BSZE 3WZPA 1KT6A 4YCEA 3RWXA 3MG5A 5DPQA 1QABE 2RTIB 1PM1X 1SREA 1E06A 1E5PA 1SWKA 2CAMA 2EU7X 2L5PA 1VWGB 3FIQA 4HPCA 2FR2A 3PQSA 3T6LA 4NYQA 2E4JA 4KC7A 1O8VA 1VWMB 4GGTA 2AT8X 1SMPI 5H9AA 2QO5A 1LIFA 2BS5A 2PI3O 3RBYA 3SAOA 3O2YA 3V8UA 3HWGA 4JO6A 4BX6B 2XKLA 4NLIA 4BGFA 1Y53X 2FTBA 3BS2A 2GH7A 4QZUA 1CBRA 1VWLB 3P6EA 3KFIA 4N7CA 4YDAA 3BU1A 1ICMA 2IZEB 2RTPB 1SWLA 3GAQA 1BSQA 5IO7A 4AZRA 3FW5A 2WR6A 3APUA 2CBSA 4Y0PA 5H9LA 4RUNA 4O4XA 1W4TA 4O3XB 5D48A 4QYPA 3LTWA 5EZ2A 1NDJA 4XMHA 3RDOA 1AVDA 4AZOA 5K67A 3MVFA 3D9WA 3VU1A 2MHDA 3ZW1A 2A2UA 2BHVA 3FR4A 3UEXA 1IKJA 3P6DA 1MUPA 5CE4A 1I06A 1BLRA 5HAEA 4B55A 1BBPA 2IZAA 1SWUA 3STMX 5FENA 3QQ2A 4ZFXA 3GE2A 1VWJB 3I0AA 4KCAA 2OY1O 4O3YA 2R74A 1SY2A 3ZW0A 1SWDA 1G74A 1PTSA 1STSB 4U8UN 3OE3A 4LZUA 3EMMA 1XKIA 2GTFX 1GX8A 3BDRA 3FMZA 5KHPA 2Q2PA 1ZNHA 3HTYA 2OF8A 2CM4A 1ERBA 2FS7A 2C1QA 2GC9A 3NX2A 2JU3A 2AVIA 3EYCA 3OBLA 1VWRB 4CDCA 1B56A 1N0SA 3NPOA 4NW4A 2ZSCA 4GE1A 3C77X 3SZHA 4K19A 1LUQA 1VWFB 3BLGA 1AQBA 4DQ4A 2Z4HA 2FS6A 2RTEB 2QM9A 1KFFA 1VYOA 1GT4A 2HZRA 3FA6A 4NLJA 4O4OA 2LBVA 4CPFA 1QWDA 1E2TA 1MVGA 1UREA 2HMBA 3B2KA 3P6HA 4QRLA 4WFUA 5KIDA 5B27A 4Z2PA 1LCWA 1JV4A 2X46A 3G7XA 3PPTA 1W6FA 2WEWA 4OS0A 1A2DA 3HOLA 3B2JA 4YGHA 4YGGA 1MK5A 3ZWEA 1SWGA 1SWJA 1ZNGA 2UYWA 2FR3A 4MVLA 1QFTA 2AMMX 5LKEA 1QQSA 4IB6A 4BX5A 1JIWI 2AL0X 2IZIA 3SOTA 1HMSA 4ML7B 2BLGA 1Y0GA 2LKKA 3CQRA 2IZCB 3PEDA 2F01A 5F1EA 1QFVA 1DZJA 4IABA 4GRJA 1SXYA 2KW1A 1YP7A 4NP1A 3BX7A 1ADLA 3VG5A 1PMPA 1QG5A 2PY1A 1FELA 4ALOA 2W2FA 1K24A 4EDEA 4JGLA 2A13A 4ORUA 2WUTA 2OY7A 4ZH6A 3C76X 2ACPX 1VPRA 2RN4A 1Y52X 4I3DA 1SRFA 1CBQA 1T8VA 1A57A 1NC9A 5B3MO 3RY1A 5B5GA 2VFBA 3EW1A 4YBPA 4ORWA 3CR6A 1RAVA 3FA8A 3UAQA 4GKCA 3RKGA 5HBSA 5FQ6E 4ZH9A 1AVEA 5HZQA 2M4LA 2BS6A 1LCZA 1U18A 5HZ8A 3U03A 3F8AA 2FKGA 3BRNA 1LIDA 1BRQA 4WBKA 2G8CO 1BRPA 1X8NA 1KXOA 3RZYA 5IO6A 2ACOA 2RTLA 4FQBB 3WYPA 3APVA 4GDZA 2OL6O 4WFVA 2I5VO 3N91A 4NV8A 4ZHGA 1CBSA 3NX1A 1BM5A 1HQPA 4IMNA 1RSTB 4KH8A 5HTDA 5LJKA 5IRAA 5BYPA 5EDCA 2KT4B 3O19A 2HZQA 1TOWA 2IZHB 4CPEA 1SY3A 3WJBA 4IAXA 2L68A 1HMTA 1GKAB 3KFGA 1SWHA 2QO6A 3DTQA 4ES7A 5IO5A 1MOYA 3VGWA 1SWCA 1GT5A 4O4SA 3SLOA 1GX9A 3B2HA 3WBGA 4D6AA 2OFAA 2QOSC 1OEEA 5FQ7E 1RXHA 5H9NA 2NNDA 4GU8A 3CKGA 4QYNA 1JYDA 4GH7A 1DZKA 1IFBA 1LCVA 1SWBA 2ANSA 4U9CA 4YVBA 2JU7A 1OEKA 4ORXA 4JHQA 1A3YA 1T0VA 2OFRX 4BCSA 1SLGB 4DNEA 3P6FA 2HYSA 1KT7A 4CDDA 4QNIA 1SRGA 2WSJA 2NP1A 1I04A 4MISA 3WVMA 4FBRA 5LJBA 4LKPA 4GGRA 3X00A 4CPIA 3U0DA 4EFGA 1MEPA 1GM6A 4ZCBA 4XMDA 4CK4A 2WWPA 3HK1A 2FRSA 1RBPA 2BSZA 5HCCC 2A5CA 2FT9A 2LFOA 2RTKA 1MX7A 2JOZA 1LNMA 1X71A 2FGSA 1SLFB 4HFOA 3I17A 1HN2A 1GXAA 4INNA 2UZ2A 2X34A 2Y32A 5H8TA 3ZW0B 4AZMA 1IW2A 4IBAA 4M6SA 1VYFA 1KQXA 2K62A 4IMOA 5CYBA 1B8EA 1JJJA 3AKMA 1SXXA 1N7YA 5D47A 4CPHA 1NQMA 4Z2OA 1VWBB 1G5WA 1E00A 1SWNA 1SXUA 1VWAB 4QGWA 4YMYA 1PBOA 3E3CA 5HWZA 1VWPB 1UYNX 1STRB 2RCQA 1YWDA 4Y59A 4A60A 4AW8A 2LBAA 5AEOA 1L6MA 3DSZA 1FE3A 2XSTA 5F6ZA 2RCTA 4ON1A 4YFPA 1KQWA 2OYBO 1EI5A 1OBPA 5C0NA 2DJGA
chains in the Genus database with same CATH topology
4I9RA 3Q6LA 3EM0A 4HPAA 3IA8A 4COTA 1DC9A 1LFOA 2X8SA 2G7BA 4AYHA 4ORRA 1SY0A 3WOVA 2FWVA 3S60A 2OVDA 1X8QA 2Q2MA 3TZSA 1KZWA 5D4AA 1G7NA 3MBTA 3PP6A 4ZHFA 5BVQA 5LKFA 3VG3A 1FENA 5HZ6A 2L9CA 3B2IA 3ZW2A 1CJ5A 1I4UA 3VPJE 5LJHA 3U9PC 2W2BA 1EPBA 1ACDA 1OEJA 2A2GA 4MIRA 5D8JA 4LZVA 3ZUOA 5K06A 2K23A 1S7DA 1X89A 2GTLM 2KD2A 4ORSA 2BT9A 4I6SA 2WQ9A 2AT5X 1CRBA 1ML7A 1GT1A 4M7MA 1EXSA 4MVKA 3AKNA 4XMCA 1ERXA 5FFHA 2AH7X 1QY0A 4YDBA 2RD7C 4YFQA 1ALBA 3VE1A 3OD9A 3HWDA 4NNTA 5HA0A 2A0AA 4MVEA 2GJ5A 3NQ9A 3D95A 1FEMA 3VG7A 4EXZA 1MX8A 3FW4A 3RSWA 1EW3A 3QKGA 1BEBA 4BVMA 4FBOA 4HPDA 4YFRA 1O1VA 4QQ1A 2POAA 1X8UA 1JJXA 4TLJA 4O3ZA 1TW4A 5LJCA 3WJGA 3HWEA 3NP1A 3NADA 4WHIA 3VG4A 5AQ6A 3O22A 3KFHA 3PQUA 2RQ0A 3BX8A 4ZR2A 2GTLO 2OVSA 4A8ZA 4Y0SA 3FLLA 1H91A 2F09A 2JU8A 2QO4A 4TKBA 3CMPA 2CZTA 4I9SA 1A18A 1ZNKA 2QMIA 5EEEA 1RLBE 1SA8A 1PEEA 3ELXA 2OFMX 3KFFA 2ASNX 4GZVA 2X45A 1YIVA 4EQAC 2JMBA 2R56A 3F6ZB 5AJCA 4ZGUA 1LIBA 3FYFA 4IB7A 3TGAA 3L4RA 1D3SA 3C78X 3CBCA 3D4RA 3D96A 2LB6A 3P02A 4GNWA 1DV9A 4ZGFA 1U0XA 1ZNDA 4U3QA 2WQAE 1LPJA 5BVSA 1P6PA 1AELA 5LJEA 4Y0QA 4D6BA 1JYJA 1AB0A 1YWAA 3FR5A 3CWKA 5LJGA 4XMGA 3STKA 3H3IA 3UEVA 2OVAA 3JSQA 4BQUA 5HZ9A 2KTDA 4OMXA 3ZW1B 1EIOA 1SXWA 3KQ0A 4N7DA 4DQ3A 4L1NA 3PH6A 4ODDA 3ZQ3A 4KIIA 3B2LA 3K3LA 3FA7A 2N93A 1HBPA 2YMSA 4FGIB 2ZAGA 1B0OA 5DG4A 1YUPA 3MX7A 1XCAA 1MDCA 4YCHA 2MWHA 3CBSA 5F7GA 4YH0A 5AJBA 3WJDA 2AT3X 1E02A 2W2AA 2G78A 5HCEC 5HA1A 4ZHCA 3NBXX 1G85A 1GKAA 4ALBA 1YWBA 4QAEA 5L8IA 1KT4A 5HCDC 3VG6A 2RA6A 1B4MA 4NYRA 2Q39A 4Y0RA 2AKQA 2CZUA 4TKJA 4OS8A 4QGXA 3S5XA 1KT3A 1KGLA 2NNEA 2MO5A 3IFBA 5HZ5A 3LV4A 3TGBA 4TQ2A 1LICA 4NNSA 4AZQA 1QY1A 4R0BA 3EBKA 2KTSA 1EPAA 2A3FX 2MJIA 3STNA 1FTPA 3TGCA 1GT3A 2AT0X 3NR3A 1TOUA 2MM3A 1LIEA 3WJEA 3T1DA 1U17A 2IFBA 3NQ3A 1TVQA 1EALA 4YGZA 4A1YA 1X8OA 4ID2A 4U8UM 3WXQA 1X8PA 5EEDA 4CSBA 2GTLN 4KT5A 3BY0A 2Q4NA 4ZHHA 1T68X 2ZAIA 3ZI8A 4O49A 4QZTA 5EDBA 4LKTA 1HBQA 4ARHA 2G79A 4O9SA 3WJFA 3KZAA 4IB9A 2HNXA 2JN3A 3PH5A 4O4UA 1Y9LA 3VE2A 3OJYC 3P24A 2DM5A 5JR8A 4GETA 2WEXA 1VYGA 1OBQA 4OS3A 3D97A 1DZMA 4PJ2A 4UU3A 1LKEA 3APWA 3S5VA 1HMRA 1TXLA 1JZUA 3ZUIA 4TKHA 1D2UA 3FEKA 4I3CA 5B29A 1ZNLA 2AT6X 3JS1A 4YKMA 1AVGI 3JQOA 1EUOA 1OPBA 1YWCA 1Y9TA 4AZNA 2LA7A 1O1UA 1FDQA 2CBRA 3FR2A 4HPBA 1BSOA 4LQZA 1ZNEA 4I3BA 4O3WA 1EQDA 3FA9A 3S26A 1DZPA 4GNYA 1KOIA 1OBUA 1YP6A 2L67A 4U8UO 2HLVA 3BU9A 3FENA 2OZQA 4KC8A 5L8OA 1ZRYA 4GK9A 3UEUA 2X8TA 3P6CA 2P8GA 1GGLA 2NNQA 4A1HA 1CBIA 1S44A 4XMEA 1DFVA 1KZXA 2X8FA 1IFCA 3ZZVA 2OVEA 3HOEA 1IIUA 4ORYA 3APXA 2O62A 3PECA 1NGLA 3HWFA 1IKEA 4UU2A 1BSYA 4MVIA 5EPQA 1BJ7A 3CQNA 2JW1A 3EBWA 3F9DA 3P6GA 4EEJA 2ALLX 5L8NA 1NP4A 4OMWA 5FAZA 1SY1A 1JBHA 3FEPA 2F73A 4BOEA 4I95A 3NQKA 4IAWA 5HTEA 1I05A 5F6BA 5FQ8E 2YG2A 2Q9SA 3FELA 4ZHDA 2CM9A 1R0UA 5LJDA 3ELZA 4PSQA 2FLJA 1OPAA 4TJZA 1DF3A 4AZPA 4FBVA 3VG2A 1S2PA 4CV7A 1UZ2X 2Z4IA 1Z24A 1BWYA 1QY2A 4IB8A 5H9KA 1LF7A 4HWMA 3WJCA 4XMFA 4QGVA 4YKOA 5F58A 4L3RA 4YBUA 2R73A 5BVTA 1ICNA 1EIIA 1NP1A 4ZJ0A 5D45A 3UEWA 3LHNA 1KT5A 3BSZE 1KT6A 4YCEA 3RWXA 5DPQA 1QABE 4TNNA 1PM1X 2L5PA 1E06A 1E5PA 2EU7X 4HPCA 4RUUA 3FIQA 3TF6A 2FR2A 3PQSA 4NYQA 2E4JA 4KC7A 1O8VA 2AT8X 1SMPI 5H9AA 2QO5A 1LIFA 2BS5A 3RBYA 3SAOA 3O2YA 3V8UA 3HWGA 2XKLA 4NLIA 2FTBA 3BS2A 4QZUA 1CBRA 3P6EA 4N7CA 3KFIA 4YDAA 3BU1A 1ICMA 3GAQA 1BSQA 5IO7A 4AZRA 3FW5A 2WR6A 3APUA 2CBSA 4Y0PA 5H9LA 4RUNA 4O4XA 4O3XB 5D48A 4QYPA 5EZ2A 4AZOA 4XMHA 3MVFA 3VU1A 3ZW1A 2MHDA 2A2UA 2BHVA 3FR4A 3UEXA 1IKJA 3P6DA 1MUPA 5CE4A 1I06A 1BLRA 5HAEA 1BBPA 3STMX 5FENA 4ZFXA 3GE2A 3I0AA 4KCAA 4O3YA 2R74A 1SY2A 3ZW0A 1G74A 4U8UN 3OE3A 4LZUA 3EMMA 1XKIA 2GTFX 1GX8A 3BDRA 3FMZA 5KHPA 2Q2PA 1ZNHA 3HTYA 2CM4A 1ERBA 2FS7A 2GC9A 3NX2A 2JU3A 3EYCA 3OBLA 1B56A 1N0SA 3NPOA 4NW4A 4GE1A 3C77X 4K19A 3BLGA 1AQBA 4DQ4A 2Z4HA 2FS6A 2QM9A 2HZRA 1GT4A 4NLJA 3FA6A 4O4OA 2LBVA 1QWDA 1MVGA 1UREA 2HMBA 3B2KA 3P6HA 5KIDA 4QRLA 4WFUA 5B27A 1JV4A 2X46A 3G7XA 3PPTA 2WEWA 4OS0A 1A2DA 3HOLA 3B2JA 4YGHA 4YGGA 3ZWEA 1ZNGA 2FR3A 4MVLA 1QFTA 2AMMX 5LKEA 1QQSA 4IB6A 1JIWI 2AL0X 3SOTA 1HMSA 4ML7B 2BLGA 2LKKA 3CQRA 3PEDA 5F1EA 1QFVA 1DZJA 4IABA 4GRJA 1SXYA 2KW1A 1YP7A 4NP1A 3BX7A 1ADLA 3VG5A 1PMPA 1QG5A 2PY1A 1FELA 4ALOA 2W2FA 4EDEA 4JGLA 2A13A 4ORUA 2WUTA 4ZH6A 3C76X 2ACPX 1VPRA 2RN4A 4I3DA 1CBQA 1T8VA 1A57A 4YBPA 4ORWA 3CR6A 3FA8A 3UAQA 4GKCA 3RKGA 5HBSA 5FQ6E 4ZH9A 5HZQA 2M4LA 2BS6A 5HZ8A 1U18A 3U03A 3F8AA 3BRNA 1LIDA 1BRQA 4WBKA 1BRPA 1X8NA 1KXOA 3RZYA 5IO6A 2ACOA 4FQBB 3APVA 4GDZA 4WFVA 3N91A 4ZHGA 1CBSA 3NX1A 1BM5A 1HQPA 4IMNA 4KH8A 5HTDA 5LJKA 5BYPA 5EDCA 2KT4B 3O19A 2HZQA 1TOWA 1SY3A 3WJBA 4IAXA 2L68A 1HMTA 1GKAB 3KFGA 5IO5A 2QO6A 3DTQA 4ES7A 1GT5A 4O4SA 1GX9A 3B2HA 3WBGA 4D6AA 2QOSC 1OEEA 5FQ7E 5H9NA 2NNDA 4GU8A 4QYNA 1JYDA 4GH7A 1DZKA 1IFBA 2ANSA 4U9CA 2JU7A 1OEKA 4ORXA 1A3YA 1T0VA 2OFRX 3P6FA 2HYSA 1KT7A 4QNIA 2WSJA 2NP1A 1I04A 4MISA 3WVMA 4FBRA 5LJBA 4LKPA 3U0DA 4EFGA 1GM6A 4ZCBA 4XMDA 4CK4A 2WWPA 3HK1A 2FRSA 1RBPA 5HCCC 2FT9A 2LFOA 1MX7A 2JOZA 1LNMA 1X71A 4HFOA 3I17A 1HN2A 1GXAA 4INNA 5H8TA 3ZW0B 5KICA 4AZMA 1IW2A 4IBAA 4M6SA 1VYFA 1KQXA 2K62A 4IMOA 5CYBA 1B8EA 1JJJA 3AKMA 1SXXA 5D47A 1G5WA 1E00A 4QGWA 1SXUA 4YMYA 1PBOA 3E3CA 5HWZA 2RCQA 1YWDA 4A60A 4AW8A 2LBAA 5AEOA 1L6MA 3DSZA 1FE3A 2XSTA 5F6ZA 2RCTA 4ON1A 4YFPA 1KQWA 1EI5A 1OBPA 5C0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I9R A;  3Q6L A;  3EM0 A;  4HPA A;  3IA8 A;  1DC9 A;  1LFO A;  2G7B A;  4AYH A;  4ORR A;  1SY0 A;  2FWV A;  2OVD A;  1X8Q A;  2Q2M A;  3TZS A;  1KZW A;  5D4A A;  1G7N A;  3MBT A;  3PP6 A;  4ZHF A;  5BVQ A;  5LKF A;  3VG3 A;  1FEN A;  5HZ6 A;  2L9C A;  3B2I A;  1CJ5 A;  1I4U A;  5LJH A;  3U9P C;  2W2B A;  1EPB A;  1ACD A;  1OEJ A;  2A2G A;  3ZUO A;  5D8J A;  4LZV A;  5K06 A;  2K23 A;  1S7D A;  1X89 A;  4ORS A;  2WQ9 A;  2AT5 X;  1CRB A;  1ML7 A;  1GT1 A;  4M7M A;  1EXS A;  4MVK A;  3AKN A;  4XMC A;  1ERX A;  5FFH A;  2AH7 X;  1QY0 A;  4YDB A;  2RD7 C;  4YFQ A;  1ALB A;  5HA0 A;  3HWD A;  4NNT A;  2A0A A;  2GJ5 A;  3NQ9 A;  3D95 A;  1FEM A;  3VG7 A;  4EXZ A;  1MX8 A;  3FW4 A;  3RSW A;  1EW3 A;  3QKG A;  1BEB A;  4BVM A;  4HPD A;  4YFR A;  1O1V A;  2POA A;  1X8U A;  1JJX A;  4TLJ A;  1TW4 A;  5LJC A;  3WJG A;  3HWE A;  3NP1 A;  3NAD A;  3VG4 A;  5AQ6 A;  3O22 A;  3KFH A;  2RQ0 A;  3BX8 A;  4ZR2 A;  4A8Z A;  4Y0S A;  3FLL A;  1H91 A;  2JU8 A;  2QO4 A;  4TKB A;  3CMP A;  2CZT A;  4I9S A;  1A18 A;  1ZNK A;  5EEE A;  1PEE A;  1RLB E;  1SA8 A;  3ELX A;  2OFM X;  3KFF A;  2ASN X;  2X45 A;  1YIV A;  2R56 A;  4ZGU A;  1LIB A;  4IB7 A;  3TGA A;  3L4R A;  1D3S A;  3C78 X;  3CBC A;  3D96 A;  2LB6 A;  4GNW A;  1DV9 A;  1U0X A;  1ZND A;  2WQA E;  1LPJ A;  5BVS A;  1P6P A;  1AEL A;  5LJE A;  4Y0Q A;  4D6B A;  1JYJ A;  1AB0 A;  1YWA A;  3FR5 A;  3CWK A;  5LJG A;  4XMG A;  3STK A;  3UEV A;  2OVA A;  3JSQ A;  4BQU A;  5HZ9 A;  2KTD A;  4OMX A;  1EIO A;  1SXW A;  3KQ0 A;  4N7D A;  4DQ3 A;  3PH6 A;  4ODD A;  3ZQ3 A;  4KII A;  3B2L A;  3K3L A;  3FA7 A;  2N93 A;  1HBP A;  1B0O A;  5DG4 A;  1YUP A;  1XCA A;  1MDC A;  4YCH A;  3CBS A;  5F7G A;  3WJD A;  4YH0 A;  2AT3 X;  1E02 A;  2W2A A;  2G78 A;  5HCE C;  5HA1 A;  4ZHC A;  1G85 A;  1GKA A;  4ALB A;  1YWB A;  4QAE A;  5L8I A;  1KT4 A;  5HCD C;  3VG6 A;  2RA6 A;  1B4M A;  4NYR A;  2Q39 A;  4Y0R A;  2AKQ A;  2CZU A;  4TKJ A;  4OS8 A;  4QGX A;  1KGL A;  1KT3 A;  2NNE A;  2MO5 A;  3IFB A;  5HZ5 A;  3TGB A;  4TQ2 A;  1LIC A;  4NNS A;  4AZQ A;  1QY1 A;  4R0B A;  3EBK A;  1EPA A;  2A3F X;  2MJI A;  3STN A;  1FTP A;  3TGC A;  1GT3 A;  2AT0 X;  3NR3 A;  1TOU A;  2MM3 A;  1LIE A;  3WJE A;  3T1D A;  1U17 A;  2IFB A;  3NQ3 A;  1TVQ A;  1EAL A;  4YGZ A;  4A1Y A;  1X8O A;  3WXQ A;  1X8P A;  5EED A;  3BY0 A;  2Q4N A;  4ZHH A;  1T68 X;  4QZT A;  5EDB A;  4LKT A;  1HBQ A;  4ARH A;  2G79 A;  4O9S A;  3WJF A;  3KZA A;  4IB9 A;  2HNX A;  2JN3 A;  3PH5 A;  3OJY C;  2DM5 A;  5JR8 A;  4GET A;  2WEX A;  1VYG A;  1OBQ A;  4OS3 A;  3D97 A;  1DZM A;  4UU3 A;  1LKE A;  3APW A;  1HMR A;  1TXL A;  1JZU A;  3ZUI A;  4TKH A;  1D2U A;  3FEK A;  4I3C A;  5B29 A;  1ZNL A;  2AT6 X;  3JS1 A;  4YKM A;  1AVG I;  1EUO A;  1OPB A;  1YWC A;  4AZN A;  1O1U A;  1FDQ A;  2CBR A;  3FR2 A;  4HPB A;  1BSO A;  1ZNE A;  4I3B A;  1EQD A;  3FA9 A;  3S26 A;  1DZP A;  4GNY A;  1KOI A;  1OBU A;  1YP6 A;  2L67 A;  2HLV A;  3BU9 A;  3FEN A;  2OZQ A;  5L8O A;  1ZRY A;  3UEU A;  3P6C A;  2P8G A;  1GGL A;  2NNQ A;  4A1H A;  1CBI A;  1S44 A;  4XME A;  1DFV A;  1KZX A;  1IFC A;  2OVE A;  1IIU A;  4ORY A;  3APX A;  2O62 A;  3PEC A;  1NGL A;  3HWF A;  1IKE A;  4UU2 A;  1BSY A;  4MVI A;  5EPQ A;  1BJ7 A;  3CQN A;  3EBW A;  3P6G A;  3F9D A;  4EEJ A;  2ALL X;  5L8N A;  1NP4 A;  4OMW A;  5FAZ A;  1SY1 A;  1JBH A;  3FEP A;  2F73 A;  4BOE A;  4IAW A;  5HTE A;  1I05 A;  5F6B A;  2YG2 A;  2Q9S A;  3FEL A;  4ZHD A;  2CM9 A;  1R0U A;  5LJD A;  3ELZ A;  4PSQ A;  2FLJ A;  1OPA A;  4TJZ A;  1DF3 A;  4AZP A;  3VG2 A;  1S2P A;  1UZ2 X;  1Z24 A;  1BWY A;  1QY2 A;  4IB8 A;  5H9K A;  1LF7 A;  3WJC A;  4XMF A;  4QGV A;  4YKO A;  5F58 A;  4YBU A;  2R73 A;  5BVT A;  1ICN A;  1EII A;  1NP1 A;  4ZJ0 A;  5D45 A;  3UEW A;  1KT5 A;  3BSZ E;  1KT6 A;  4YCE A;  5DPQ A;  1QAB E;  4TNN A;  1PM1 X;  2L5P A;  1E06 A;  1E5P A;  2EU7 X;  4HPC A;  4RUU A;  3FIQ A;  3TF6 A;  2FR2 A;  4NYQ A;  2E4J A;  1O8V A;  2AT8 X;  5H9A A;  2QO5 A;  1LIF A;  3SAO A;  3O2Y A;  3HWG A;  2XKL A;  4NLI A;  2FTB A;  3BS2 A;  4QZU A;  1CBR A;  3P6E A;  4N7C A;  3KFI A;  4YDA A;  3BU1 A;  1ICM A;  3GAQ A;  1BSQ A;  5IO7 A;  4AZR A;  3FW5 A;  2WR6 A;  3APU A;  2CBS A;  4Y0P A;  5H9L A;  4RUN A;  5EZ2 A;  5D48 A;  4QYP A;  4AZO A;  4XMH A;  3MVF A;  2A2U A;  3FR4 A;  3UEX A;  1IKJ A;  3P6D A;  1MUP A;  5CE4 A;  1I06 A;  1BLR A;  5HAE A;  1BBP A;  3STM X;  5FEN A;  4ZFX A;  3I0A A;  2R74 A;  1SY2 A;  1G74 A;  4LZU A;  3EMM A;  1XKI A;  2GTF X;  1GX8 A;  3BDR A;  3FMZ A;  5KHP A;  2Q2P A;  1ZNH A;  2CM4 A;  1ERB A;  2FS7 A;  2GC9 A;  3NX2 A;  2JU3 A;  3EYC A;  1B56 A;  1N0S A;  3NPO A;  4GE1 A;  3C77 X;  4K19 A;  3BLG A;  1AQB A;  4DQ4 A;  2FS6 A;  2QM9 A;  2HZR A;  1GT4 A;  4NLJ A;  3FA6 A;  2LBV A;  1QWD A;  1MVG A;  1URE A;  2HMB A;  3B2K A;  3P6H A;  5KID A;  4WFU A;  5B27 A;  1JV4 A;  2X46 A;  3G7X A;  3PPT A;  2WEW A;  4OS0 A;  1A2D A;  3B2J A;  4YGH A;  4YGG A;  1ZNG A;  2FR3 A;  4MVL A;  1QFT A;  2AMM X;  5LKE A;  1QQS A;  4IB6 A;  2AL0 X;  1HMS A;  2BLG A;  2LKK A;  3CQR A;  3PED A;  5F1E A;  1QFV A;  1DZJ A;  4GRJ A;  1SXY A;  1YP7 A;  4NP1 A;  3BX7 A;  1ADL A;  3VG5 A;  1PMP A;  1QG5 A;  2PY1 A;  1FEL A;  4ALO A;  2W2F A;  4EDE A;  2A13 A;  4ORU A;  2WUT A;  4ZH6 A;  3C76 X;  2ACP X;  1VPR A;  4I3D A;  1CBQ A;  1T8V A;  1A57 A;  4YBP A;  4ORW A;  3CR6 A;  3FA8 A;  4GKC A;  5HBS A;  4ZH9 A;  5HZQ A;  5HZ8 A;  1U18 A;  3U03 A;  3F8A A;  3BRN A;  1LID A;  1BRQ A;  4WBK A;  1BRP A;  1X8N A;  1KXO A;  3RZY A;  5IO6 A;  2ACO A;  3APV A;  4WFV A;  4ZHG A;  1CBS A;  3NX1 A;  1BM5 A;  1HQP A;  4IMN A;  5HTD A;  5LJK A;  5EDC A;  2KT4 B;  3O19 A;  2HZQ A;  1TOW A;  1SY3 A;  3WJB A;  4IAX A;  2L68 A;  1HMT A;  1GKA B;  3KFG A;  5IO5 A;  2QO6 A;  3DTQ A;  4ES7 A;  1GT5 A;  1GX9 A;  3B2H A;  3WBG A;  4D6A A;  2QOS C;  1OEE A;  5H9N A;  2NND A;  4QYN A;  1JYD A;  4GH7 A;  1DZK A;  1IFB A;  2ANS A;  2JU7 A;  1OEK A;  4ORX A;  1A3Y A;  1T0V A;  2OFR X;  3P6F A;  2HYS A;  1KT7 A;  2WSJ A;  2NP1 A;  1I04 A;  3WVM A;  5LJB A;  4LKP A;  3U0D A;  4EFG A;  1GM6 A;  4ZCB A;  4XMD A;  4CK4 A;  2WWP A;  3HK1 A;  2FRS A;  1RBP A;  5HCC C;  2FT9 A;  2LFO A;  1MX7 A;  2JOZ A;  1LNM A;  1X71 A;  4HFO A;  3I17 A;  1HN2 A;  1GXA A;  5H8T A;  5KIC A;  4AZM A;  1IW2 A;  4IBA A;  4M6S A;  1VYF A;  1KQX A;  2K62 A;  4IMO A;  1B8E A;  1JJJ A;  3AKM A;  1SXX A;  5D47 A;  1G5W A;  1E00 A;  4QGW A;  1SXU A;  4YMY A;  1PBO A;  5HWZ A;  2RCQ A;  1YWD A;  4A60 A;  4AW8 A;  2LBA A;  1L6M A;  3DSZ A;  1FE3 A;  2XST A;  5F6Z A;  2RCT A;  4YFP A;  1KQW A;  1OBP A;  5C0N A; 
#chains in the Genus database with same CATH topology
 3FID A;  1VWC B;  4I9R A;  3Q6L A;  3VHM A;  5IRW A;  3EM0 A;  1W5R A;  4HPA A;  3IA8 A;  4COT A;  1DC9 A;  1LFO A;  2X32 A;  2IZB A;  2G7B A;  2X8S A;  4ORR A;  4AYH A;  1SY0 A;  3WOV A;  2FWV A;  3S60 A;  3PDF A;  2OVD A;  5L3Y A;  1X8Q A;  1KL5 A;  5F2B A;  2Q2M A;  3TZS A;  1KZW A;  2RTA A;  1I9H A;  5D4A A;  1G7N A;  3MBT A;  3PP6 A;  4BX5 B;  4BJ8 A;  1VWE B;  4ZHF A;  5BVQ A;  5LKF A;  3VG3 A;  1FEN A;  5CSE A;  5HZ6 A;  2L9C A;  2X56 A;  3B2I A;  4Y5D A;  1SLD B;  3ZW2 A;  1CJ5 A;  1I4U A;  3VPJ E;  5LJH A;  3U9P C;  2W2B A;  1EPB A;  4BX6 A;  4JNJ A;  1ACD A;  1OEJ A;  1N9M A;  2A2G A;  4MIR A;  5D8J A;  4LZV A;  3ZUO A;  5K06 A;  2K23 A;  1S7D A;  1X89 A;  3RDX A;  2GTL M;  2KD2 A;  4ORS A;  2BT9 A;  4I6S A;  2WQ9 A;  2AT5 X;  1CRB A;  1ML7 A;  1SLE B;  1GT1 A;  4M7M A;  1WUB A;  1EXS A;  2I5Z O;  3RDQ A;  4MVK A;  3AKN A;  4CDF A;  3RDS A;  1UYO X;  4XMC A;  4BX7 A;  1ERX A;  1LEL A;  5FFH A;  1JMZ A;  1OSP O;  1QY0 A;  1VWK B;  4YDB A;  2AH7 X;  2RTM A;  2RD7 C;  3RDU A;  4YFQ A;  4DCB A;  3T2W A;  1ALB A;  2AF5 A;  3VE1 A;  3OD9 A;  3HWD A;  4NNT A;  5HA0 A;  4Z28 A;  2A0A A;  2IZJ A;  4MVE A;  2FHN X;  3KVN A;  5KIC A;  2GJ5 A;  3NQ9 A;  3D95 A;  1FEM A;  3VG7 A;  1STP A;  1MX8 A;  3SLJ A;  3FW4 A;  4OKA A;  4EXZ A;  1SWE A;  3RSW A;  1EW3 A;  3QKG A;  1BEB A;  4BVM A;  4FBO A;  4HPD A;  4YFR A;  1O1V A;  2HKD A;  2POA A;  4QQ1 A;  1X8U A;  5CHK A;  2IZD B;  1JJX A;  1SWP A;  4TLJ A;  4O3Z A;  1SWQ A;  1TW4 A;  5LJC A;  3WJG A;  3HWE A;  3NP1 A;  3NAD A;  4WHI A;  1DF8 A;  3VG4 A;  5AQ6 A;  3O22 A;  3KFH A;  3PQU A;  2RQ0 A;  2A5B A;  3BX8 A;  4ZR2 A;  2GTL O;  2OVS A;  4A8Z A;  4Y0S A;  1VWQ B;  3FLL A;  4C5P A;  1H91 A;  2F09 A;  3MM0 A;  4Z2V A;  2JU8 A;  2QO4 A;  4TKB A;  4MEE A;  3CMP A;  2CZT A;  4I9S A;  5B11 O;  1A18 A;  1ZNK A;  2QMI A;  2RTJ A;  1RLB E;  1SA8 A;  5EEE A;  2RTR B;  2OFM X;  3ELX A;  3KFF A;  1PEE A;  2ASN X;  4GZV A;  3RY2 A;  5B2A O;  2X45 A;  1YIV A;  4EQA C;  2JMB A;  2R56 A;  3F6Z B;  5AJC A;  4ZGU A;  1LIB A;  3FYF A;  4IB7 A;  3TGA A;  3L4R A;  1D3S A;  3C78 X;  3CBC A;  3D4R A;  1VWI B;  3D96 A;  4Z27 A;  2OY8 A;  4TNN A;  2LB6 A;  3P02 A;  4GNW A;  1DV9 A;  4ZGF A;  4Z6J A;  1NBX A;  1U0X A;  1ZND A;  1N9Y A;  2WQA E;  1LPJ A;  4I60 A;  1P6P A;  4U3Q A;  5BVS A;  1AEL A;  2FKJ A;  3TF6 A;  5LJE A;  4Y0Q A;  4D6B A;  1JYJ A;  1AB0 A;  1YWA A;  3FR5 A;  2IZK A;  3CWK A;  5LJG A;  1HQQ A;  1JMX A;  4XMG A;  3STK A;  3H3I A;  4CPH B;  3UEV A;  2OVA A;  2IZF B;  1VWH B;  3JSQ A;  4BQU A;  1SWF A;  2KTD A;  4OMX A;  3ZW1 B;  5HZ9 A;  1SXW A;  1WBI A;  1EIO A;  3SZJ A;  3KQ0 A;  4N7D A;  3EW2 A;  1SRI A;  4DQ3 A;  4L1N A;  4CDE A;  2QCB A;  3PH6 A;  4RUU A;  4ODD A;  3ZQ3 A;  4KII A;  3B2L A;  3K3L A;  3FA7 A;  2N93 A;  1HBP A;  2YMS A;  4FGI B;  2ZAG A;  1B0O A;  5DG4 A;  3EC5 A;  1FJ1 E;  1YUP A;  2RTD B;  3MX7 A;  1XCA A;  1Y55 X;  3FDC A;  1MDC A;  4YCH A;  2MWH A;  3CBS A;  5F7G A;  4YH0 A;  4IRW A;  5AJB A;  3WJD A;  2AT3 X;  1E02 A;  2W2A A;  2G78 A;  2DJF A;  3AEH A;  5HA1 A;  5HCE C;  4ZHC A;  2QOM A;  3NBX X;  4BBO A;  4GJV A;  2BC3 A;  1G85 A;  1GKA A;  4ALB A;  1YWB A;  4QAE A;  5L8I A;  1KT4 A;  5HCD C;  1IJ8 A;  5K68 A;  2IZL B;  2RA6 A;  3VG6 A;  1VWD B;  4NYR A;  1B4M A;  2Q39 A;  2RTB B;  4GUZ A;  4Y0R A;  2AKQ A;  2OL7 A;  1SWA A;  2CZU A;  2G5L A;  2IZG B;  4TKJ A;  2OF9 A;  4OS8 A;  4QGX A;  3S5X A;  1KT3 A;  1KGL A;  3HPE A;  2NNE A;  2MO5 A;  2X4M A;  3IFB A;  3WZQ A;  3LV4 A;  5HZ5 A;  3TGB A;  4OEL A;  1SWT A;  4TQ2 A;  1MM9 A;  1LIC A;  4NNS A;  4AZQ A;  1QY1 A;  1JJU A;  4R0B A;  3EBK A;  2KTS A;  1I78 A;  1SWR A;  3RDM A;  1EPA A;  2A3F X;  2MJI A;  3SZI A;  1K3B A;  3STN A;  1FTP A;  2MF6 A;  4BX7 B;  3TGC A;  1GT3 A;  2AT0 X;  3NR3 A;  1TOU A;  2MM3 A;  1LIE A;  3WJE A;  3T1D A;  4GD9 A;  1U17 A;  2IFB A;  3NQ3 A;  3RE6 A;  1SRJ A;  1TVQ A;  2A8G A;  1EAL A;  4YGZ A;  4A1Y A;  1X8O A;  2RTF B;  4ID2 A;  2OY5 O;  1SWO A;  4U8U M;  3WXQ A;  1X8P A;  5EED A;  3VHH A;  2FHL A;  4CSB A;  2GTL N;  4KT5 A;  3BY0 A;  3Q34 A;  2Q4N A;  4ZHH A;  1T68 X;  2JGS A;  2ZAI A;  3ZI8 A;  1VWO B;  4O49 A;  4QZT A;  5EDB A;  4LKT A;  1HBQ A;  4ARH A;  2G79 A;  4O9S A;  3WJF A;  3KZA A;  4IB9 A;  2HNX A;  2JN3 A;  3PH5 A;  4O4U A;  1RSU B;  1Y9L A;  5IRU A;  4U46 A;  3VE2 A;  3OJY C;  4NV7 A;  3P24 A;  2DM5 A;  3VHI A;  5JD2 A;  5JR8 A;  4GET A;  2WEX A;  1VYG A;  1OBQ A;  4OS3 A;  3AUM O;  1NQN A;  1RXK A;  1DZM A;  3D97 A;  4PJ2 A;  4UU3 A;  1LKE A;  3APW A;  3S5V A;  1HMR A;  1TXL A;  2OFB A;  3ZUI A;  4TKH A;  1D2U A;  1JZU A;  3FEK A;  4I3C A;  5B29 A;  1HXL A;  1PBY A;  1ZNL A;  2AT6 X;  3JS1 A;  4YKM A;  1AVG I;  3JQO A;  1EUO A;  1OPB A;  1YWC A;  1Y9T A;  4AZN A;  2LA7 A;  1O1U A;  1FDQ A;  2CBR A;  1SWS A;  1N43 A;  3FR2 A;  4HPB A;  1BSO A;  2C1S A;  2WPU A;  4LQZ A;  1ZNE A;  4I3B A;  4O3W A;  1EQD A;  3T6F A;  3FA9 A;  3S26 A;  1DZP A;  1SRH A;  1KOI A;  1OBU A;  4GNY A;  1N4J A;  1YP6 A;  2L67 A;  4U8U O;  2RTQ B;  2HLV A;  2RTC B;  1HY2 A;  2Y3E A;  2OZQ A;  3BU9 A;  3FEN A;  4KC8 A;  1ZRY A;  4GK9 A;  3UEU A;  5L8O A;  2X8T A;  3P6C A;  1GGL A;  2P8G A;  2NNQ A;  4A1H A;  1CBI A;  1S44 A;  4XME A;  1DFV A;  1KZX A;  1JQP A;  2X8F A;  5B10 O;  1IFC A;  1VWN B;  2OVE A;  3ZZV A;  3HOE A;  1IIU A;  4ORY A;  3APX A;  2O62 A;  3PEC A;  1NGL A;  3HWF A;  1IKE A;  4UU2 A;  1BSY A;  4MVI A;  5EPQ A;  3WZN A;  1BJ7 A;  3CQN A;  2JW1 A;  3EBW A;  3F9D A;  3P6G A;  4EEJ A;  2ALL X;  3CKF A;  5L8N A;  1NP4 A;  4OMW A;  5FAZ A;  1SY1 A;  5B5F A;  1JBH A;  4GJS A;  3FEP A;  4OEM A;  2F73 A;  4BOE A;  4GGZ A;  2RTG B;  1KL4 A;  4I95 A;  3NQK A;  4IAW A;  3WZO A;  2VDF A;  5HTE A;  1I05 A;  5F6B A;  5FQ8 E;  2Y3F A;  2Q9S A;  2YG2 A;  2RTH B;  3PK2 A;  4EKV A;  3FEL A;  4ZHD A;  2CM9 A;  1R0U A;  5LJD A;  3ELZ A;  1RXJ A;  4PSQ A;  2FLJ A;  1OPA A;  4GDA A;  4TJZ A;  2X55 A;  1DF3 A;  1KL3 A;  4AZP A;  1GX3 A;  4FBV A;  5IXG A;  3VG2 A;  2RTO B;  1S2P A;  4CV7 A;  1UZ2 X;  3T2X A;  2Z4I A;  1Z24 A;  1BWY A;  1QY2 A;  4IB8 A;  5H9K A;  1LF7 A;  2RTN B;  4HWM A;  4XMF A;  3WJC A;  4QGV A;  4YKO A;  5F58 A;  3SLT A;  4L3R A;  4YBU A;  2R73 A;  3WYQ A;  1ICN A;  5BVT A;  1NP1 A;  1EII A;  2OL8 O;  3RE5 A;  4ZJ0 A;  2C4I A;  1HXZ A;  1LDO A;  2VFC A;  5D45 A;  3UEW A;  3LHN A;  1KT5 A;  1LDQ A;  3BSZ E;  3WZP A;  1KT6 A;  4YCE A;  3RWX A;  3MG5 A;  5DPQ A;  1QAB E;  2RTI B;  1PM1 X;  1SRE A;  1E06 A;  1E5P A;  1SWK A;  2CAM A;  2EU7 X;  2L5P A;  1VWG B;  3FIQ A;  4HPC A;  2FR2 A;  3PQS A;  3T6L A;  4NYQ A;  2E4J A;  4KC7 A;  1O8V A;  1VWM B;  4GGT A;  2AT8 X;  1SMP I;  5H9A A;  2QO5 A;  1LIF A;  2BS5 A;  2PI3 O;  3RBY A;  3SAO A;  3O2Y A;  3V8U A;  3HWG A;  4JO6 A;  4BX6 B;  2XKL A;  4NLI A;  4BGF A;  1Y53 X;  2FTB A;  3BS2 A;  2GH7 A;  4QZU A;  1CBR A;  1VWL B;  3P6E A;  3KFI A;  4N7C A;  4YDA A;  3BU1 A;  1ICM A;  2IZE B;  2RTP B;  1SWL A;  3GAQ A;  1BSQ A;  5IO7 A;  4AZR A;  3FW5 A;  2WR6 A;  3APU A;  2CBS A;  4Y0P A;  5H9L A;  4RUN A;  4O4X A;  1W4T A;  4O3X B;  5D48 A;  4QYP A;  3LTW A;  5EZ2 A;  1NDJ A;  4XMH A;  3RDO A;  1AVD A;  4AZO A;  5K67 A;  3MVF A;  3D9W A;  3VU1 A;  2MHD A;  3ZW1 A;  2A2U A;  2BHV A;  3FR4 A;  3UEX A;  1IKJ A;  3P6D A;  1MUP A;  5CE4 A;  1I06 A;  1BLR A;  5HAE A;  4B55 A;  1BBP A;  2IZA A;  1SWU A;  3STM X;  5FEN A;  3QQ2 A;  4ZFX A;  3GE2 A;  1VWJ B;  3I0A A;  4KCA A;  2OY1 O;  4O3Y A;  2R74 A;  1SY2 A;  3ZW0 A;  1SWD A;  1G74 A;  1PTS A;  1STS B;  4U8U N;  3OE3 A;  4LZU A;  3EMM A;  1XKI A;  2GTF X;  1GX8 A;  3BDR A;  3FMZ A;  5KHP A;  2Q2P A;  1ZNH A;  3HTY A;  2OF8 A;  2CM4 A;  1ERB A;  2FS7 A;  2C1Q A;  2GC9 A;  3NX2 A;  2JU3 A;  2AVI A;  3EYC A;  3OBL A;  1VWR B;  4CDC A;  1B56 A;  1N0S A;  3NPO A;  4NW4 A;  2ZSC A;  4GE1 A;  3C77 X;  3SZH A;  4K19 A;  1LUQ A;  1VWF B;  3BLG A;  1AQB A;  4DQ4 A;  2Z4H A;  2FS6 A;  2RTE B;  2QM9 A;  1KFF A;  1VYO A;  1GT4 A;  2HZR A;  3FA6 A;  4NLJ A;  4O4O A;  2LBV A;  4CPF A;  1QWD A;  1E2T A;  1MVG A;  1URE A;  2HMB A;  3B2K A;  3P6H A;  4QRL A;  4WFU A;  5KID A;  5B27 A;  4Z2P A;  1LCW A;  1JV4 A;  2X46 A;  3G7X A;  3PPT A;  1W6F A;  2WEW A;  4OS0 A;  1A2D A;  3HOL A;  3B2J A;  4YGH A;  4YGG A;  1MK5 A;  3ZWE A;  1SWG A;  1SWJ A;  1ZNG A;  2UYW A;  2FR3 A;  4MVL A;  1QFT A;  2AMM X;  5LKE A;  1QQS A;  4IB6 A;  4BX5 A;  1JIW I;  2AL0 X;  2IZI A;  3SOT A;  1HMS A;  4ML7 B;  2BLG A;  1Y0G A;  2LKK A;  3CQR A;  2IZC B;  3PED A;  2F01 A;  5F1E A;  1QFV A;  1DZJ A;  4IAB A;  4GRJ A;  1SXY A;  2KW1 A;  1YP7 A;  4NP1 A;  3BX7 A;  1ADL A;  3VG5 A;  1PMP A;  1QG5 A;  2PY1 A;  1FEL A;  4ALO A;  2W2F A;  1K24 A;  4EDE A;  4JGL A;  2A13 A;  4ORU A;  2WUT A;  2OY7 A;  4ZH6 A;  3C76 X;  2ACP X;  1VPR A;  2RN4 A;  1Y52 X;  4I3D A;  1SRF A;  1CBQ A;  1T8V A;  1A57 A;  1NC9 A;  5B3M O;  3RY1 A;  5B5G A;  2VFB A;  3EW1 A;  4YBP A;  4ORW A;  3CR6 A;  1RAV A;  3FA8 A;  3UAQ A;  4GKC A;  3RKG A;  5HBS A;  5FQ6 E;  4ZH9 A;  1AVE A;  5HZQ A;  2M4L A;  2BS6 A;  1LCZ A;  1U18 A;  5HZ8 A;  3U03 A;  3F8A A;  2FKG A;  3BRN A;  1LID A;  1BRQ A;  4WBK A;  2G8C O;  1BRP A;  1X8N A;  1KXO A;  3RZY A;  5IO6 A;  2ACO A;  2RTL A;  4FQB B;  3WYP A;  3APV A;  4GDZ A;  2OL6 O;  4WFV A;  2I5V O;  3N91 A;  4NV8 A;  4ZHG A;  1CBS A;  3NX1 A;  1BM5 A;  1HQP A;  4IMN A;  1RST B;  4KH8 A;  5HTD A;  5LJK A;  5IRA A;  5BYP A;  5EDC A;  2KT4 B;  3O19 A;  2HZQ A;  1TOW A;  2IZH B;  4CPE A;  1SY3 A;  3WJB A;  4IAX A;  2L68 A;  1HMT A;  1GKA B;  3KFG A;  1SWH A;  2QO6 A;  3DTQ A;  4ES7 A;  5IO5 A;  1MOY A;  3VGW A;  1SWC A;  1GT5 A;  4O4S A;  3SLO A;  1GX9 A;  3B2H A;  3WBG A;  4D6A A;  2OFA A;  2QOS C;  1OEE A;  5FQ7 E;  1RXH A;  5H9N A;  2NND A;  4GU8 A;  3CKG A;  4QYN A;  1JYD A;  4GH7 A;  1DZK A;  1IFB A;  1LCV A;  1SWB A;  2ANS A;  4U9C A;  4YVB A;  2JU7 A;  1OEK A;  4ORX A;  4JHQ A;  1A3Y A;  1T0V A;  2OFR X;  4BCS A;  1SLG B;  4DNE A;  3P6F A;  2HYS A;  1KT7 A;  4CDD A;  4QNI A;  1SRG A;  2WSJ A;  2NP1 A;  1I04 A;  4MIS A;  3WVM A;  4FBR A;  5LJB A;  4LKP A;  4GGR A;  3X00 A;  4CPI A;  3U0D A;  4EFG A;  1MEP A;  1GM6 A;  4ZCB A;  4XMD A;  4CK4 A;  2WWP A;  3HK1 A;  2FRS A;  1RBP A;  2BSZ A;  5HCC C;  2A5C A;  2FT9 A;  2LFO A;  2RTK A;  1MX7 A;  2JOZ A;  1LNM A;  1X71 A;  2FGS A;  1SLF B;  4HFO A;  3I17 A;  1HN2 A;  1GXA A;  4INN A;  2UZ2 A;  2X34 A;  2Y32 A;  5H8T A;  3ZW0 B;  4AZM A;  1IW2 A;  4IBA A;  4M6S A;  1VYF A;  1KQX A;  2K62 A;  4IMO A;  5CYB A;  1B8E A;  1JJJ A;  3AKM A;  1SXX A;  1N7Y A;  5D47 A;  4CPH A;  1NQM A;  4Z2O A;  1VWB B;  1G5W A;  1E00 A;  1SWN A;  1SXU A;  1VWA B;  4QGW A;  4YMY A;  1PBO A;  3E3C A;  5HWZ A;  1VWP B;  1UYN X;  1STR B;  2RCQ A;  1YWD A;  4Y59 A;  4A60 A;  4AW8 A;  2LBA A;  5AEO A;  1L6M A;  3DSZ A;  1FE3 A;  2XST A;  5F6Z A;  2RCT A;  4ON1 A;  4YFP A;  1KQW A;  2OYB O;  1EI5 A;  1OBP A;  5C0N A;  2DJG A; 
#chains in the Genus database with same CATH homology
 4I9R A;  3Q6L A;  3EM0 A;  4HPA A;  3IA8 A;  4COT A;  1DC9 A;  1LFO A;  2X8S A;  2G7B A;  4AYH A;  4ORR A;  1SY0 A;  3WOV A;  2FWV A;  3S60 A;  2OVD A;  1X8Q A;  2Q2M A;  3TZS A;  1KZW A;  5D4A A;  1G7N A;  3MBT A;  3PP6 A;  4ZHF A;  5BVQ A;  5LKF A;  3VG3 A;  1FEN A;  5HZ6 A;  2L9C A;  3B2I A;  3ZW2 A;  1CJ5 A;  1I4U A;  3VPJ E;  5LJH A;  3U9P C;  2W2B A;  1EPB A;  1ACD A;  1OEJ A;  2A2G A;  4MIR A;  5D8J A;  4LZV A;  3ZUO A;  5K06 A;  2K23 A;  1S7D A;  1X89 A;  2GTL M;  2KD2 A;  4ORS A;  2BT9 A;  4I6S A;  2WQ9 A;  2AT5 X;  1CRB A;  1ML7 A;  1GT1 A;  4M7M A;  1EXS A;  4MVK A;  3AKN A;  4XMC A;  1ERX A;  5FFH A;  2AH7 X;  1QY0 A;  4YDB A;  2RD7 C;  4YFQ A;  1ALB A;  3VE1 A;  3OD9 A;  3HWD A;  4NNT A;  5HA0 A;  2A0A A;  4MVE A;  2GJ5 A;  3NQ9 A;  3D95 A;  1FEM A;  3VG7 A;  4EXZ A;  1MX8 A;  3FW4 A;  3RSW A;  1EW3 A;  3QKG A;  1BEB A;  4BVM A;  4FBO A;  4HPD A;  4YFR A;  1O1V A;  4QQ1 A;  2POA A;  1X8U A;  1JJX A;  4TLJ A;  4O3Z A;  1TW4 A;  5LJC A;  3WJG A;  3HWE A;  3NP1 A;  3NAD A;  4WHI A;  3VG4 A;  5AQ6 A;  3O22 A;  3KFH A;  3PQU A;  2RQ0 A;  3BX8 A;  4ZR2 A;  2GTL O;  2OVS A;  4A8Z A;  4Y0S A;  3FLL A;  1H91 A;  2F09 A;  2JU8 A;  2QO4 A;  4TKB A;  3CMP A;  2CZT A;  4I9S A;  1A18 A;  1ZNK A;  2QMI A;  5EEE A;  1RLB E;  1SA8 A;  1PEE A;  3ELX A;  2OFM X;  3KFF A;  2ASN X;  4GZV A;  2X45 A;  1YIV A;  4EQA C;  2JMB A;  2R56 A;  3F6Z B;  5AJC A;  4ZGU A;  1LIB A;  3FYF A;  4IB7 A;  3TGA A;  3L4R A;  1D3S A;  3C78 X;  3CBC A;  3D4R A;  3D96 A;  2LB6 A;  3P02 A;  4GNW A;  1DV9 A;  4ZGF A;  1U0X A;  1ZND A;  4U3Q A;  2WQA E;  1LPJ A;  5BVS A;  1P6P A;  1AEL A;  5LJE A;  4Y0Q A;  4D6B A;  1JYJ A;  1AB0 A;  1YWA A;  3FR5 A;  3CWK A;  5LJG A;  4XMG A;  3STK A;  3H3I A;  3UEV A;  2OVA A;  3JSQ A;  4BQU A;  5HZ9 A;  2KTD A;  4OMX A;  3ZW1 B;  1EIO A;  1SXW A;  3KQ0 A;  4N7D A;  4DQ3 A;  4L1N A;  3PH6 A;  4ODD A;  3ZQ3 A;  4KII A;  3B2L A;  3K3L A;  3FA7 A;  2N93 A;  1HBP A;  2YMS A;  4FGI B;  2ZAG A;  1B0O A;  5DG4 A;  1YUP A;  3MX7 A;  1XCA A;  1MDC A;  4YCH A;  2MWH A;  3CBS A;  5F7G A;  4YH0 A;  5AJB A;  3WJD A;  2AT3 X;  1E02 A;  2W2A A;  2G78 A;  5HCE C;  5HA1 A;  4ZHC A;  3NBX X;  1G85 A;  1GKA A;  4ALB A;  1YWB A;  4QAE A;  5L8I A;  1KT4 A;  5HCD C;  3VG6 A;  2RA6 A;  1B4M A;  4NYR A;  2Q39 A;  4Y0R A;  2AKQ A;  2CZU A;  4TKJ A;  4OS8 A;  4QGX A;  3S5X A;  1KT3 A;  1KGL A;  2NNE A;  2MO5 A;  3IFB A;  5HZ5 A;  3LV4 A;  3TGB A;  4TQ2 A;  1LIC A;  4NNS A;  4AZQ A;  1QY1 A;  4R0B A;  3EBK A;  2KTS A;  1EPA A;  2A3F X;  2MJI A;  3STN A;  1FTP A;  3TGC A;  1GT3 A;  2AT0 X;  3NR3 A;  1TOU A;  2MM3 A;  1LIE A;  3WJE A;  3T1D A;  1U17 A;  2IFB A;  3NQ3 A;  1TVQ A;  1EAL A;  4YGZ A;  4A1Y A;  1X8O A;  4ID2 A;  4U8U M;  3WXQ A;  1X8P A;  5EED A;  4CSB A;  2GTL N;  4KT5 A;  3BY0 A;  2Q4N A;  4ZHH A;  1T68 X;  2ZAI A;  3ZI8 A;  4O49 A;  4QZT A;  5EDB A;  4LKT A;  1HBQ A;  4ARH A;  2G79 A;  4O9S A;  3WJF A;  3KZA A;  4IB9 A;  2HNX A;  2JN3 A;  3PH5 A;  4O4U A;  1Y9L A;  3VE2 A;  3OJY C;  3P24 A;  2DM5 A;  5JR8 A;  4GET A;  2WEX A;  1VYG A;  1OBQ A;  4OS3 A;  3D97 A;  1DZM A;  4PJ2 A;  4UU3 A;  1LKE A;  3APW A;  3S5V A;  1HMR A;  1TXL A;  1JZU A;  3ZUI A;  4TKH A;  1D2U A;  3FEK A;  4I3C A;  5B29 A;  1ZNL A;  2AT6 X;  3JS1 A;  4YKM A;  1AVG I;  3JQO A;  1EUO A;  1OPB A;  1YWC A;  1Y9T A;  4AZN A;  2LA7 A;  1O1U A;  1FDQ A;  2CBR A;  3FR2 A;  4HPB A;  1BSO A;  4LQZ A;  1ZNE A;  4I3B A;  4O3W A;  1EQD A;  3FA9 A;  3S26 A;  1DZP A;  4GNY A;  1KOI A;  1OBU A;  1YP6 A;  2L67 A;  4U8U O;  2HLV A;  3BU9 A;  3FEN A;  2OZQ A;  4KC8 A;  5L8O A;  1ZRY A;  4GK9 A;  3UEU A;  2X8T A;  3P6C A;  2P8G A;  1GGL A;  2NNQ A;  4A1H A;  1CBI A;  1S44 A;  4XME A;  1DFV A;  1KZX A;  2X8F A;  1IFC A;  3ZZV A;  2OVE A;  3HOE A;  1IIU A;  4ORY A;  3APX A;  2O62 A;  3PEC A;  1NGL A;  3HWF A;  1IKE A;  4UU2 A;  1BSY A;  4MVI A;  5EPQ A;  1BJ7 A;  3CQN A;  2JW1 A;  3EBW A;  3F9D A;  3P6G A;  4EEJ A;  2ALL X;  5L8N A;  1NP4 A;  4OMW A;  5FAZ A;  1SY1 A;  1JBH A;  3FEP A;  2F73 A;  4BOE A;  4I95 A;  3NQK A;  4IAW A;  5HTE A;  1I05 A;  5F6B A;  5FQ8 E;  2YG2 A;  2Q9S A;  3FEL A;  4ZHD A;  2CM9 A;  1R0U A;  5LJD A;  3ELZ A;  4PSQ A;  2FLJ A;  1OPA A;  4TJZ A;  1DF3 A;  4AZP A;  4FBV A;  3VG2 A;  1S2P A;  4CV7 A;  1UZ2 X;  2Z4I A;  1Z24 A;  1BWY A;  1QY2 A;  4IB8 A;  5H9K A;  1LF7 A;  4HWM A;  3WJC A;  4XMF A;  4QGV A;  4YKO A;  5F58 A;  4L3R A;  4YBU A;  2R73 A;  5BVT A;  1ICN A;  1EII A;  1NP1 A;  4ZJ0 A;  5D45 A;  3UEW A;  3LHN A;  1KT5 A;  3BSZ E;  1KT6 A;  4YCE A;  3RWX A;  5DPQ A;  1QAB E;  4TNN A;  1PM1 X;  2L5P A;  1E06 A;  1E5P A;  2EU7 X;  4HPC A;  4RUU A;  3FIQ A;  3TF6 A;  2FR2 A;  3PQS A;  4NYQ A;  2E4J A;  4KC7 A;  1O8V A;  2AT8 X;  1SMP I;  5H9A A;  2QO5 A;  1LIF A;  2BS5 A;  3RBY A;  3SAO A;  3O2Y A;  3V8U A;  3HWG A;  2XKL A;  4NLI A;  2FTB A;  3BS2 A;  4QZU A;  1CBR A;  3P6E A;  4N7C A;  3KFI A;  4YDA A;  3BU1 A;  1ICM A;  3GAQ A;  1BSQ A;  5IO7 A;  4AZR A;  3FW5 A;  2WR6 A;  3APU A;  2CBS A;  4Y0P A;  5H9L A;  4RUN A;  4O4X A;  4O3X B;  5D48 A;  4QYP A;  5EZ2 A;  4AZO A;  4XMH A;  3MVF A;  3VU1 A;  3ZW1 A;  2MHD A;  2A2U A;  2BHV A;  3FR4 A;  3UEX A;  1IKJ A;  3P6D A;  1MUP A;  5CE4 A;  1I06 A;  1BLR A;  5HAE A;  1BBP A;  3STM X;  5FEN A;  4ZFX A;  3GE2 A;  3I0A A;  4KCA A;  4O3Y A;  2R74 A;  1SY2 A;  3ZW0 A;  1G74 A;  4U8U N;  3OE3 A;  4LZU A;  3EMM A;  1XKI A;  2GTF X;  1GX8 A;  3BDR A;  3FMZ A;  5KHP A;  2Q2P A;  1ZNH A;  3HTY A;  2CM4 A;  1ERB A;  2FS7 A;  2GC9 A;  3NX2 A;  2JU3 A;  3EYC A;  3OBL A;  1B56 A;  1N0S A;  3NPO A;  4NW4 A;  4GE1 A;  3C77 X;  4K19 A;  3BLG A;  1AQB A;  4DQ4 A;  2Z4H A;  2FS6 A;  2QM9 A;  2HZR A;  1GT4 A;  4NLJ A;  3FA6 A;  4O4O A;  2LBV A;  1QWD A;  1MVG A;  1URE A;  2HMB A;  3B2K A;  3P6H A;  5KID A;  4QRL A;  4WFU A;  5B27 A;  1JV4 A;  2X46 A;  3G7X A;  3PPT A;  2WEW A;  4OS0 A;  1A2D A;  3HOL A;  3B2J A;  4YGH A;  4YGG A;  3ZWE A;  1ZNG A;  2FR3 A;  4MVL A;  1QFT A;  2AMM X;  5LKE A;  1QQS A;  4IB6 A;  1JIW I;  2AL0 X;  3SOT A;  1HMS A;  4ML7 B;  2BLG A;  2LKK A;  3CQR A;  3PED A;  5F1E A;  1QFV A;  1DZJ A;  4IAB A;  4GRJ A;  1SXY A;  2KW1 A;  1YP7 A;  4NP1 A;  3BX7 A;  1ADL A;  3VG5 A;  1PMP A;  1QG5 A;  2PY1 A;  1FEL A;  4ALO A;  2W2F A;  4EDE A;  4JGL A;  2A13 A;  4ORU A;  2WUT A;  4ZH6 A;  3C76 X;  2ACP X;  1VPR A;  2RN4 A;  4I3D A;  1CBQ A;  1T8V A;  1A57 A;  4YBP A;  4ORW A;  3CR6 A;  3FA8 A;  3UAQ A;  4GKC A;  3RKG A;  5HBS A;  5FQ6 E;  4ZH9 A;  5HZQ A;  2M4L A;  2BS6 A;  5HZ8 A;  1U18 A;  3U03 A;  3F8A A;  3BRN A;  1LID A;  1BRQ A;  4WBK A;  1BRP A;  1X8N A;  1KXO A;  3RZY A;  5IO6 A;  2ACO A;  4FQB B;  3APV A;  4GDZ A;  4WFV A;  3N91 A;  4ZHG A;  1CBS A;  3NX1 A;  1BM5 A;  1HQP A;  4IMN A;  4KH8 A;  5HTD A;  5LJK A;  5BYP A;  5EDC A;  2KT4 B;  3O19 A;  2HZQ A;  1TOW A;  1SY3 A;  3WJB A;  4IAX A;  2L68 A;  1HMT A;  1GKA B;  3KFG A;  5IO5 A;  2QO6 A;  3DTQ A;  4ES7 A;  1GT5 A;  4O4S A;  1GX9 A;  3B2H A;  3WBG A;  4D6A A;  2QOS C;  1OEE A;  5FQ7 E;  5H9N A;  2NND A;  4GU8 A;  4QYN A;  1JYD A;  4GH7 A;  1DZK A;  1IFB A;  2ANS A;  4U9C A;  2JU7 A;  1OEK A;  4ORX A;  1A3Y A;  1T0V A;  2OFR X;  3P6F A;  2HYS A;  1KT7 A;  4QNI A;  2WSJ A;  2NP1 A;  1I04 A;  4MIS A;  3WVM A;  4FBR A;  5LJB A;  4LKP A;  3U0D A;  4EFG A;  1GM6 A;  4ZCB A;  4XMD A;  4CK4 A;  2WWP A;  3HK1 A;  2FRS A;  1RBP A;  5HCC C;  2FT9 A;  2LFO A;  1MX7 A;  2JOZ A;  1LNM A;  1X71 A;  4HFO A;  3I17 A;  1HN2 A;  1GXA A;  4INN A;  5H8T A;  3ZW0 B;  5KIC A;  4AZM A;  1IW2 A;  4IBA A;  4M6S A;  1VYF A;  1KQX A;  2K62 A;  4IMO A;  5CYB A;  1B8E A;  1JJJ A;  3AKM A;  1SXX A;  5D47 A;  1G5W A;  1E00 A;  4QGW A;  1SXU A;  4YMY A;  1PBO A;  3E3C A;  5HWZ A;  2RCQ A;  1YWD A;  4A60 A;  4AW8 A;  2LBA A;  5AEO A;  1L6M A;  3DSZ A;  1FE3 A;  2XST A;  5F6Z A;  2RCT A;  4ON1 A;  4YFP A;  1KQW A;  1EI5 A;  1OBP A;  5C0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...