3MVNA

Crystal structure of a domain from a putative udp-n-acetylmuramate:l-alanyl-gamma-d-glutamyl-medo-diaminopimelate ligase from haemophilus ducreyi 35000hp
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
123
Chain Sequence
RLEVKGVVNNITVYDDFAHHPTAITATIDALRAKVGQQRILAVLEPRKHELATSLQDADSVFIYQPWQVSEVLANLAQPAISADDVDELVMRIVQQAKPNDHILIMSNGAFGGIHQKLLTALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a domain from a putative UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-medo-diaminopimelate ligase from Haemophilus ducreyi 35000HP
rcsb
source organism Haemophilus ducreyi
molecule tags Ligase
molecule keywords UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-medo-diaminop
total genus 36
structure length 123
sequence length 136
ec nomenclature
pdb deposition date 2010-05-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.190.20 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Mur ligase, C-terminal domain 3mvnA00
4UAGA 5A5EA 2VOSA 4BUCA 4C13A 2JFHA 1J6UA 1UAGA 3LK7A 1E8CA 2GCAA 1GQYA 2X5OA 3MVNA 1JBVA 2VORA 4CVMA 3ZM6A 2AM1A 4QDIA 1P31A 4CVLA 2WJPA 2Y67A 2VTDA 1JBWA 2JFFA 1GG4A 2XPCA 2AM2A 2XJAA 3HN7A 2UAGA 2UUOA 1O5ZA 1EEHA 2GC5A 2JFGA 3PYZA 2Y1OA 4BUBA 1W78A 1P3DA 3ZM5A 4CVKA 4HV4A 2UUPA 4QF5A 2GC6A 3QCZA 2VTEA 3N2AA 3UAGA 4C12A 2Y68A 1W7KA 5A5FA 2GCBA 3ZL8A 2F00A 2Y66A 4ZIYA 1E0DA 1FGSA 2WTZA 3NRSA 1GQQA
chains in the Genus database with same CATH superfamily
2SHPA 5K24A 4UAGA 2HNPA 1XRIA 2HC1A 2CNFA 1I9TA 1QXKA 1C84A 5J8RA 2WGPA 4QDIA 1BZJA 4RKKA 2JFFA 1J4XA 2B4OA 1OHCA 1Q6SA 1ONZA 4NX8A 2NT7A 5KA8A 2CM3A 2I5XA 2C46A 2GCBA 3F9BA 2I6IA 3GXHA 2PI7A 1OEUA 5K9WA 1E0DA 5K25A 1OHDA 1MKPA 4PYHA 3ZM1A 1PH0A 1BZHA 2FH7A 4KI9A 4QAPA 1BZCA 5KACA 2BGDA 3V0HA 2QBSA 3V0FA 2J16A 1G4US 2QEPA 4OHDA 2NLKA 2F6WA 1L8KA 2UUOA 3D1OA 2JFGA 3AWGA 3V0EA 3ZM5A 1G7GA 4BPCA 4OHEA 3QCGA 4AZ1A 1Q6PA 2BZLA 1PTTA 1PXHA 2VEVA 3F9AA 1SUGA 4NYHA 3F99A 4Z6BA 2Y67A 4QAHA 3QKPA 2I6JA 1YN9A 3I7ZA 2GP0A 2PA5A 3S3HA 3RGQA 4GE2A 1RPMA 4JBCA 2VEWA 3D1QA 4Y14A 2F00A 2G6ZA 3RGOA 3NRSA 2DXPA 2FJMA 2CM8A 3QCCA 3D42A 4ICZA 1J6UA 2J17A 2PSZA 1AAXA 5K22A 5LXQB 2CNGA 1XBOA 1FPZA 4OHIA 3ZV2A 2F71A 4J51A 1PYNA 3F81A 2H4VA 1YTWA 1PA9A 4GE5A 5GTJA 4NNDA 2CMAA 5M43A 4I8NA 3UAGA 1W7KA 1LARA 2Y66A 1V3AA 3QKQA 1ZC0A 1JF7A 2IMGA 1U24A 2QDCA 1A5YA 4ERCA 1KAKA 2QCTA 2GCAA 2M3VA 2CNHA 3CWEA 4HRFA 4HJPA 1OEOX 3A5KA 4GFUA 2AM2A 2XJAA 3HN7A 3QCBA 3BRHA 1QZ0A 3QCKA 2B49A 2GC6A 3QCJA 4RI5A 3QCHA 1U25A 2I42A 3MOZA 1G1HA 3D9CA 1WRMA 1Q6JA 2MBCA 2NV5A 4JNBA 3ZM2A 2BV5A 2QBQA 3QCLA 2P4DA 3S3EA 1EEOA 1I9SA 4CVLA 3ZM3A 1G1GA 4Y2EA 3OMHA 2Y96A 4RI4A 5HDEA 1C86A 3PYZA 2Y1OA 4GWFA 3GXGA 4OHHA 3O5XA 2I6OA 2I4EA 2PT0A 3EB1A 1C85A 3A5JA 4WTYA 2B4PA 4QBEA 2OC3A 3PS5A 2ZN7A 1GQQA 2Q05A 4KYRA 4NWGA 4MBBA 1UAGA 2FJNA 2H4KA 3O4TA 2AHSA 2I75A 4WOHA 4GFVA 3AWEA 4D3QA 1GG4A 4GRZA 3S3KA 4D3PA 2H04A 3H2XA 3QCIA 1OESA 3U96A 2F6VA 1GFYA 2B3OA 4HV4A 5EHRA 2F46A 1OEVA 2QCJA 1JLNA 2CM2A 1PTVA 4WU3A 1T49A 1ECVA 3QCEA 5KA1A 4S0GA 2E0TA 2H4GA 2VORA 4CVMA 5EHPA 1WAXA 2QBRA 2XPCA 3I80A 4BUBA 4ZRTA 1PTYA 4JMKA 4ZN5A 5AWXA 5KADA 5K23A 4GRYA 5BX1A 1NO6A 2F6ZA 3CM3A 3O4SA 3ZM6A 1T48A 4B04A 1P31A 1LQFA 4QUMA 1ZCLA 3ZMQA 5KA3A 2UAGA 4KYQA 1WCHA 2CNIA 3QCZA 4C12A 4ZIYA 2J16B 2B4UA 4H1OA 1Q6TA 3AWFA 4YAAA 2R0BA 1NWEA 1NNYA 4D3RA 3MOWA 3D44A 3MVNA 2RF6A 1I57A 3B7OA 1PTUA 1X24A 2Y2FA 2GC5A 4DGPA 2CFVA 1EENA 5IBSA 1YZ4A 4GE6A 3QCDA 4RH5A 2B07A 2WTZA 3ZM0A 2VOSA 1Q6NA 2QDMA 2JFHA 3V0GA 2VEUA 5KA0A 2HVLA 2X5OA 3V0IA 2H02A 2AM1A 5BZZA 2WJPA 2VTDA 4DGXA 4ZI4A 3BLUA 1XXPA 3SMEA 1P15A 4CVKA 1GWZA 2I4GA 5K9VA 3SR9A 4YR8B 1OEMX 3RO1A 2Q47A 1XXVA 4BUCA 2I3UA 2I3RA 4H34A 1VHRA 1PA1A 1G4WR 4QBWA 5KA9A 2HY3A 4WU2A 1XM2A 2JJDA 2PQ5A 1NL9A 1P3DA 3EZZA 4R0TA 4IKCA 3QCMA 4RDDA 1NWLA 5KA7A 3N0AA 1ONYA 2HC2A 3F41A 2B4SA 2BGEA 3BM8A 1YFOA 2VEYA 3S4EA 1GQYA 4GS0A 4PVGA 3S3FA 5IBMA 3EU0A 3BLTA 1RXDA 2G59A 1M3GA 1FQ1A 2CNEA 1ZZWA 1O5ZA 1YTSA 2CMCA 2F6YA 2NTAA 2QDPA 3O4UA 3QCFA 5MMZB 4HJQA 1C87A 2C7SA 3M4UA 3OLRA 2I6PA 4QF5A 2A3KA 2HXPA 2Y68A 3RZ2A 3S4OA 3I36A 1C83A 1KAVA 1OETA 1FPRA 4C13A 2CJZA 2VEXA 3V0DA 3LK7A 1YGUA 1JBVA 4RH9A 4OHLA 1G7FA 4NWFA 2ZMMA 1R6HA 5BUGA 1NZ7A 3EMUA 3NMEA 5I6VA 2F6FA 2BIJA 1G1FA 2ESBA 1W78A 5BZXA 5KA4A 2UUPA 2GWOA 5KABA 1FGSA 5KAAA 2OZ5A 2I4HA 3EAXA 5A5EA 1D5RA 1YPTA 2OUDA 2F70A 3V0JA 2YDUA 1YTNA 1ZCKA 1LYVA 2H03A 2CM7A 4TVVA 1U26A 1C88A 4R30A 2HB1A 2HNQA 3N2AA 1T4JA 1L8GA 2A8BA 5A5FA 3ZL8A 3MMJA 3QCNA 3ZMPA 2I1YA 1YWFA 3D1HA 2HCMA 2I6MA 1YGRA 2GJTA 1E8CA 2AZRA 2OOQA 5KA2A 2PBNA 4BJOA 1Q1MA 3O3LA 4QUNA 2F6TA 2CMBA 2P6XA 1JBWA 4R0SA 1EEHA 1OHEA 4JMJA 1Q6MA 2NT2A 2VTEA 4RHGA 3LJ8A 2QBPA 2NZ6A
chains in the Genus database with same CATH topology
4UAGA 5A5EA 2VOSA 4BUCA 4C13A 2JFHA 1J6UA 1UAGA 3LK7A 1E8CA 2GCAA 1GQYA 2X5OA 3MVNA 1JBVA 2VORA 4CVMA 3ZM6A 2AM1A 4QDIA 1P31A 4CVLA 2WJPA 2Y67A 2VTDA 1JBWA 2JFFA 1GG4A 2XPCA 2AM2A 2XJAA 3HN7A 2UAGA 2UUOA 1O5ZA 1EEHA 2GC5A 2JFGA 3PYZA 2Y1OA 4BUBA 1W78A 1P3DA 3ZM5A 4CVKA 4HV4A 2UUPA 4QF5A 2GC6A 3QCZA 2VTEA 3N2AA 3UAGA 4C12A 2Y68A 1W7KA 5A5FA 2GCBA 3ZL8A 2F00A 2Y66A 4ZIYA 1E0DA 1FGSA 2WTZA 3NRSA 1GQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UAG A;  5A5E A;  2VOS A;  4BUC A;  4C13 A;  2JFH A;  1J6U A;  1UAG A;  3LK7 A;  1E8C A;  2GCA A;  1GQY A;  2X5O A;  3MVN A;  1JBV A;  2VOR A;  4CVM A;  3ZM6 A;  2AM1 A;  4QDI A;  1P31 A;  4CVL A;  2WJP A;  2Y67 A;  2VTD A;  1JBW A;  2JFF A;  1GG4 A;  2XPC A;  2AM2 A;  2XJA A;  3HN7 A;  2UAG A;  2UUO A;  1O5Z A;  1EEH A;  2GC5 A;  2JFG A;  3PYZ A;  2Y1O A;  4BUB A;  1W78 A;  1P3D A;  3ZM5 A;  4CVK A;  4HV4 A;  2UUP A;  4QF5 A;  2GC6 A;  3QCZ A;  2VTE A;  3N2A A;  3UAG A;  4C12 A;  2Y68 A;  1W7K A;  5A5F A;  2GCB A;  3ZL8 A;  2F00 A;  2Y66 A;  4ZIY A;  1E0D A;  1FGS A;  2WTZ A;  3NRS A;  1GQQ A; 
#chains in the Genus database with same CATH topology
 2SHP A;  5K24 A;  4UAG A;  2HNP A;  1XRI A;  2HC1 A;  2CNF A;  1I9T A;  1QXK A;  1C84 A;  5J8R A;  2WGP A;  4QDI A;  1BZJ A;  4RKK A;  2JFF A;  1J4X A;  2B4O A;  1OHC A;  1Q6S A;  1ONZ A;  4NX8 A;  2NT7 A;  5KA8 A;  2CM3 A;  2I5X A;  2C46 A;  2GCB A;  3F9B A;  2I6I A;  3GXH A;  2PI7 A;  1OEU A;  5K9W A;  1E0D A;  5K25 A;  1OHD A;  1MKP A;  4PYH A;  3ZM1 A;  1PH0 A;  1BZH A;  2FH7 A;  4KI9 A;  4QAP A;  1BZC A;  5KAC A;  2BGD A;  3V0H A;  2QBS A;  3V0F A;  2J16 A;  1G4U S;  2QEP A;  4OHD A;  2NLK A;  2F6W A;  1L8K A;  2UUO A;  3D1O A;  2JFG A;  3AWG A;  3V0E A;  3ZM5 A;  1G7G A;  4BPC A;  4OHE A;  3QCG A;  4AZ1 A;  1Q6P A;  2BZL A;  1PTT A;  1PXH A;  2VEV A;  3F9A A;  1SUG A;  4NYH A;  3F99 A;  4Z6B A;  2Y67 A;  4QAH A;  3QKP A;  2I6J A;  1YN9 A;  3I7Z A;  2GP0 A;  2PA5 A;  3S3H A;  3RGQ A;  4GE2 A;  1RPM A;  4JBC A;  2VEW A;  3D1Q A;  4Y14 A;  2F00 A;  2G6Z A;  3RGO A;  3NRS A;  2DXP A;  2FJM A;  2CM8 A;  3QCC A;  3D42 A;  4ICZ A;  1J6U A;  2J17 A;  2PSZ A;  1AAX A;  5K22 A;  5LXQ B;  2CNG A;  1XBO A;  1FPZ A;  4OHI A;  3ZV2 A;  2F71 A;  4J51 A;  1PYN A;  3F81 A;  2H4V A;  1YTW A;  1PA9 A;  4GE5 A;  5GTJ A;  4NND A;  2CMA A;  5M43 A;  4I8N A;  3UAG A;  1W7K A;  1LAR A;  2Y66 A;  1V3A A;  3QKQ A;  1ZC0 A;  1JF7 A;  2IMG A;  1U24 A;  2QDC A;  1A5Y A;  4ERC A;  1KAK A;  2QCT A;  2GCA A;  2M3V A;  2CNH A;  3CWE A;  4HRF A;  4HJP A;  1OEO X;  3A5K A;  4GFU A;  2AM2 A;  2XJA A;  3HN7 A;  3QCB A;  3BRH A;  1QZ0 A;  3QCK A;  2B49 A;  2GC6 A;  3QCJ A;  4RI5 A;  3QCH A;  1U25 A;  2I42 A;  3MOZ A;  1G1H A;  3D9C A;  1WRM A;  1Q6J A;  2MBC A;  2NV5 A;  4JNB A;  3ZM2 A;  2BV5 A;  2QBQ A;  3QCL A;  2P4D A;  3S3E A;  1EEO A;  1I9S A;  4CVL A;  3ZM3 A;  1G1G A;  4Y2E A;  3OMH A;  2Y96 A;  4RI4 A;  5HDE A;  1C86 A;  3PYZ A;  2Y1O A;  4GWF A;  3GXG A;  4OHH A;  3O5X A;  2I6O A;  2I4E A;  2PT0 A;  3EB1 A;  1C85 A;  3A5J A;  4WTY A;  2B4P A;  4QBE A;  2OC3 A;  3PS5 A;  2ZN7 A;  1GQQ A;  2Q05 A;  4KYR A;  4NWG A;  4MBB A;  1UAG A;  2FJN A;  2H4K A;  3O4T A;  2AHS A;  2I75 A;  4WOH A;  4GFV A;  3AWE A;  4D3Q A;  1GG4 A;  4GRZ A;  3S3K A;  4D3P A;  2H04 A;  3H2X A;  3QCI A;  1OES A;  3U96 A;  2F6V A;  1GFY A;  2B3O A;  4HV4 A;  5EHR A;  2F46 A;  1OEV A;  2QCJ A;  1JLN A;  2CM2 A;  1PTV A;  4WU3 A;  1T49 A;  1ECV A;  3QCE A;  5KA1 A;  4S0G A;  2E0T A;  2H4G A;  2VOR A;  4CVM A;  5EHP A;  1WAX A;  2QBR A;  2XPC A;  3I80 A;  4BUB A;  4ZRT A;  1PTY A;  4JMK A;  4ZN5 A;  5AWX A;  5KAD A;  5K23 A;  4GRY A;  5BX1 A;  1NO6 A;  2F6Z A;  3CM3 A;  3O4S A;  3ZM6 A;  1T48 A;  4B04 A;  1P31 A;  1LQF A;  4QUM A;  1ZCL A;  3ZMQ A;  5KA3 A;  2UAG A;  4KYQ A;  1WCH A;  2CNI A;  3QCZ A;  4C12 A;  4ZIY A;  2J16 B;  2B4U A;  4H1O A;  1Q6T A;  3AWF A;  4YAA A;  2R0B A;  1NWE A;  1NNY A;  4D3R A;  3MOW A;  3D44 A;  3MVN A;  2RF6 A;  1I57 A;  3B7O A;  1PTU A;  1X24 A;  2Y2F A;  2GC5 A;  4DGP A;  2CFV A;  1EEN A;  5IBS A;  1YZ4 A;  4GE6 A;  3QCD A;  4RH5 A;  2B07 A;  2WTZ A;  3ZM0 A;  2VOS A;  1Q6N A;  2QDM A;  2JFH A;  3V0G A;  2VEU A;  5KA0 A;  2HVL A;  2X5O A;  3V0I A;  2H02 A;  2AM1 A;  5BZZ A;  2WJP A;  2VTD A;  4DGX A;  4ZI4 A;  3BLU A;  1XXP A;  3SME A;  1P15 A;  4CVK A;  1GWZ A;  2I4G A;  5K9V A;  3SR9 A;  4YR8 B;  1OEM X;  3RO1 A;  2Q47 A;  1XXV A;  4BUC A;  2I3U A;  2I3R A;  4H34 A;  1VHR A;  1PA1 A;  1G4W R;  4QBW A;  5KA9 A;  2HY3 A;  4WU2 A;  1XM2 A;  2JJD A;  2PQ5 A;  1NL9 A;  1P3D A;  3EZZ A;  4R0T A;  4IKC A;  3QCM A;  4RDD A;  1NWL A;  5KA7 A;  3N0A A;  1ONY A;  2HC2 A;  3F41 A;  2B4S A;  2BGE A;  3BM8 A;  1YFO A;  2VEY A;  3S4E A;  1GQY A;  4GS0 A;  4PVG A;  3S3F A;  5IBM A;  3EU0 A;  3BLT A;  1RXD A;  2G59 A;  1M3G A;  1FQ1 A;  2CNE A;  1ZZW A;  1O5Z A;  1YTS A;  2CMC A;  2F6Y A;  2NTA A;  2QDP A;  3O4U A;  3QCF A;  5MMZ B;  4HJQ A;  1C87 A;  2C7S A;  3M4U A;  3OLR A;  2I6P A;  4QF5 A;  2A3K A;  2HXP A;  2Y68 A;  3RZ2 A;  3S4O A;  3I36 A;  1C83 A;  1KAV A;  1OET A;  1FPR A;  4C13 A;  2CJZ A;  2VEX A;  3V0D A;  3LK7 A;  1YGU A;  1JBV A;  4RH9 A;  4OHL A;  1G7F A;  4NWF A;  2ZMM A;  1R6H A;  5BUG A;  1NZ7 A;  3EMU A;  3NME A;  5I6V A;  2F6F A;  2BIJ A;  1G1F A;  2ESB A;  1W78 A;  5BZX A;  5KA4 A;  2UUP A;  2GWO A;  5KAB A;  1FGS A;  5KAA A;  2OZ5 A;  2I4H A;  3EAX A;  5A5E A;  1D5R A;  1YPT A;  2OUD A;  2F70 A;  3V0J A;  2YDU A;  1YTN A;  1ZCK A;  1LYV A;  2H03 A;  2CM7 A;  4TVV A;  1U26 A;  1C88 A;  4R30 A;  2HB1 A;  2HNQ A;  3N2A A;  1T4J A;  1L8G A;  2A8B A;  5A5F A;  3ZL8 A;  3MMJ A;  3QCN A;  3ZMP A;  2I1Y A;  1YWF A;  3D1H A;  2HCM A;  2I6M A;  1YGR A;  2GJT A;  1E8C A;  2AZR A;  2OOQ A;  5KA2 A;  2PBN A;  4BJO A;  1Q1M A;  3O3L A;  4QUN A;  2F6T A;  2CMB A;  2P6X A;  1JBW A;  4R0S A;  1EEH A;  1OHE A;  4JMJ A;  1Q6M A;  2NT2 A;  2VTE A;  4RHG A;  3LJ8 A;  2QBP A;  2NZ6 A; 
#chains in the Genus database with same CATH homology
 4UAG A;  5A5E A;  2VOS A;  4BUC A;  4C13 A;  2JFH A;  1J6U A;  1UAG A;  3LK7 A;  1E8C A;  2GCA A;  1GQY A;  2X5O A;  3MVN A;  1JBV A;  2VOR A;  4CVM A;  3ZM6 A;  2AM1 A;  4QDI A;  1P31 A;  4CVL A;  2WJP A;  2Y67 A;  2VTD A;  1JBW A;  2JFF A;  1GG4 A;  2XPC A;  2AM2 A;  2XJA A;  3HN7 A;  2UAG A;  2UUO A;  1O5Z A;  1EEH A;  2GC5 A;  2JFG A;  3PYZ A;  2Y1O A;  4BUB A;  1W78 A;  1P3D A;  3ZM5 A;  4CVK A;  4HV4 A;  2UUP A;  4QF5 A;  2GC6 A;  3QCZ A;  2VTE A;  3N2A A;  3UAG A;  4C12 A;  2Y68 A;  1W7K A;  5A5F A;  2GCB A;  3ZL8 A;  2F00 A;  2Y66 A;  4ZIY A;  1E0D A;  1FGS A;  2WTZ A;  3NRS A;  1GQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...