3MVKA

The crystal structure of fucu from bifidobacterium longum to 1.65a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
Knots found
sequence length
140
structure length
140
Chain Sequence
IPKIIPPELLKVLCEMGHGDQLVIADGNFPAESIGKNAIVVRMDGHGGGEILKAILTVFPLDTYVDKPATLMEKVPGDTVATPIWDVYAGLIKEHDERGADAIGSLERFAFYEQAKNAYCVIASGESAQYANLILQKGVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of FucU from Bifidobacterium longum to 1.65A
rcsb
source organism Bifidobacterium longum subsp. infantis
molecule tags Isomerase
molecule keywords protein FucU
total genus 41
structure length 140
sequence length 140
chains with identical sequence B, C, D, E, F, G, H, I, J
other databases KnotProt 2.0: S +31
ec nomenclature
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05025 RbsD_FucU RbsD / FucU transport protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1650.10 Alpha Beta 3-Layer(aba) Sandwich RbsD-like fold RbsD-like domain 3mvkA01
2WCUA 1OGCA 3MVKA 3P12A 1OGFA 3P13A 3E7NA 1OGEA 2OB5A 2WCVA 1OGDA 4A34A
chains in the Genus database with same CATH superfamily
2WCUA 1OGCA 3MVKA 3P12A 1OGFA 3P13A 3E7NA 1OGEA 2OB5A 2WCVA 1OGDA 4A34A
chains in the Genus database with same CATH topology
2WCUA 1OGCA 3MVKA 3P12A 1OGFA 3P13A 3E7NA 1OGEA 2OB5A 2WCVA 1OGDA 4A34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCU A;  1OGC A;  3MVK A;  3P12 A;  1OGF A;  3P13 A;  3E7N A;  1OGE A;  2OB5 A;  2WCV A;  1OGD A;  4A34 A; 
#chains in the Genus database with same CATH topology
 2WCU A;  1OGC A;  3MVK A;  3P12 A;  1OGF A;  3P13 A;  3E7N A;  1OGE A;  2OB5 A;  2WCV A;  1OGD A;  4A34 A; 
#chains in the Genus database with same CATH homology
 2WCU A;  1OGC A;  3MVK A;  3P12 A;  1OGF A;  3P13 A;  3E7N A;  1OGE A;  2OB5 A;  2WCV A;  1OGD A;  4A34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...