3MWCA

Crystal structure of probable o-succinylbenzoic acid synthetase from kosmotoga olearia
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
388
structure length
388
Chain Sequence
b'LTESARIDGVSLYEIVIPMKIPFQISSGTCYTRRSLVVEIREGDLFGYGESAPFEEPFYLGETLETTKVILKNHLLPMILGKEPLSIEEFNHLIKNGIRGNHFARCGVENAYWDLIAKKNKISLKAMIEKKMKNLGVKQEYLASNNYIESGAALGIPEDGRIETLIHQVEESLQEGYRRIKIKIKPGWDVEPLQETRRAVGDHFPLWTDANSSFELDQWETFKAMDAAKCLFHEQPLHYEALLDLKELGERIETPICLDESLISSRVAEFVAKLGISNIWNIKIQRVGGLLEAIKIYKIATDNGIKLWGGTMPESGLGARFLISLASFRGFVFPADVAASEKWYGKGNDLVENTMTDGKIYVPDEPGASFDMTLSHLEALGKKIWESQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing protein
publication title Crystal Structure of O-Succinylbenzoic Acid Synthetase from Kosmotoga Olearia
rcsb
source organism Kosmotoga olearia
molecule tags Ligase
total genus 139
structure length 388
sequence length 388
ec nomenclature
pdb deposition date 2010-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3mwcA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3mwcA01
3NO1A 3PWGA 2AL2A 2OX4A 3N6HA 3H7VA 1P43A 3MQTA 1ECQA 3ES8A 3OPSA 4DX3A 3FCPA 4GIRA 4GISA 3DIPA 1XS2A 3BSMA 2OPJA 3UJFA 2PU0A 2PP0A 2GGEA 3DESA 2OZ8A 4H2HA 4DHGA 4ZA0A 2HNEA 3DG6A 3T6CA 2OG9A 1JDFA 2AKZA 3IJQA 4KEMA 1W6TA 2PPGA 5FJRA 4HNLA 3DFHA 3RCYA 2QQ6A 3K1GA 3RGTA 2HXUA 1ELSA 2PTYA 3VFCA 3CYJA 3OW1A 3S5SA 1XPYA 2XGZA 1ONEA 3ZLFA 5J04A 3NXLA 5FJTA 5FJUA 3VA8A 3DG7A 3B97A 3N6JA 1WUFA 1MDRA 3VC5A 2OZTA 5BOFA 3GC2A 2ONEA 4ROPA 1BKHA 3SN1A 2ZC8A 2PP1A 4HCLA 3D46A 2XH7A 3OZMA 3FJ4A 3ZVHB 1EBGA 3KUMA 3FXGA 2P0IA 3P93A 2OVLA 4GGHA 2AL2B 3SSZA 2XH4A 3GY1A 7ENLA 2AKMA 4K8GA 1SJDA 1EC8A 1EC9A 2NQLA 3R1ZA 3VCNA 4G8TA 3MKCA 4FI4A 3Q4DA 2GGIA 3JW7A 1MRAA 4GGBA 3T8QA 3I4KA 4H19A 4GMEA 2QJMA 1KCZA 3U4FA 3RITA 2PGWA 3TQPA 3FYYA 2P88A 1IYXA 3ES7A 2GGGA 2OKTA 3HPFA 3VDGA 2QGYA 3UCDA 3H12A 1MDLA 3CT2A 2OZ3A 4J3ZA 2P8BA 4FP1A 2I5QA 4JN8A 2PP3A 2PMQA 4H83A 3GO2A 2QJJA 4EWJA 3TJIA 3Q45A 2XSXA 4DYEA 3CB3A 4KPLA 2DW7A 3TJ4A 4IL2A 3V4BA 6ENLA 3UJ2A 2O56A 4E4UA 3THUA 2MUCA 1SJBA 1L8PA 2QDEA 3MWCA 3QKEA 4J1OA 3P3BA 4HCDA 3R10A 3NZGA 3EKGA 2OFJA 4MKSA 1NU5A 2PA6A 3SN4A 3DDMA 4A6GA 3QTPA 2GDQA 2PTZA 3MY9A 3TWBA 4IL0A 1TE6A 1MUCA 4GYPC 4IHCA 4K1WA 3V5FA 3FVDA 2XH2A 2FKPA 3U9IA 4E6MA 3UJRA 3DEQA 3TWAA 4IT1A 3UGVA 4E5TA 2HZGA 2CHRA 3PWIA 3T4WA 3TTEA 4ZCWA 3VC6A 4G7FA 4MGGA 1PDZA 3BJSA 3GD6A 4JN7A 2AL1A 4KT2A 1MNSA 4Z17A 3IK4A 3UJSA 2GGHA 1RVKA 3FV9A 3IJLA 1PDYA 1NELA 4HPNA 4GFIA 4DXKA 3STPA 2HXTA 2PCEA 1JPMA 3ZVIA 3DGBA 2ZADA 4E4FA 3ENLA 4IP5A 3MUCA 3UCCA 3CXOA 3R25A 2OLAA 4IP4A 2QJNA 3OTRA 5ENLA 3ZVHA 4H1ZA 3V3WA 3V5CA 3RRAA 3R0UA 3PFRA 3ZLGA 4KWSA 1P48A 4X2PA 3H8AA 4HN8A 2MNRA 3N4EA 3DG3A 4HCHA 1TZZA 3I6EA 3QN3A 1SJAA 4M6UA 2QDDA 2GL5A 4K2SA 3TOYA 2PTXA 4YWSA 3H70A 2FYMA 2PS2A 1FHVA 3EEZA 3D47A 2OO6A 3VCCA 3RO6A 2PODA 2PTWA 4MMWA 3QPEA 4F4RA 3P0WA 1E9IA 3I6TA 2XH0A 1EBHA 1BQGA 3RR1A 1F9CA 1TKKA 1WUEA 3SN0A 3BOXA 3R11A 3MZNA 3UXKA 1YEYA 5FJOA 4A35A 3SBFA 3DFYA 1OEPA 2RDXA 3DERA 4A3RA 5BOEA 4IZGA 3NFUA 3SQSA 2GGJA 3JVAA 3UXLA 5IDZA 2POZA 2PSNA 1EC7A 4HYRA 3T9PA 3MSYA 3R0KA 3CK5A 4HNCA 3UJEA 1JPDX 1JCTA 3CAWA 2OQHA 4E8GA 3QLDA 2PU1A 3OZYA 4JHMA 2QVHA 4GYPA 3S47A 1R0MA 1R6WA 1KKOA 4M0XA 5EU9A 2P8CA 3TCSA 2GSHA 3PK7A 1DTNA 3N4FA 3TW9A 4Z1YA 1KD0A 1SJCA 3OP2A 3SJNA 1FHUA 4DWDA 4ENLA 2PGEA 5FJPA 3ZLHA 3JZUA 4DN1A 2P3ZA 2DW6A 2OQYA 3IJIA 1KKRA
chains in the Genus database with same CATH superfamily
3T2QA 5F2GA 3L0KA 1VFOA 1PHWA 4H4VA 2XN2A 1QPOA 4PH6A 4QJ5B 3GBEA 3H7VA 2YSWA 3ONBA 2REQB 4LUSA 4XD6A 4B92A 4FF5A 1SMDA 3BV7A 3AZRA 3CZKA 1GORA 3QTGA 2WKJA 3PB2A 2DJLA 2NV2A 1ODZA 2GR1A 3IGXA 4PMXA 3DG6A 5F2LA 2NQ5A 1IV8A 3OYXA 4I9MA 4JNMA 2VEPA 1TO3A 5I03A 1PHQA 4MKNA 3WD4A 5LNWA 2BGQA 1ZAJA 1PB0A 3S5SA 5CPQA 1O1ZA 3MMTA 2W27A 1ONEA 3B40A 1BYCA 4HOWA 3VNKA 4HK5A 3IJ8A 4AXKA 3OVRA 2F7FA 3SI9A 5MKGA 1GONA 3HGSA 4F8XA 1S7MA 3KVKA 2CWNA 3VA8A 3HQNA 5U7SA 2V2HA 2PWUA 2P50A 2ZDSA 2OYKA 1IXNA 4XO6A 2ZC8A 4DJFD 4IUGA 3NZQA 5D37A 4AD0A 1PXGA 4H4ZA 3IAPA 3ABXA 3U5YA 3PTMA 1UZDA 2EBNA 5HANA 1GG0A 4IFKA 3QFAA 1W2PA 3G1HA 4CD7A 3ZMRA 3GNNA 4GI6A 2WMIB 4QIUA 1F2JA 1TTPA 3ABOA 3EOLA 2CW6A 4DJDD 3ZJKA 3SZ8A 3MSRA 2QMKA 5I09A 1SO5A 4XB3A 1L6YA 1M7PA 1YBQA 1U1UA 1WX0A 3VGGA 2BXVA 2X1SA 4GH3A 4UQAA 4GGBA 4IISA 2X1UA 3WO8A 2ZRUA 3VMOA 1H63A 3E1F1 4FLRA 2Q3OA 4KRUA 1WKEA 4B9ZA 3UR7A 1DIEA 4FIRA 3HB9A 1UIOA 4QRNA 4JOMA 4PB3A 4HYWA 1N8IA 4CD5A 3IVUA 1HO1A 4RE3A 1ZMCA 2Z29A 4F0KA 3N3TA 1RH9A 1P0KA 4D1IA 3LM3A 1MDLA 1W9UA 2PDNA 3EBVA 4PR4A 2ZX5A 3HFTA 3O0FA 4KMQA 2DY3A 1B4KA 3VKKA 3EMQA 3QYQA 3MV01 4HPGA 3TJIA 3CB3A 4PCPA 2R14A 1ONXA 3CLWA 4GZEA 5FEWA 1LL6A 2QCFA 2ANUA 2Z26A 4WZHA 1JF5A 2E7FA 4O18A 1BEUA 1K9EA 3OB8A 1TJ1A 1M9HA 5I2UA 1J01A 4I8YA 3HM7A 4DB7A 3TXVA 1I2QA 5ABFA 4H9UA 2DJXA 4NNCA 2D69A 3WMSA 3WLSA 4AZCA 3B9NA 4D8LA 2RABA 2VTFA 4MDPA 1FWSA 5HA7A 1LBFA 3BL3A 5CC6A 1K9TA 9CGTA 3O6AA 4WDTA 3I10A 4IHCA 1S3HA 3QY8A 4QDMA 1A5CA 9XIMA 3W00A 4Q8VA 4LC8A 1N8WA 3NURA 3PWIA 2PDGA 1JAKA 4UQ9A 3OG2A 1F5ZA 1XW8A 2HQMA 3TZFA 1XIHA 4EE9A 1Q8AA 5IFTA 1MEHA 4WQ6A 7CGTA 1FH8A 2FVKA 2G4FA 2GGHA 3IVSA 1R7OA 2NUYA 3TOPA 4HPNA 2ALDA 3UETA 1XKYA 3P14A 2HXTA 4O1EA 2VQUA 2PGRA 3TDFA 2F38A 4LWWA 1M5WA 4PUKA 4XD5A 2W3RA 1NP2A 4HK6A 2FZBA 4IP5A 4TVUA 2G37A 3VOCA 3C2FA 2POTA 3WQOA 3RX4A 2VR5A 1WE5A 2J7GA 2OYLA 3W6MA 4UQDA 2VX5A 2V5CA 5JRBA 5KSWA 4JIHA 1JR1A 4RDWA 2HNHA 1JCMP 5I3KA 3UCQA 3PFRA 5AC7A 2Z6JA 3L4TA 1RLCL 4MVAA 4MSSA 1FHLA 1XLFA 2DZSA 1ODUA 1THFD 3IJ7A 4EOUA 8XIAA 2OXNA 4W8AA 1JPIA 4C6FA 5BMWA 1CI1A 4IQDA 2XZ7A 1ECEA 1JEHA 2TAAA 1FCQA 1H41A 5H6HA 1E0TA 3C5QA 1CGVA 2ZTJA 3S2NA 3RM4A 1PKNA 3R13A 3WF2A 2WSQA 5BZAA 3E0WA 2YGYA 5M03A 2ZICA 1E9IA 4JIEA 1M68A 5F7UA 3QW4B 1VFSA 3CUJA 1FFQA 1K8CA 4GNKB 4IPNB 5C0QA 2REQA 5C9RA 1RJPA 3OYZA 4K6AA 1QI2A 1EZ2A 1BFNA 4AX7A 1OEPA 4HA0A 4D6HA 3M0VA 1JCXA 5E1QA 1R46A 8XIMA 4EIVA 1DV7A 1ZCCA 3IVTA 4IMDA 1EJRC 1PYMA 4YVXA 5G4EA 1WB0A 4AC7C 3H2MA 3CB8A 5LGZA 3B0VC 1EC7A 3BW2A 5HPCA 2X2YA 4PBGA 4H4XA 3CHFA 3WH5A 1CDGA 4PFMA 1RAKA 5A6JA 1MFUA 4BEQA 2EHHA 4RDYA 2PUZA 3NOYA 3VOIA 4CGTA 4RZ6A 3QLDA 4XBKA 4NNAA 3AXHA 3KRUA 4PRWA 1BSIA 1BYAA 4O0KA 5FCZA 4RZ5A 3PUOA 1X98A 3KBVA 3M6DA 4M56A 3TTQA 2ACUA 1REQA 5I3DA 4W7VA 1L6SA 3M7SA 3A9BA 3CASA 4F0RA 2OLSA 2F2KA 1LWHA 2P1FA 4L56A 4GY7A 1DWFM 2FDSA 3IJIA 3A4JA 3SRDA 3WBEA 4P7QA 3AXKA 1SQ7A 4IXHA 3TVAA 3WENA 5I23A 5CG7A 3KOZA 3REQB 1V93A 3QVQA 2WMIA 1KRAC 4WGHA 1TUFA 4JTUA 3WF1A 3TN3A 4Z2GA 2IQDA 4EVZA 3IIZA 1XS2A 3P81A 4TUFA 5D09A 1YDOA 2NXHA 4UNKA 5CC7A 1BVNP 3TLQA 5EY5A 3DI1A 5A2CA 3M46A 4YL2A 1YMYA 4QROA 4B4FA 1S5WA 1GCYA 1HX0A 4C1NB 5ABEA 3NPWA 1FCVA 4AD3A 2ALRA 4QE5A 3BLKA 1EFZA 1F8WA 4UQBA 1BXBA 4WXYA 2XWDA 3ZWTA 4EP8C 3L7RA 3LZ5A 4R9OA 4NKCA 2AOSA 2NUXA 3LPGA 4FEZA 2HSAA 1NDYA 3K8MA 3O07A 5M5DA 2XGZA 4JTHA 4CNUA 3EWBX 2E5CA 2IPWA 3U5UA 4TVYA 1TTIA 4LFYA 3NSNA 4GR1A 5J04A 1WDDA 1CBGA 1CX9A 3BLDA 4N9CA 2A0NA 3P60A 5G4HC 2X7VA 1E1FA 4H9XA 3V0TA 1KR0A 1O68A 4GNVA 4CNNA 4TXEA 4EXQA 1EX1A 4Q8NA 1W5PA 3WX7A 4PCSA 1UP2A 3IV8A 4YVPA 2DV0A 5ABHA 1N62C 4DXVA 3FJ4A 6TAAA 5CJMA 4PMUA 4W4QA 2PAJA 2H3BA 3RCNA 1XIBA 3LHUA 2Z2AA 1QOPA 3SSJA 1TYTA 1QR7A 3ITYA 2D24A 4GKTA 4L9XA 3TONA 5D8ZA 3E0VA 4BF7A 2VEGA 1B30A 3SCPA 5FL1A 2F84A 4W89A 4UTMA 3LI0A 1ML1A 1TZ7A 2J13A 2TMDA 4RZ4A 2RDTA 2VX7A 3ABSA 4A8NA 1EC8A 3GNPA 3MKCA 1Q6CA 3Q6JA 3TROA 4ZFCA 3S6OA 4L64A 4EMWA 4UTIA 3AIUA 3VNIA 5CSYA 4FLSA 4GMEA 1KCZA 3QGKC 2WP6A 2F5ZA 3VOFA 4GRSA 4O50A 4B5VA 2Y88A 1MW0A 1QNOA 3FYYA 1CIUA 4GX9A 5C7VA 4IMGA 1Q66A 7REQB 1M41A 2C7FA 3M7WA 1PZ2A 3LGEA 3CT2A 4QDPA 1MI3A 4ZENA 3PWAA 3NL5A 3TN4A 3O06A 1TV7A 4AFYA 4PN2A 2D3LA 4Z0JA 5AN7A 1ONRA 3WLKX 2VX4A 4B5UA 5BRQA 3ICJA 3TJ4A 2GDVA 3G0UA 3QV9A 1EYEA 2HROA 5FF4A 3MUIA 3BZGA 4HNTA 3WBYA 4TQTA 3VX1A 2AGTA 4UOJA 3PY2A 4S1FA 2WVUA 2AQWA 3HQPA 2E9LA 4F0HA 2H3DA 4N9EA 3I65A 4ZOAA 1GZGA 4Q4PA 4F79A 1AOGA 3GUWA 1M1BA 4ML4A 1KNWA 4O13A 1GW9A 1PKYA 2EGZA 2CLPA 3BW3A 5FL0A 1GQLA 4GJJA 1EPXA 3GXNA 4BKNA 2QCMA 4MOZA 3M0XA 2QPSA 3W23A 3N2OA 4BS0A 1CXHA 1ZAHA 4F2BA 4UMCA 5G5HB 1OCNA 5BOOA 2J7CA 3B8DA 4QLKA 3VC6A 2TPRA 3H23A 5I3HA 1QHOA 3W7LA 4KWOA 3B9DA 2HJPA 1CCWB 3TU9A 4KT2A 3ZS4A 5KTLA 5EBAA 2Z4GA 3W7QA 5DO8A 3OEXA 2VZUA 3LD5A 3W01A 2FZ9A 1RPXA 2X7WA 5A6AA 4F66A 5CQ1A 5FJJA 1TREA 3NNTA 1ISVA 3AYSA 3F5KA 4R3UA 1RJQA 3K13A 2YL6A 4TO8A 1XL9A 5U1OA 1IIHA 3Q67A 1LDCA 1WDSA 4GCAA 4NZ4A 1QNQA 4LCQA 3RHGA 2FGLA 3OGVA 3PBUA 1Z44A 5JUVA 4Y8EA 3KX6A 4V28A 4DZIA 2YB4A 4XZBA 2BY3A 3O8AA 4ZO9A 4AHOA 1PX3A 1NM9A 1ZFJA 2NX3A 4HA1A 5LZLA 2P53A 3I6EA 4TOQA 2ZXDA 1UWRA 4JX6A 3WLLA 3CMJA 2ISFA 3CBWA 1K6WA 1XINA 2ZX8A 4PMQA 1PTGA 1SYTA 4H4UA 2VNCA 4B91A 5HR7A 4G1KA 3AOFA 3QH2A 1OG0A 4Z42C 8RUCA 2G95A 1XLBA 4H6QA 1KM3A 1WOBA 2BTMA 4HHPA 1IHIA 3QV8A 1PL9A 4U4MA 1LOSA 5DN1A 3CAKA 4LTSA 1RY8A 2Y0FA 4Q32A 4ZQNA 3SBFA 1UR4A 2G3JA 3MKVA 2IKIA 2XINA 3ARXA 1M01A 1GOIA 3KLLA 1V6TA 5HAOA 3L5OA 2ZZ5A 5EMKA 4DNMA 4HOXA 4C1NA 2J79A 1HUVA 3SW6A 4C6EA 4KWWA 2C0AA 5G1MA 3GDBA 1UMLA 2QJIA 4TVDA 4QTGA 1M53A 3CK5A 4G7EB 4DBUA 4PFHA 1EBDA 5LA1A 3N2BA 1I2PA 2VZOA 2OQHA 4B2DD 2DIKA 3GXFA 4HZMA 2CZFA 4M8UA 2AGKA 4H9VA 3S47A 1AL8A 1FBAA 1KKOA 4JGDA 4ZGYA 1BWVA 2DSWA 1EJTC 1I1XA 3R4IA 3UG3A 3RN6A 3EDKA 4Z1YA 3UEQA 1JDDA 3GHTA 2BXZA 3GDLA 3LMYA 1G01A 2ZVRA 2FFIA 4A3HA 3TX9A 3PAOA 2F6KA 1FFUC 1IIGA 4M29A 3ATYA 1FP9A 5A6BA 1TX2A 3RO8A 2ZZ4A 2A7PA 2J8GA 3SGZA 2J9ZA 3MQTA 2DU2A 3DC8A 3OPSA 2Q01A 1SR0A 4LUTB 3BGAA 2X8HA 4CD6A 4V1XA 5F2IA 2Y24A 3W2KA 2GGEA 3K4DA 3KRBA 2ZUSA 4J9JA 3G8EA 1JDFA 4UR8A 3DN5A 1YTDA 3ZYZA 4O8RA 3OBKA 1LT8A 4H9MA 1WZLA 3A23A 2WZIA 3B8IA 2G8ZA 3VGHA 1JZ7A 1QMLA 3WLMA 4N9DA 1X6LA 4Q7NA 1OJTA 1D9EA 4MUPA 3KOXA 1UPMB 2GYIA 2PEVA 3GSMA 3LTSA 3CUFA 2C15A 5CC3A 1HNYA 5D9OA 3RCMA 3TYEA 5IDIA 4TU1A 4PMOA 3OOQA 2BVYA 3DG7A 3VIOA 1G94A 3HPZA 1VF8A 1OC5A 2BC0A 3OHMB 3B9OA 3FEMA 3DI0A 2R1NA 2R9ZA 1J0JA 3SN1A 3NZRA 2F8QA 4O1CA 4TV5A 5E09A 4ML9A 5HR6A 3WF4A 1NIUA 3WD1A 3KUMA 2P0IA 2OVLA 4NL1A 4C6OA 4WLCA 2PWEA 4ECLA 2GR0A 2C1GA 4EKJA 5FAGA 2E77A 2PLKA 5G5IA 1GZ1A 5E0CA 2XH4A 3A13A 1EIBA 3GLCA 1KW1A 2ZFAA 3FKRA 5DANA 1ADDA 4X0VA 3H2OA 3BARA 3GBDA 3L0NA 4G8TA 2FQIA 2DUAA 5DQPA 1PUDA 4KCTA 2W61A 4EMJA 1N5XA 2AQOA 2FZMA 4LX4A 1H0IA 3VINA 4IOTA 4QS5A 3EDJA 3I7RA 5E70A 2DP3A 3GW3A 1M6JA 2A3HA 2WMJA 3WDHA 1U22A 1TTJA 4Z1CA 3MVTA 1IXQA 4NG3A 3EGJA 1ZKQA 3HPFA 1NOWA 2I1OA 3KCOA 3FG2P 3AM9A 1M7JA 1N82A 3GHUA 4MB3A 1DE5A 2VC7A 3RM8A 1UUQA 1W8GA 1GRBA 4FP1A 1A5AA 5JH1A 3ITOA 5FS6A 3T07A 1YNQA 4GQBA 3NQAA 4TIMA 2A3AA 3GO2A 5A6MA 1R85A 3TNBA 3LHTA 3WZ0E 3GM8A 1QASA 1H61A 4KEVA 4RL3A 4CQDA 2NPXA 1E5JA 2QHAA 1XDIA 4JTGA 3AS2A 4LGXA 5CGTA 3NAVA 2VQTA 3W7GA 3TTOA 3OBEA 4DI8A 1DNCA 3SCSA 1I2OA 5CCZA 3UG4A 3EKGA 3VMNA 4H01A 5KMYA 2WVSA 1AA1B 3DDMA 4PRRA 3VIFA 3VUPA 2XM2A 3B8WA 2GR3A 3KRZA 3WD2A 1VBJA 3LLDA 1U83A 2DUZA 3TJXA 3H54A 1LWJA 3GU2A 2CKRA 2NUWA 2GUUA 3O6CA 2BWGA 4XWUA 3LB8A 1FXPA 3CMGA 3HTWA 5D04C 2DT0A 1KFKA 1O5QA 4R33A 1LVLA 2A79A 1JEZA 2PDWA 1QVBA 1QPRA 1VPYA 4Y7EA 3KM8A 4ORMA 3WH6A 5A69A 3FJLA 4ZOBA 1L6GA 2G0WA 2WVTA 4I7UA 1HL9A 2YCJA 1FECA 1D7FA 1H5YA 2YLLA 2OR2A 3AXXA 4JTRA 2JEQA 3W1PA 3LV5A 1ZL1A 4FAMA 2OLHA 1K4QA 1C8QA 1W2VA 2XN1A 2A3BA 1AZ1A 3OTRA 1Q4WA 4JTCA 1NDAA 1LM1A 1P6WA 1Z8AA 3SRKA 4G7EA 1XGEA 3OJGA 2E28A 1YPXA 3C8NA 3OU8A 2HTMA 2W9MA 1WNOA 5C55A 4FK9A 2DDXA 5LKYA 4GE8A 4XZNX 3C0SA 5HNUA 3OHIA 1TRDA 4JY8A 5E93A 1RP9A 1ITXA 1MZHA 2GL5A 4QITA 2YVJA 3RJXA 3BAXA 3T0TA 3ZJ8A 2P0OA 5BROA 3ZR5A 2PODA 3LM7A 3CZJA 2FGBA 1TMHA 3PM6A 2ZA1A 4AB4A 4CU6A 1XCFA 2DZWA 3G1XA 1GPFA 2WZEA 1CTNA 3WUGA 4IICA 3TJLA 4LUTA 1V51A 4AVOA 2Q6ZA 1BD0A 2C1HA 3NM3A 3QM3A 1GYMA 1ITUA 4W9TA 3F2DA 1XD0A 1NSJA 3N73A 4U3CA 1XI3A 1NWSA 3LSBA 1XM3A 4M52A 4EXBA 3IJ9A 3GAKA 1X8CA 2E5BA 2YCIX 1JCTA 3VIIA 5KZ6A 1MW1A 2VEFA 1E6XM 1LQ2A 4J40A 1SB3B 1V0MA 3POHA 1EWDA 1GOKA 3M0JA 2WCGA 4J2MA 4S2CA 2ZX6A 5F4WA 2PE4A 2PRHA 3TCSA 3BAIA 1UWSA 2GSHA 3F5LA 4WKFA 4JTKA 4JTTA 3GS6A 2YCLB 4HZ7A 4HSOA 4B9YA 1FHUA 2O9RA 3CWHA 5JIPA 3RU8X 1P6BA 1TG7A 2Y5SA 2CXGA 1J5SA 4IPLA 5IM51 5FS9A 3CHCA 4LCSA 1KM5A 3BE7A 1RLDA 5LNRA 2TSYA 2NWRA 2J3NA 3BSGA 4AXNA 3VKJA 3BC9A 2EPOA 3U6WA 1OFOA 1S2CA 5CBJA 1BWCA 2A85A 5AZ1A 3RFAA 3QR1A 4CVWA 1TB3A 2I5IA 2OZ8A 1M7XA 4EACA 2VL4A 2DVUA 2NXIA 2XFFA 4UTWC 4CQ9A 4L4MA 1TYGA 1LLWA 5HMEA 4JX4A 3MTWA 4KERA 5L9FA 2JKAA 4JKKA 4KFOA 3GRSA 1EJSC 2QS8A 1ITQA 4LA1A 3CWNA 5AHMA 3T0CA 2PRMA 1DJWA 4M3PA 4GBUA 4J3XA 1DXIA 3FIGA 4JFUA 3NQ6A 3WDPP 4L7ZA 5AYXA 3T40A 3MP5A 2PRLA 4D6EA 3E2RA 1LCOA 4TX8A 5FJUA 3NL2A 1BLIA 2OWWA 1LROA 4S3KA 1YHTA 3DK9A 1QAPA 2WNQA 2ADAA 3Q2DA 4G6CA 3TYDA 3WH8A 4QJ3B 3EEGA 4ZR8A 1BKHA 1G7VA 2CLHA 3FK4A 2PD9A 3TAOA 1TCDA 3D46A 3SCWA 1P7TA 5DMNA 1VJSA 4YN5A 3LPOA 4FSAA 4O54A 3MJMA 1E0VA 1ONFA 2ACRA 1O5RA 2PD5A 3RAOA 2XIMA 4NU7A 3AYVA 3N15A 1IT8A 1KGXA 4EQRA 1KWKA 1XKJA 1IWAA 3S2MA 1Q65A 4NHVA 1ZDLA 1FCBA 2QCDB 3MSDA 4LW7A 3LXAA 4NJJA 3QGAC 3A9IA 1D2KA 3V16A 5JH2A 4F3HA 1JNDA 3Q37A 5AHFA 2PLMA 4AYSA 3T8QA 3H2CA 3L8KA 4YWIA 4C5YA 1UOZA 4XKYB 1F8MA 1W56A 1T8XA 3L5MA 4FDCB 4WJXA 3RITA 1P0DA 3M5YA 4GYFA 3L23A 1HN1A 2HMCA 1SFLA 2BLEA 2JK6A 3TAKA 4GC3A 3W83A 1K03A 1SW7A 2X50A 3TTSA 5U4NA 1KGWA 3M16A 1E6NA 3P2VA 1K7FA 3WFZA 1DPMA 3LENA 4IXXA 4B16A 5A6LA 1LT7A 1RBLA 4NSBA 4AZIA 3HPSA 4DNHA 2FIQA 2IUZA 3ITCA 4IL2A 3ZWSA 2JF7A 3RLHA 1ONWA 2O56A 2HPIA 4FOUA 2IXVA 4FX8A 3BLIA 2RUSA 4L6DA 2FJUB 1IXOA 2WW5A 3PG6A 5HBFA 3CWOX 2W55A 4EQWA 1OFAA 3LHZA 4EANA 6TIMA 1QNPA 3VDCA 3N12A 1VLIA 1WPCA 3IRSA 2ON3A 1FDZA 1VPXA 3TWBA 3M64A 4K1WA 2EPHA 1AW2A 1S1PA 1XBXA 2Y61A 4HNOA 5JCNA 2YW4A 4DJFC 3QSRA 4GYKA 4WY0B 3W72A 4AX6A 2J78A 3MBDA 4LYRA 4Y96A 1PWLA 2QF8A 3S0CA 3VNDA 4ACZA 4Z2KA 3BLOA 4A8IA 1B3OA 4S3JA 1XR2A 5CZTA 1ZBKA 1FH7A 4RKAA 3GC4A 4HQVA 3NTYA 4GQRA 2ISSA 3ZT5A 4QSHA 1E6SM 2OOGA 3ITGA 4DJDC 1S5MA 4M6PA 2BZNA 2VFFA 3HMJG 3EWDA 3CPRA 4LBSA 2Q8LA 1W9PA 2NT0A 3NO5A 4MLJA 3ZR6A 3LXCA 4HPHA 4XIMA 1X1NA 3SQPA 4US6A 3TYZA 1EA9C 1MEIA 1A5KC 2X09A 1HT6A 3L67A 1FUYA 1VIWA 3GIQA 3IARA 5JCKA 4P8UA 4X2PA 1J2BA 5AKQA 1XQKA 4I9TA 4S23A 3O0KA 4NIRA 1CYGA 1DVJA 1CXLA 4GI4A 3EPOA 3MHFA 2VUNA 2VX6A 2EJAA 3GDTA 5D2TA 2YCLA 1DHPA 1C3FA 1F6KA 5AVHA 1CW2A 3NL3A 4PULA 3EX1A 4MTVA 2TODA 2Z27A 3ARUA 1H62A 4UQEA 5DX7A 3S4TA 4AYGA 1KN0A 4HD5A 3QPEA 2FTWA 1OC6A 3O9NA 1J6OA 4H3DA 2QAEA 1VPQA 3KZSA 3MZNA 3D5HA 1OFQA 4R9XA 1ICSA 5AHEA 3TXZA 3MI2A 4AZ5A 1G5AA 1I8JA 2WWCA 2DH3A 5BRBA 1JRPA 1LL7A 1W1TA 1Q3NA 3AXMA 3LNPA 1YNPA 1OCBA 4HYRA 2DZXA 4U10A 1EP1A 4AWEA 3HQ1A 3KTCA 4O15A 5HPOA 1JPDX 1DJQA 5AECA 1BF2A 8CGTA 4HZ6A 3N1AA 5JU6A 2CZEA 2OT1A 4J56A 5F1VA 4L9YA 4ZFMA 4OU1A 4PYSA 4ZQMA 4GQGA 4O1AA 3TTYA 4INFA 4DXXA 3QR0A 2O7QA 1AQFA 3PK7A 1XPGA 3WFLA 1WKDA 2D0GA 3T8LA 3R5EA 4JYDA 1HVQA 3S5YA 2JIWA 3RLGA 3IEBA 4QLLA 3CTLA 4H4RA 4PA8A 1QNSA 4QE1A 1HIZA 3L9CA 3WQ6A 4NVTA 5D8WA 2VDGA 4DUWA 1NP0A 3S9YA 3WSUA 4PB5A 2WHKA 2DUXA 3QXBA 2PB1A 3GQYA 2V2CA 3M4HA 4FOJA 2R82A 3VXGA 5A8GA 2CDUA 1U5HA 5G2HA 1OK4A 4GISA 4RV3A 2QCDA 1PX4A 1W3NA 2BV9A 4L80A 4XVEA 4REQB 3VKAA 5G1YA 3HW2A 5I5RA 1L2QA 1Y5VA 1G4PA 2Q09A 1QOQA 4XKYA 4N2YA 2V69A 1DJXA 5I3FA 1QRQA 3U0HA 3W27A 1AMYA 2V3GA 3UR5A 4C7FA 1D3GA 3ZLFA 2VRJA 3VAVA 4PUEA 5AC8A 4NXKA 4OOZA 3KOYA 1H3GA 4RLIA 3TYAA 3CM4A 2YPIA 3PSWA 4TTGA 3HMCA 3FKKA 2XIOA 4JD4A 4JFWA 2CBIA 3M0LA 4NZCA 4GACA 1B5TA 1XUZA 2ZTKA 2VUYA 3QZ6A 3UPWA 4F9DA 4IWWA 1IGSA 1EBGA 3LSCA 3WQDA 5T9BG 3FXGA 2Z1VA 4GGHA 2DVTA 3WUBA 5D30A 1PIIA 5CG0A 3NVWB 1Z48A 1N2VA 1MVYA 4N0RA 3GW0A 3CL7A 2ZIDA 1XV8A 2R94A 4D6DA 3VNMA 4CU7A 1D8CA 4PEEA 1EC9A 3LMZA 4TVCA 3IV3A 5I6SA 3P61A 3H4KA 3SCTA 4GYJA 5CKSA 5L6UA 3XIMA 2W5FA 3M5ZA 2X8GA 1OBAA 2BOEX 1CXFA 1UWAA 3GAYA 2R9RA 4CN6A 2ZCGA 3MMUA 2P88A 4UNLA 1PO9A 3ES7A 2OKTA 3VIKA 2I5GA 3PPHA 1ZHAA 1DWHM 5IRPA 4L1XA 3RX2A 1SM9A 1WBHA 3N14A 1UD2A 3BVJA 3PUEA 3QEZA 1O94A 2GRTA 1OHLA 4JN8A 4HT3A 1W1ZA 4LS0A 3AIBA 4E8CA 1MOKA 3AU6A 1FWDC 2XIBA 3GH7A 4AEFA 2DW7A 1AVAA 1E4NA 3V4BA 3MVIA 4Q4RA 1MFVA 4AHQA 3GHSA 4GA8A 1LQ0A 4E4UA 3WLTA 2VYOA 2QDEA 1ZBCA 2JQXA 3MPGA 4DF2A 3E74A 1I1WA 1J9YA 4MB5A 3NZGA 4KEUA 3MUY1 4AH7A 5LA0A 5AHLA 2FHBA 4NQ1A 3MJYA 4UTWA 3N9RA 4M1BA 5FIPA 3SN4A 4GOAA 3IUHA 2D3NA 4QG9A 2XH2A 1TMQA 4UMBA 4KEZA 1NJJA 1ZJBA 5A8PA 1TVNA 1KGUA 4PTNA 5HNRA 3CIXA 4NASA 3DECA 4MGGA 4Q4KA 3BAWA 2AAAA 1EWEA 2CLEA 3SQMA 3NO3A 1OF6A 3GRTA 1XQLA 1IZKA 4IUOA 3VKCA 3P82A 1GT8A 3IJLA 4AG0A 3RNMA 1NELA 5GVJA 2ZA3A 3STPA 1DXFA 2PCEA 2QUMA 1VBGA 4J3SA 3E9AA 4H41A 3SRHA 3VKBA 5G1TA 5CPLA 2XVKA 4GQ0A 2BX7A 4G9PA 4XTDA 4A29A 4AC1X 3GWQA 3T4CA 2OLAA 4Q7BA 1JOAA 3IGUA 1XHCA 3EF6A 1TPDA 3EB4A 3TR9A 1A5LC 3L4ZA 4LB4A 3CPUA 1EP2A 1Z69A 2VWTA 3O6DA 3W87A 5T8GA 4CQAA 1DJYA 1GTHA 3EB3A 4UFHA 5CBIA 4F0SA 4CQ8A 2R1LA 3URHA 4O1FA 3BV4A 5C7HA 1UD3A 3N11A 2DSVA 4GVIA 4AD5A 3WUFA 1CNVA 4M6UA 4DUXA 2EPLX 5I00A 3P5ZA 4NJHA 3H70A 3PNUA 3II4A 3GFXA 1BTCA 5JCIA 1VD6A 3H24A 2VKZG 1PJ9A 2EQDA 2E6AA 2ZE3A 2WBGA 4XK2A 3S5ZA 5FAJA 5HQMA 2VC9A 3B9JB 2HE8A 3M0KA 1K77A 2E8YA 1F9CA 5EBKA 3R11A 4JEJA 1UR0A 2WHJA 1BRLB 2GJPA 3L5AA 3DZ1A 3TE9A 4RZBA 4G2DA 3ARVA 4HPJA 1R87A 1RBOB 5EKYA 5FJIA 1IEWA 3MCOA 1A47A 4HJFA 3PHAA 5C54A 2E6YA 4REQA 2QZRA 1W1YA 3DFPA 4DNAA 1XLLA 3T9PA 1OFDA 4HNCA 1MRQA 1Y5XA 5DFAA 1MXDA 2WKLA 1XLJA 3ISIX 5I77A 4RXGA 1C8XA 4HSHA 1K7XA 1I0BA 2J77A 3HGRA 5AB3A 3HPAA 1ZENA 4IJBA 5EU9A 2QPUA 7XIMA 1UHVA 3EDEA 3B04A 4WOZA 1AH3A 4DJFA 3N29A 2CU0A 2A3CA 2PGEA 1LUCB 1UH3A 1O5XA 2Q8XA 2BVDA 1B90A 4P7LA 4DUVA 3A3XA 4UFJA 5TQLA 3NQBA 1A4MA 1VBHA 1ZB5A 3L65A 1NHRA 4ALDA 3DIPA 1QPQA 4LJ3A 3FA3A 1XSKA 4PZVA 3CEUA 2XG9A 5D9NA 2QDHA 4AD2A 4NJGA 3ZSSA 3TN5A 1DIOA 3G1FA 4LUYA 1UW9A 1EH9A 1S38A 3HZ3A 4HNLA 1XD1A 1IEQA 3PF3A 1KXTA 4OUIA 3OQ8A 1GRFA 3N2TA 1F4HA 3OW1A 4IFOA 3B8VA 1ISXA 4HB7A 4DELA 4UNIA 1PIGA 5CZJA 1E9ZB 3VD7A 1QTWA 4BEUA 4Y6GA 3E38A 1H2IA 3LXBA 1A3HA 2W66A 1IZCA 1QATA 3NZ1A 1SO6A 1JL8A 4QE4A 3B0UX 1TV4A 1V7YA 4JQAA 3OA5A 4MY9A 4JX5A 3CO4A 4XZLX 4XZMX 4MJMA 2X0YA 3ZOAA 1JROA 4AZBA 3TMLA 4NX0A 1S3TC 4C6DA 2BASA 3G1RA 1RP8A 1UYQA 3BAJA 1TV3A 1A49A 1WDWA 7ENLA 3PJXA 3KXQA 4MHBA 2BVTA 2OGJA 1DQXA 4ILSA 4BV6A 3RUBL 4N42A 3NDOA 1C7TA 4JNYA 4ERGA 1JF6A 3GVGA 3W6YA 6REQB 1SZEA 1YX1A 2Y4SA 4FXSA 1LLOA 1MUWA 1YPIA 3W02A 4HP5A 2GUBA 3CAQA 5LXEA 3HPXA 4XIAA 1AUSL 5D05A 1F76A 5XINA 3BLLA 3HG3A 2DSUA 4NZ1A 2W91A 2PWFA 2BHYA 4TV6A 2JF6A 2VEKA 1R3VA 3AIWA 3W1QA 3O7UA 1CXKA 4IMEA 3UWQA 4DO4A 3FHQA 1JDEA 4DLMA 1KQYA 2WLZA 1JDCA 4KS0A 1TRIA 2FH8A 4PUDA 2BMBA 1Q2SA 2D2HA 4ICMA 3A21A 5I02A 1MW2A 4YCOA 1F61A 3LEPA 1W32A 4NNBA 1EKOA 4E4PA 2VEIA 4HNUA 4UTKA 1FRBA 2DZAA 4OVXA 1GHSA 5A8OA 1XLCA 2XM1A 4Y9MA 4CUCA 5GPRA 3GIPA 1PBGA 3UXIA 3RNDA 1ZBVA 4EAMA 2GSJA 5EMMA 3GNDA 3B05A 2DZUA 5HJLA 4AVNA 1BQCA 2WSKA 1SFTA 4QM1A 1KO0A 1CGUA 1HKIA 3LQGA 3P3BA 1RQBA 4QNWA 3H2NA 1ENUA 3CUIA 2FMNA 4ONVA 1Y0EA 2OFJA 2NW0A 1GKPA 3UU0A 1LL4A 3W7CA 3T81A 5F2MA 4FIQA 1TE6A 3CQIA 5HWNA 2L5HA 1XIMA 2TYSA 1TJPA 2ZZ1A 1CB7B 2J9XA 1OIMA 1RR2A 3SY5A 4WKHA 3AXIA 4PSPA 3UT0A 1QPNA 2OSWA 4KCWA 1HZYA 4I5RA 3BANA 2AL1A 1MNSA 3WD3A 3C0JA 4X61A 1TPVA 3FAXA 4EQSA 1QFEA 2G5WA 4HYVA 4K1GA 1BRLA 1BWLA 4GIYA 4GFIA 1P6CA 3S6DA 1OY0A 3M5XA 1E55A 2PDKA 3ENLA 3W1NA 1DWIM 3H6OA 4LEFA 1A0DA 1XRTA 3WF0A 4F40A 3ERPA 3PG9A 2JKPA 3P80A 3W85A 1TCMA 4HMCA 4AZGA 4PTMA 4C6JA 4L6HA 1L2UA 1PV8A 3W24A 1VH7A 4XQ6A 4B5XA 1F6YA 3HIJA 1RCQA 4MJ2A 3GG7A 2Y7EA 1KRMA 3CUXA 2QCHA 4ZZ9A 4WHBA 1GVEA 3W84A 4GWEA 2QV5A 1V3KA 1T7LA 3M44A 1E4LA 1EJWC 1Q2RA 4JQ4A 2GQWA 5A8NA 3CT7A 4GX8A 5E6YA 3C6CA 3L12A 1UG6A 7A3HA 1GVIA 1J6PA 1SJAA 4H8VA 3CUGA 1GKRA 4MUZA 4DM1A 3G1DA 4KFNA 4YHGA 3PZUA 1PCKA 2ZDRA 4Q8WA 4JQ3A 4H4SA 3DXIA 1LUCA 5CJ5A 2PC8A 5FKYA 2R24A 5CXPA 4IQJA 3AHZA 3URQA 3JZEA 4BQ2A 2KX9A 4KRTA 2CKSA 2WO5A 2EPMX 2XH0A 4Q4OA 4A22A 4GK8A 4J4KA 4W7WA 2NQJA 4EMIA 3BOXA 2OCZA 1FWTA 3CS2A 4KGJA 3IAQA 1GVRA 4UR9A 4ZXOA 1KM1A 2E5DA 1NWUA 1WZMA 4EM3A 1NHPA 3B9EA 3PPGA 4RNHA 3KCLA 4LF1A 1T99A 4DQWA 5ABGA 1EJUC 1JULA 1GEUA 3JVAA 3VM5A 4JTQA 2E68A 1D8WA 4WEVX 3LUTA 3TNOA 1WOAA 3QW3A 4FZIA 3WYZA 1S2TA 2ACQA 1PE1A 4XZIA 4D6FA 3MZ2A 4JHMA 1WA3A 4R7WA 4UC5A 2C6QA 1KTBA 1AMKA 3GNRA 2YXOA 1E40A 1B0IA 1DTNA 1T8QA 1NTHA 1V02A 1SW0A 3N04A 1MMFA 4LRSA 3CGDA 3QPZA 3ZLHA 3BDKA 1J96A 2XIJA 4DVOA 1H11A 3LADA 3N9SA 1GRHA 3W4RA 3KFTA 3E12A 2ZZCA 5CZ0A 3LBMA 1EX5A 1H50A 2NV9A 4X22A 1DORA 1KBKA 5BWAA 2HWGA 3INPA 1TV5A 3KDOA 3LRLA 3DBPA 1ME9A 1VCVA 3CZEA 3F4NA 1V0LA 3ANYA 4JTLA 2E6DA 3ALGA 2HEJA 3LLFA 1D7YA 2OPJA 1EUNA 6REQA 2Y7FA 1OGGA 4DHGA 4TX9A 1BYDA 3BURA 2D0FA 2O9TA 2WQPA 2E6FA 2YZ5A 1JZ4A 1TWZA 3RCYA 2QJGA 1SZGA 4FLOA 3V35A 3WF3A 2G3MA 2NV1A 4X9YA 1LG2A 2XISA 3M0IA 3NVZB 3M1ZA 5LHEA 1AL7A 1GV4A 2ZRYA 1VYSX 1CECA 2ZZ7A 1KCKA 1X96A 3GYCA 3FS2A 3VDHA 2QUVA 1KM4A 3H55A 1B3WA 1JZ3A 5EGRA 3VC5A 1QJWA 2DT1A 5BOFA 2ONEA 2X1TA 4LVAA 3HO8A 4J2PA 5BW6A 4NEWA 4HHMA 4ROPA 3NQEA 1UD8A 2VVSA 3V5OA 2XIIA 2A7NA 5CSSA 1S5VA 5HWJA 3ZVHB 4KCVA 2VHLA 4QEHA 5F4SA 2BY0A 1H60A 2HK0A 4C91A 2JIEA 2BB0A 1Z89A 1OGBA 3TC3A 3FYOA 4ATDA 3N25A 1UA3A 4WGXA 4PSRA 3CZLA 3DFNA 2YB1A 3IIOA 2SFPA 3APYA 4CD4A 3QYSA 2E09A 3AWNA 4MWAE 3VNYA 4BY3A 1MSSA 3KVLA 1VFLA 3SFWA 3B0PA 1XSJA 3MMWA 2QCGA 7PTDA 3Q4DA 2ZE0A 2WC4A 4D6JA 1FWNA 4JTEA 1V6VA 6XIMA 4UUIA 2YW3A 1XIJA 1XBVA 2ODOA 3HG5A 3MS8A 3PBGA 5JCMA 4PBEA 5DT5A 1QI5A 3W71A 4IIFA 4BF9A 2PDMA 3WQPA 1OJXA 3CYVA 2DZVA 3L0GA 3CL8A 1XCXA 3S9ZA 2FPVA 4ATWA 2C3CA 1IR2A 4H2CA 5BWFA 1Q7QA 4Q22A 1ZU8A 4Y90A 1XIDA 2OTDA 1JI1A 5DELA 1B4EA 2NLYA 3CC1A 3NYZA 3PPFA 4NYYA 5K2ZA 2NX1A 2XSXA 3GVQA 3NVDA 3TYUA 1US0A 2VT0A 5EMJA 4BQ5A 5GNZA 1FFRA 4FB7A 1X2GA 3KOWA 4C7GA 5E0KA 5FEPA 3D0CA 1Q45A 3PJWA 1ZTVA 4RJEA 3WK2A 1UZHA 2VFHA 3QKEA 4OOUA 2GQ3A 3R89A 5DBUA 2XTKA 2J8TA 2YCKX 4F0LA 4ZL1A 1NEYA 4MKSA 2YL9A 4W8LA 2WPFA 5FF2A 4LNYA 3WLIA 3OC4A 4TX6A 4LEQA 3FVDA 3U9IA 3DOPA 1JYWA 4O28A 3DEQA 1SR9A 3HV9A 4HOZA 3W82A 1H49A 5IHSA 2QYGA 3WEMA 1US3A 3BGJA 3VPLA 1ZX9A 1J93A 3UQNA 1LLZA 1EDGA 3CZGA 2F2HA 1NFPA 1U5JA 3BJSA 4JN7A 2VGBA 1R86A 1RQEA 4HMNA 3BICA 5AYIA 2QAFA 4XAPA 1V6YA 2CLFA 3AWOA 4XD3A 1A5SA 4LT9A 4HGXA 4BWLC 4ADSA 5CPTA 2Y5EA 4B5WA 3AZTA 3DGBA 1H1YA 3EOEA 2H9AB 3W0KA 3W28A 5KZEA 4QJ4B 1GSNA 5FS7A 1W5QA 3GTFA 3THDA 3NQ7A 4E2OA 4AY8A 3HOJA 4JFSA 4N02A 5A2AA 2J9YA 5AC5A 4K37A 2ZXQA 5B80A 1XC6A 3L4UA 1X7IA 3DU0A 4B2DA 1B57A 1XICA 1TVLA 4KWSA 4LVBA 2YJQA 4C6IA 1EPVA 4NILA 4LAOA 5E9XA 4IG2A 1M04A 4QEEA 1JFHA 4JCLA 4AIOA 4S38A 4V2XA 3R79A 1ZP3A 2DT3A 2FYMA 2Z24A 5LIKX 1HKKA 1C90A 4NAEB 3TA9A 4D8AA 3W7IA 4ATLA 3LV6A 2V5DA 5CAHA 1X1OA 1BSLA 1F4AA 2OEMA 4WUIA 2KAUC 3M43A 3NVVB 4I9AA 1W3LA 3ABQA 3UESA 1KCXA 1SFJA 2P5NA 2WBAA 1ISZA 2FHFA 3KLJA 1ISWA 1H7WA 3O6YX 2DT2A 4GXPA 4JTFA 3DFYA 5M1TA 3IRDA 4H4WA 2C71A 4WRHA 4RR4A 1E1CA 3L66A 4WX2A 1KM6A 1JCNA 1S5TA 3DERA 3VIPA 4HU4A 5BOEA 4QSFA 1TX0A 3N34A 2VCAA 2CXEA 3PUGA 3VZYA 3UXLA 3FDGA 2POZA 4Q4QA 1GREA 2OX1A 3WNKA 3WNLA 3C4UA 4OV4A 1E0UA 3MSYA 4JYEA 3UFYA 1S2WA 1LRNA 1OQFA 4PMRA 3PZ9A 1WQ5A 4H7VA 4EM4A 3W1LA 4E8GA 2V81A 2BHUA 4DYKA 1H7OA 4CEXC 1OM0A 4RE2A 3NL6A 4YTRA 3VMPA 3VOJA 5C9WA 4RXFA 3CH0A 5BMXA 1KXVA 4LS1A 3OP2A 3GG8A 1JYNA 1U2YA 4GI9A 4JFTA 3SR7A 2BOGX 4I8DA 1EOKA 1XUUA 5D02A 4GRTA 1W0MA 3EPNA 1HQTA 3URNA 5K9CA 1GOOA 1G7UA 1QW9A 3WY1A 4KF1A 4AWSA 3NVTA 1IZJA 4ZOHB 3L4WA 1FQ0A 5FEXA 2PDQA 3E5BA 3NEHA 5HMFA 3BSMA 3WJYA 3AUOA 1V3JA 3D3AA 1QW7A 3C56A 4PCFA 3MT1A 3DESA 4X0NA 2ZWYA 5REQB 3T6CA 3N2CA 2PDPA 3MP3A 4ZB0A 2UZ9A 5HK4A 1T5AA 1W5NA 4Q8UA 4O11A 3OVQA 3A4XA 3SAZA 2HBXA 3LG3A 3T55A 4AD1A 3SO7A 4A3YA 5KVIA 5D33A 1NWTA 4JIIX 3A24A 4YYCA 2G3FA 3EUB3 2R6OA 1QW8A 2C8NA 3GXPA 5F4XA 3B97A 1AQ0A 4UR7A 5D9MA 3RG6A 3VCRA 3EMCA 3W1UA 1GEQA 3I3BA 2W6RA 1QO2A 5DMMA 3AICA 3MI6A 2WZTA 5LIXX 3TUUA 2BG5A 3TQ0A 1OD0A 3WK1A 4DZAA 3OZMA 2F61A 4EX4A 3QF0A 4TMBA 4R27A 4U28A 4L65A 2E67A 3RM9A 3VD4A 3W81A 5CZSA 4HU3A 4R88A 2QT3A 1BGGA 3M5VA 3OO2A 1WAWA 1B3ZA 1LRTA 4ZEPA 3VIMA 1AK5A 2BP1A 3GK0A 3GU1A 1A53A 3VM7A 4MB1A 4M5PA 4W86A 5KZMA 3G5EA 3VYLA 1RM6B 1RJRA 2A1YA 3ARPA 2PWHA 2FJKA 4R34A 2YA0A 4GUGA 1Z3NA 1CT5A 3KW3A 1SU5A 2GQ9A 1V77A 4NP7A 4IMAA 3PN8A 5H8UA 5A95A 3NGFA 3U4FA 2Y70A 2V3FA 3ARSA 4R7JA 2QUUA 4HTBA 1EYWA 1UROA 1V7AA 2EQ6A 3PZMA 2YDRA 5AYYA 1KFWA 4PTVA 4LVFA 3MDUA 4GLEA 1EL3A 3PTDA 4GQQA 3W37A 2FZ8A 1HKMA 4JXCA 4J3ZA 3WDQA 4MDOA 3V75A 4J7RA 3F1QA 2PDHA 3W7RA 1E6QM 1WYGA 3AS0A 5EB8A 3W74A 1Q85A 3EAUA 3LHVA 4MY8A 3TFCA 1M6IA 3CAVA 1XYCA 2XJ7A 5JBEA 5C71A 3T2OA 2H9AA 1E1EA 6ENLA 2GPTA 3UG5A 2ZX7A 1H4PA 1J10A 2J7EA 4UTTC 3ZIZA 3U57A 1KXHA 2WMFA 4POCA 4P5UA 3S2LA 3R10A 4H4IA 1SFSA 3KBSA 1NPXA 3LB0A 4ZQRA 1TPH1 3AIVA 4PB4A 3LHYA 4H4QA 1DJGA 2IXUA 3SCUA 1XHGA 2NVDA 4ZQOA 2GFTA 4QXIA 3FW6A 4RNIA 5FA5A 2VO5A 2Z2UA 1GPWA 3T2PA 2FPYA 4JIQA 2CHRA 1KBLA 2WSPA 2Z6IA 3RDKA 3F4CA 1E51A 1HKJA 1E72M 3QOMA 4WD0A 3NZPA 3V36A 4WSJA 1XISA 2NQZA 2ABAA 1V8EA 3ZQ9A 3C86A 4FNSA 1HL2A 3CV7A 4IIHA 3BCFA 9XIAA 3QBUA 3N13A 3C3UA 4DXKA 1J0ZA 2HQAA 5DRCA 2WCSA 3HJEA 4E4FA 3SR6B 4UOZA 1TPC1 5T91A 1GRAA 4PL1A 1YW1A 1F8IA 4Q33A 1FO4A 2E3ZA 1GERA 3VD3A 3R25A 2QXWA 4DRSA 4O17A 4WY0F 4OTKA 2D22A 3EX3A 3SY8A 4M6VA 5HOSA 3V5CA 3WH9A 2Y8UA 3AC0A 3AHVA 4WXZA 4K36A 2BVWA 2WPGA 3GVRA 1J18A 2PWGA 2NLIA 1DL3A 2B7PA 3CGCA 4BZYA 3THCA 3DG3A 2YOCA 1FVPA 3OLGA 4HCHA 3WQFA 2EKCA 2Y6ZA 2HISA 2OWCA 1F74A 3CEPA 4FMVA 3LTPA 3H4WA 1HJWA 3GTIA 4GVFA 1V3HA 1N60C 5HDRA 1RV8A 4H4PA 3BQ6A 3AO0A 4WR3A 3VCCA 2C1IA 2PTWA 4NX5A 1AH4A 3R8HA 2V2DA 3FSTA 3B03A 3K5XA 3G24A 4DPPA 4A8RA 2D20A 1GKQA 2WPCA 4UFKA 3QMSA 1YTEA 3WQCA 3WNMA 1HO4A 1BQGA 1WDRA 3SN0A 1UKPA 3MA8A 3MMDA 3I7SA 1UR9A 3UXKA 4YHEA 4WSHA 5ECVA 1EDQA 2W0HA 4RW5A 3UA3A 3UVAA 2EG6A 3O15A 4HBKA 2Z7GA 1UH4A 3CQJA 4OIFA 5CGQA 5C9XA 4Q8PA 4IF2A 2WOWA 2GGJA 4G1NA 2XFYA 2DZBA 2XU2A 3C3NA 4K3ZA 3OGSA 3MB9A 1KBIA 3UA4A 2J75A 3QKZA 4A8LA 2Y1HA 2X30A 3PPCA 4G56A 4LAUA 4M80A 5LYRA 1LRQA 3PZOA 3W86A 1VFUA 2EJ1A 4E2BA 2PDLA 5GNYA 3IPWA 1GETA 3I3EA 4LYKA 2W67A 1UQYA 1J0IA 3T44A 2QNEA 2QULA 2VP8A 3QY7A 3T09A 1PTDA 4UFMA 1GUVA 1HJQA 1SJCA 4ZO8A 5FJPA 3SECA 1C92A 4DF0A 2WC3A 1YYAA 2XFWA 2OQYA 3AIRA 3EDDA 2EQ8A 4GVHA 1QNVA 1UWTA 1TJRA 5HMSA 3PWGA 4FXJA 3E2QA 2OWXA 2VURA 1TIMA 1QK2A 2RFGA 2Y63A 2WWDA 1Q6QA 1UIPA 4WDXA 3UZXA 2FLIA 4BWLA 3K4AA 4LOCA 3HG4A 5C2GA 3R58A 1FIQB 2V38A 1X2HA 3THQA 3L4XA 4H4YA 3W2NA 5I7GA 1JCYA 1SW3A 2V68A 2X1IA 3BMVA 2OB3A 4K39A 2PLCA 3EXSA 3CQ0A 3DFHA 2X1RA 5AYZA 4Q8TA 1HTIA 3RLVA 3URBA 3URAA 4K8EA 4TTUA 4FR1A 1YNYA 3S1GA 4O0ZA 4C6QA 4KQNA 3LRMA 2NT1A 1W1IE 4O8AA 3NXLA 5HUPA 4NUWA 1W9XA 2Y7DA 1WUFA 5TIMA 1BG4A 5FESA 1G1YA 4IPPA 5C8BB 2ISVA 3QLLA 2YDSA 4OKDA 4LUJA 4JAWA 4HU8A 8A3HA 3QQ1A 4J27A 3VD9A 4FPSA 4ZB5A 3QSTA 1F3XA 1O66A 3WG6A 2X0SA 4AW7A 2EQ7A 1UC5A 4C6MA 2YYUA 3A5VA 3DFSA 2Z7KA 3H4GA 1O60A 3CIWA 2CYGA 1OT2A 1W1A1 4C1LA 3SQLA 3ZO9A 1UB3A 3VCNA 1NOFA 2GK1B 3PBYA 3WIJA 3B8UA 4PMJA 1MRAA 1E15A 3M0MA 4EQXA 4KFPA 2V63A 4H9TA 2BY1A 1EIXA 5T9CE 2EPKX 2MANA 1ESWA 4I90A 4JL2A 1CWYA 2X40A 3CUZA 4FS9A 4YTUA 4I7VA 3VIJA 2FZDA 1RALA 2HVOA 2XWEA 2VR2A 4BF5A 1QXLA 4A3QA 3L2IA 1EJXC 1E6ZA 3ZZ1A 2D2JA 2Y89A 1JI2A 3IWPA 3VDGA 3PZTA 4AMAA 4LY4A 3N3MA 4H6KA 1P4CA 2HVMA 3LERA 2NQHA 2P8BA 3NQVA 1AD4A 1SZRA 2O55A 2J4GA 3CIVA 5GNXA 3KS5A 3NDZA 3TQVA 1JUBA 3W7JA 3W1MA 3WQGA 5EMUA 3OLDA 3K2GA 1V3IA 1R3TA 2X42A 3PC0A 1BWKA 1KLZA 2HPMA 4ADWA 1XLEA 3NDYA 1WDQA 2DZPA 2ZUNA 2BSLA 1TZ9A 5G2WA 1B31A 3BLEA 3EX4A 5B7YA 3WL1A 2TRSA 5K3VA 5EYWA 3WBAA 3V7PA 3REQA 4D1JA 1QI4A 1TPWA 1POKA 1H1ZA 1GYNA 4Y9OA 4IJCA 4GYPC 1GQKA 2FKPA 3GZAA 1US2A 4E6MA 4MWAD 2EG8A 3TWAA 1TV2A 2J7DA 4GD0A 2FHCA 3UZZA 5F1UA 1XYZA 2Y7GA 1ZAIA 4S3CA 4ZCWA 4MNMA 4CCCA 5FF7A 4OT7A 4LC6A 3U8GA 3KWSA 4OUEA 1EGMA 2FGZA 3GD6A 2PURA 1Z7AA 1G69A 3VGBA 1UCWA 4QQUA 1H0GA 5GQBA 4FX6M 4KBXA 5AHIA 1E0XA 1XYAA 5HINA 1S2UA 4Q8OA 3ARZA 2V3AA 1Q6DA 2PBOA 3MC5A 2W4XA 2VJXA 4PL2A 3C2OA 2ZXBA 1DBTA 2PDFA 5DMLA 3W70A 1AQHA 3VI2A 1JYXA 3AQUA 4MY1A 2W63A 2GJNA 3K30A 2BC1A 4S3EA 4UWMA 4IIDA 3TA6A 3VNZA 2OEKA 4Q6JA 1Q63A 3EKLA 1DIDA 5DY2A 1GYLA 1KFCA 4N9BA 4K7VA 3II1A 3OVGA 1QU4A 1VJZA 2UV8G 3VE7A 3STCA 3NVYB 3ZLGA 4I3GA 1QBAA 3RRXA 1HP4A 1AFSA 4QX4A 4HNVA 4QCEA 4E2VA 3R94A 3P6LA 1MZRA 4IFKB 1JZ5A 4O19A 2P3EA 3PBWA 3QZAA 1OFEA 3DJJA 3KL3A 2A8XA 3QC0A 1K4GA 1NQ6A 4ZQCA 2PWVA 3EEZA 3EWZA 1ZP4A 5EFFA 3RO6A 5HUOA 3I4EA 1XLHA 4NJIA 2OODA 2EXOA 3W75A 6ALDA 1BVWA 2UY3A 3CUHA 1WCGA 2QDGA 3E0FA 2W3SA 3A4AA 4IIEA 3H22A 4Q6XA 7REQA 1I9CB 2E3TA 3USBA 2CC0A 4ADUA 3WDRA 2CITA 1MXGA 1YE4A 3BH4A 1GGOA 1PZ0A 2QGHA 4IX0A 4FX9A 2NVKX 4ASTA 3O16A 4M51A 4UTTA 3E0IA 1FWBC 4CVUA 4PUUA 1FWEC 2VR4A 4JY9A 4I6VA 1SZNA 3LCFA 1FEBA 3SRFA 3PZNA 3A6OA 3LCHA 2OEJA 3HBLA 2BS9A 4A4AA 3HU7A 3W7OA 1VBRA 3DHDA 3OZOA 3W1XA 3DFOA 2HE5A 5CLWA 2W92A 4XUYA 5SWUA 1F3TA 5IBXC 1DIKA 4Y8FA 4DN1A 1YXYA 4LXFA 4BCEA 4OE7A 5ABFB 4GZ7A 3NS1B 3NO1A 1JCLA 5BYWA 1F3EA 2I9EA 3HA1A 1P1MA 1IQ8A 3MO4A 1RZMA 4UFLA 2O7SA 3DX5A 3CXBA 3BG9A 5TNVA 1HJVA 4LPCA 4AWTA 4YNGA 2W62A 3AMCA 4AZ7A 3LQLA 3AJXA 2GK1A 5K7JA 1OX6A 3TSMA 5HQLA 4YLWA 3R43A 2OG9A 2PCQA 2QAPA 1IWPA 2AKZA 4DAIA 3LYEA 1MW3A 1KFJA 2G3IA 2OSXA 2KZHA 1DQWA 4PTDA 4ZSUA 2XVLA 3UY7A 2HXUA 4GKLA 3SGGA 1BYBA 3VFCA 1JAEA 3CYJA 2JEPA 4QHRA 1XPYA 5HMDA 2WSRA 4N7QA 2R1KA 1GZJA 3UR8A 1RXOB 5FJTA 2PDXA 5DRIA 1NDVA 2EF9A 2I16A 2IPJA 1OYAA 3TC6A 4AY7A 5BNKA 2R1PA 4M7SA 3N2XA 2UBPC 4GG9A 3TLLA 2ZRXA 7TIMA 3NIYA 4PTWA 3KCJA 4HCLA 2A7RA 1HVXA 1O7AA 3F2BA 3S5OA 3WDJA 1UA7A 3P93A 2V3BA 3LCIA 2CZDA 1K3UA 2V8ZA 1ZRQA 3FX4A 4GFSA 4S3FA 4MPQA 2AKMA 3SCVA 3MUZ1 4MAVA 1YDYA 1UBSA 4YTQA 1ITCA 3CV2A 5DY3A 2X99A 2NQLA 2V30A 2GVEA 4XV0A 1F6PA 1VEOA 1E0WA 4LUIA 1X6NA 3UR2A 3TP4A 1HW6A 3B4YA 2E1WA 2CEQA 1MO0A 4IQLA 3CHDA 4CNSA 1G4EA 3OQEA 3G3MA 1E70M 4GZIA 2CESA 2Z25A 2QGYA 3UCDA 3CHVA 1OADA 1QUMA 2DSKA 3LXDA 3AYRA 5XIMA 3W2UA 3FA4A 3RPTA 2J66A 2VRKA 3ALFA 3MP4A 2PDJA 2ZUTA 1G4TA 3PZGA 4I6KA 1EHAA 2PMQA 5G5GB 4GABA 4H4TA 4GINA 4DAFA 3BLPX 3DAQA 1KTNA 2WMHA 4X3ZA 3ETRB 1XIIA 4L6OA 2NXGA 1VYPX 2CLLA 4GUFA 1DE6A 5LIUX 4JHOA 5DT7A 2QW5A 1PCWA 1ZS2A 2OQLA 3NQ2A 1CGXA 1NF7A 2XDFA 1WO2A 4H7CA 2XUCA 5AC6A 3GRIA 1SPQA 3DH9A 3CQKA 1NU5A 1REQB 3A47A 3KL0A 1J12A 3EWYA 4MFEA 4IL0A 2VOMA 3NQ8A 3PVFA 1TWIA 1M03A 3UPBA 1XLKA 4IGMA 1KQZA 4C6BA 4TVWA 2VFIA 1B9ZA 1CGTA 1XSIA 2C14A 3JR2A 1XLAA 1AH0A 1XP3A 3BJFA 2HCVA 2JE8A 4JDBA 4AZ6A 3CNYA 2GOKA 1IR1A 4M82A 4JZ5A 2RAGA 1PPIA 1Q6OA 4KKXA 9RUBA 1TUXA 4YCPA 2IKHA 3FHAA 1EGVA 1WV2A 3PBMA 4E0CA 2YLAA 5I3IA 4ADTA 3MUCA 3UCCA 4L4OA 2C3DA 3F5JA 2BFGA 2VXNA 3SB0A 2FTYA 1X39A 4UMAA 2WOIA 1GESA 3R8RA 2YVGA 2PI6A 1FWCC 1OYBA 4BFAA 1JGIA 4QISA 3N2MA 2O9OA 3UF9A 1NQKA 4PMYA 3LPFA 4YTSA 4JICA 1FWGC 1QHZA 4LSBA 4MG4A 3RR4A 1N8FA 4MB4A 1UBPC 1VFHA 5FF3A 4ZTYA 2QEZA 3SCRA 4URIA 1AJ2A 1P48A 3LRKA 3BO9A 3N4EA 3UYIA 4Q4MA 3PUDA 1V6WA 5E9AA 4NY2A 2ZQ0A 1YADA 2ZWZA 3UGRA 1GJWA 1UUMA 2PTXA 3QZEA 5DBTA 1TQXA 4LYQA 1H2JA 3D47A 3PB0A 5A2BA 3WCZA 4U31A 1KTCA 4IM4A 3WK0A 5BRPA 4LNCA 4F4RA 4UIOA 3G1YA 1CB2A 2AQVA 5E6ZA 1EF2A 4IMFA 3OLEA 4Z2IA 2D1ZA 1JGMA 2CFYA 1KB3A 1QHPA 3QHMA 1H5VA 3STGA 1WUEA 2V6OA 3WLQA 2XFRA 4PUMA 1H7PA 3IGHX 1YEYA 1BF6A 5I3GA 2DEPA 2BY2A 4IPIA 1FKXA 1R9ZA 1TVPA 3EDFA 3IIVA 3V0UA 2I17A 3EYPA 3VTRA 2H8ZA 4LU0A 1A0CA 5MHBA 5H8PA 3VGDA 3LU2A 2VENA 4W87A 3W38A 3DFQA 4W5ZA 4LAKA 4HVXA 2AMXA 3GU9A 5U25A 1RSCA 1K70A 4HN4A 2WYSA 1OWQA 2IKGA 1DXEA 1XX1A 6CGTA 3PS7A 4C6KA 3OZYA 4PCTA 3W26A 1OX5A 1QT1A 4GYPA 3AU2A 4W93A 2VC5A 1Z41A 3W7KA 1JPHA 1UWIA 3DK4A 4O16A 2D0HA 1C93A 1JYVA 1UWQA 1FWJC 3N4FA 1MNZA 1C91A 2YA2A 2NZLA 3LX9A 2GVJA 2P3ZA 2V3EA 4XAFA 4TMCA 1F05A 1AW5A 5CZKA 5I07A 5DEZA 3IUIA 2O92A 5LA2A 3NQFA 4FOKA 4A2RA 1PAMA 2CBUA 4AY1A 1HXJA 4JQ9A 4JBRA 3NQCA 3QQ0A 4JIPA 1XCWA 3OODA 4JQ2A 3KLKA 4L9ZA 3NSXA 3FXYA 4DX3A 4OZOA 3WMLA 3KVJA 4DJED 5HQEA 1E73M 1E4IA 1LZOA 1Y7VA 1GVFA 5EPDA 1XYLA 4ZOCA 1FKWA 3W7PA 3IGSA 1W6TA 2PPGA 4HSNA 2J62A 1XRFA 2QQ6A 3GD3A 2A3LA 4V27A 4EAYA 4N6FA 3P74A 1ZGDA 4JIRA 1KXQA 3C0QA 2VFDA 3PULA 2X41A 4US5D 4GIAA 3V1PA 1RA0A 2C18A 3LK6A 3MUXA 5K4XA 2EO7A 5HULA 3NPUA 2O4MA 1IXPA 5A3HA 3ABZA 4F48A 1RY0A 1OD8A 1CLVA 4JS3A 1R8LA 3SUTA 4LY8A 3DYMA 4PBFA 1AG1O 2JFEX 3APTA 1KRCC 4R85A 3ANUA 2V5BA 4MFDA 4DEFA 1OFRA 4N4PA 4NZJA 1LTDA 2QUNA 1N55A 4C6CA 3QOKA 4XG1A 3M0ZA 3RYSA 3NCOA 2AL2B 1VHNA 3KBWA 2BODX 3DUGA 1FP8A 3WLHA 1H1NA 4B5TA 2DVXA 5TF0A 1A5MC 4Z2LA 4XSMA 5JBDA 1SO3A 3UG8A 1JQXA 4BJHA 1JZ8A 1M7OA 3TYCA 4J57A 1OFBA 2QPXA 3HGJA 2VFGA 1XC4A 4FR6A 1Y8BA 5EMYA 1NHSA 2CLIA 1TE1A 4AIBA 1FWFC 2I9UA 3W1RA 1B54A 3I4KA 4YTTA 2QJMA 3ZJ6A 1WAUA 1B1YA 1LF1A 2DQXA 1J5TA 3NQGA 3PR2A 5AYBA 5HJYA 5J5DA 2C0HA 4QJ1A 4JQ1A 1IYXA 3ARWA 1RD5A 1GTEA 1ZUAX 4IQEA 3UWUA 3QRHA 4XZHA 3SURA 5BU6A 3EOOA 6PTDA 3E2SA 1HGWA 4XISA 4K7YA 3PTQA 3LCGA 3BGGA 2ZOXA 4DUOA 3MDWA 4XUGA 1W9BM 5IBXA 1CXEA 2J7HA 4FO4A 4GPNA 1AODA 1EDTA 1E6RA 3WLPA 3STEA 1EGZA 4ZVJA 1RD6A 4LALA 1W5OA 1KBJA 2PDBA 1F3WA 4HA3A 3ZT6A 3OZPA 4OWGA 1ZNNA 1DXLA 3A3WA 3BK0A 4HCDA 1OZQA 1GW1A 5J8LA 1TWDA 1D3HA 1JZ6A 3VILA 4RUBA 3KTXA 3I7QA 1GOWA 4BI6A 4B5SA 2PTZA 3WKZA 4J3UA 3WJZA 3UY8A 4AMCA 3A12A 3PTKA 2FZNA 2VEMA 2Z1BA 4MNKA 1ZQ5A 3TC7A 4GH1A 2QR6A 2ZZ3A 1R2RA 3L2MA 1TA3B 1KLYA 4NT0A 2CBJA 3AMZA 2HK1A 3BLFA 3MWAA 3UYCA 3P5YA 3K1DA 5FEZA 1J0YA 3IUDA 4AHPA 2GJRA 3NSMA 2WJEA 3VFLA 2WMGA 3IK4A 3R07C 3ARYA 4O10A 3TZNA 4H7ZA 3UZJA 1BTMA 2VMFA 3UXDA 4JDYA 2PLJA 4GY0A 2FVLA 2BCPA 1FFVC 3VE9A 3H26A 3WMBA 4A21A 3ZR4A 4K7ZA 1AZ2A 2Y8VA 1DP0A 2IKJA 2QMJA 3WD0A 3QV6A 5T26A 2DFAA 3GVVA 1GEHA 4CN1A 3CZ8A 4IP4A 4F0MA 2WB5A 3WJXA 2HRWA 2GSEA 5RUBA 1JZ2A 4OV9A 2BXYA 2J25A 3VGFA 1SSGA 1F73A 3BOLA 1IEVA 1HP5A 3EOUA 5DMYA 1MYRA 4RPQA 5FSDC 4BURA 3HN3A 5JIWA 3CV1A 2VD8A 3ITVA 4XX6A 2V5LA 4HPXA 1N5WC 5MF5A 5CGMA 4JDRA 1ALDA 1YDNA 1PVNA 1RQHA 1XH2A 2WLYA 1XF0A 3GC5A 1XYMA 4OBRA 3F7JA 2GWNA 3UNTA 3OGRA 3WNPA 5LIYX 1ZBWA 3CQHA 3H21A 4LYPA 4ZOEA 1KC7A 2YZRA 4UTJA 1DWAM 4D9PA 1BPLB 2E9BA 4J3WA 3O3RA 2E5AA 4GXWA 1TQJA 3JU2A 3TH6A 4DWSD 3RU6A 4M81A 1NOUA 3WEOA 3N19B 3TSBA 2GH5A 2YQUA 2J7BA 1Q13A 2Z00A 1Q1RA 3QHNA 5DCEA 2V82A 4OBSA 3UWYA 1EO5A 1GJUA 2XIQA 3TW7A 1XH1A 4TR9A 1UKOA 4AEEA 3WNOA 5AOUA 2B7OA 1QO5A 5IOBA 4Z1AA 3W7MA 2WC7A 3UWZA 5IDZA 3G2GA 4KPRA 5LNUA 1Q6EA 2I7GA 1H7XA 3SUVA 4UZUA 1W8SA 3UJEA 3FAWA 4LRTA 4DBWA 1ZLPA 3CAWA 3W1TA 4FA3A 2V5JA 2YX0A 4G5DA 2IW0A 4M0XA 3NQDA 3W7NA 3H2EA 3DGRA 3G6LA 1VQTA 1K9DA 3NEVA 2E8ZA 5D9PA 1XLDA 2D2OA 1RHCA 1EQPA 1UD4A 4K8DA 1GWJA 4D72A 4O4WA 4IGHA 1R3YA 2AL2A 4B90A 1B3VA 3DKJA 3AMDA 4V1YA 4WY0A 1S46A 1DTUA 1T96A 1JQVA 3ES8A 5HJXA 4JN6A 4JCMA 3S42A 3EX2A 3WBXA 4Q4SA 3B3DA 2DZTA 2PU0A 2WM1A 4CQBA 1STZA 1IE7C 3KDNA 4Y9AA 1HF6A 5EA9A 3QMRA 2GZXA 1ZJIA 3GNOA 1GVOA 3IJQA 2F6XA 3GR7A 3QPYA 3K1GA 1H6VA 4K8HA 1XYBA 2VGGA 2DSZA 5DF0A 2ZUVA 2A4AA 1U5VA 1EQCA 5DXYA 3AALA 5FOOA 1MWOA 1E9LA 2WPBA 1KR1A 4L4PA 3S1UA 1X6UA 2XVPA 3T0BA 1MO9A 2Q02A 1Y5WA 1JJKA 1PYFA 3PZVA 1R2TA 1NHQA 3NPVA 1GXFA 1G4SA 1JUEA 2I57A 4XKMA 4RX0A 4J3VA 5D2WA 3DK8A 3NGJA 1V97A 1PIFA 1PKLA 5M3WA 2Z1KA 1YXCA 3SSZA 3ZM8A 4E38A 2OELA 1XLGA 1PTAA 4Z1DA 2VVNA 3BMWA 1FX6A 4MF4A 2NSXA 2UWFA 3UD6A 4UOQA 1DJNA 4IIBA 2OOFA 3A7AA 2WV8A 4IH3A 2G41A 5CJNA 1NF0A 3GR8A 4RE4A 2V9DA 3KBJA 4P7OA 2DORA 4PRTA 1V3LA 3P8IA 1Q6LA 1JPKA 3NXFA 4UQCA 1AJ0A 2V5KA 3ARRA 2WBKA 5CSUA 1TA3A 2ZZ0A 4LF2A 1VKFA 5KZDA 1K1DA 2PF0A 1LOLA 1ME7A 2D23A 1I45A 5M2FX 3AN1A 3SUUA 4F2TA 1VEMA 1NH6A 1DWJM 1OYCA 2JK2A 4R7OA 3NG3A 1QCWA 2PDCA 1HJUA 2YL8A 3G3DA 4V33A 2VZTA 2YL5A 4EF8A 1GRGA 3GUGA 3P84A 5CPSA 4XSLA 2J24A 3HQOA 2CETA 3ITTA 3UWEA 2PBGA 1MXSA 3MCNA 1I4NA 1UZ4A 1KM0A 3RXZA 3GG1A 5KINA 1OVDA 3KL5A 2G4JA 4O14A 3MWCA 4CKQA 1TIWA 1UC4A 1H7RA 2INFA 3U2CA 4MZYA 4CQCA 3KE0A 3GXDA 1TELA 3R7MA 3EKZA 4QBXA 4P8VA 3UP8A 3LCWA 3KHJA 4RNFA 1VHCA 3WLOA 2C79A 4U2ZA 2XGBA 1HKVA 2VOTA 4QFUA 1I6NA 1RCXB 1LBMA 3QJAA 3DHUA 5C5YA 3C8FA 3WUEA 1EO7A 3AMLA 1WP6A 4IT1A 1BAGA 4APNA 2CZVA 1ZALA 4I7WA 1KRBC 1UZ1A 5G4WA 3LGDA 1FEAA 2NX9A 2ZUMA 3C0LA 4JTSA 2JBMA 1TFVA 4PGLA 2YBVA 1E9YB 2HS6A 4M24A 3QFWA 3IC9A 3PNZA 3LY0A 3WNNA 3F4WA 4XZ9A 3STFA 4MYXA 2B81A 4NZ3A 3DGHA 3VDAA 1JPMA 3ZVIA 5AFDA 2OGYA 3W73A 1QWGA 1GQJA 1O4UA 3DENA 3L4YA 3COTA 4QGCA 1PZ3A 3AFBA 3CXOA 3ARTA 1J8VA 1J0HA 4CCEA 3HV8A 1LBLA 5ENLA 1X1ZA 3GB6A 4H1ZA 4ICCX 4PCNA 5BXTA 3AZSA 3P62A 1OB0A 1EA0A 3EB2A 2YKKA 4OQVA 2YDAA 3R0UA 4ERIA 2FDMA 1BXCA 3G0XA 4S3GA 2YIHA 1YKWA 5D38A 3LPPA 3S1WA 4NZ5A 2YCEA 2QKFA 3SCQA 4DJDA 2CNCA 4KESA 3PP7A 3AHYA 2QF7A 4IFRA 4KRZA 1GQIA 1P7TB 2ISWA 3GG0A 2WNNA 1ZCOA 2QDDA 3TFXA 4O52A 3MI3A 4RPPA 3S8HA 3U4AA 4FHAA 1E3ZA 4FF7A 3BXWA 4QG6A 3QMTA 3DHPA 3GR4A 4DM2A 3UZYA 2ZYFA 4ZODA 4JNZA 1HKWA 2J7FA 1QNRA 4O0QA 3E6EA 3UERA 3B4UA 3APGA 3SDOA 1TKKA 4MJ4A 2XVNA 3MUAA 4Y2WA 1GOMA 1OX4B 2NWSA 4NAFB 3GD4A 4FXRA 1W91A 3QY6A 5IHRA 2ZUUA 5GJMA 5LNVA 1RUSA 1UPPA 3QR3A 1B3XA 1V4YA 4MWAC 3SIMA 4DBEA 2YXXA 1QOXA 1RCOB 3E96A 1GRTA 1ADSA 4RK8A 4B3KA 1O1HA 2J27A 4P7NA 1K8XA 4YPJA 3K8LA 3R0DA 3JRKA 3MHUA 3DGZA 4B15A 1VB9A 1VCFA 2PU1A 1EHNA 1WKYA 4AWUA 2I14A 2QVHA 3C2EA 3P8JA 3MANA 1A0EA 4PMDA 2CIPA 5EL1A 4J5NA 1V59A 3NA8A 3SJNA 4DWDA 3LHWA 4ENLA 3EAOA 1DJHA 2VRQA 4Q7IA 1Q8JA 4M1RA 3C61A 5TAOA 3USZA 4GVGA 2JKEA 3CHEA 3VX0A 4FLQA 2OX4A 1TR9A 2PC4A 3F03K 3GE7A 3LCLA 4PUNA 4WJEA 2VDIA 2CERA 3U2OA 1VRXA 1FTXA 1ECQA 3OA3A 4LCRA 1VJIA 3AHXA 1W3HA 3B06A 3BW4A 2IQ0A 4L61A 1AQMA 2ZC1A 3VIHA 3ARQA 1NDWA 4CLMA 4F9JA 3SADA 2XSAA 4KEMA 1D7KA 2ICSA 1G67A 2BOFX 3C2VA 1FCUA 3HFYA 1V3MA 2DPEA 4Z2HA 3P67A 4ACZB 1XDJA 4W8BA 1VGAA 1QI0A 2YBUA 1OGSA 3ZT7A 1ELSA 2PTYA 3E02A 4GJ1A 4EWND 5I06A 1JRBA 4WCJA 1NARA 1XGDA 3ABRA 3BOFA 3WELA 3LOTA 1A50A 3T0DA 4H8NA 4DPQA 3RF9A 4L1WA 3KEHA 4IGNA 4M7TA 1VEPA 3ME3A 1HGYA 3QFEA 1GVQA 4B3LA 1ME8A 1V6XA 3VOGA 5ABTA 4PODA 2ZRWA 4ACYA 4FNUA 1E56A 3S1VA 4Y9NA 5H2ZA 2PDUA 1TPB1 5J5RA 5K9XA 2J6XA 3KTSA 4ROQA 3POCA 5GJPA 4XBSA 1POJA 1UD6A 2FB2A 1UKQA 5C2XA 1GG1A 2HS8A 1HJSA 1KFLA 1OC7A 1R3QA 1TWSA 3BPWA 2J74A 5TR3A 1PX8A 2PFHA 4YS1A 5C9ZA 3AS1A 2ZA2A 2WVVB 1V0KA 3HG2A 4GC4A 4U5KA 3NPXA 4KWUA 2I56A 2B31A 5DCDA 3GXTA 1FWIC 1JIBA 3TR2A 4XD4A 4UFIA 2YDQA 3YPIA 4A05A 1M65A 1OCJA 3F4VA 2UY5A 4FI4A 1XG3A 2GGIA 1PWMA 3T7VA 2RJHA 1K4HA 4W84A 4EF9A 3CO8A 3PFMA 1XANA 1SGJA 5FACA 3ORWA 5HATA 4HKPA 1B2YA 3MBFA 4MNJA 3HRDC 3M0HA 4AZHA 4DO5A 2GGGA 4DBDA 2VGFA 1H7NA 2ZRVA 3HGOA 2O9PA 3W2MA 5FS8A 3GKFA 4O1BA 4P2VA 1W3JA 5BXSA 2OZ3A 3UWVA 3D9XA 2PZNA 1KBBA 2I5QA 3KWXA 4M19A 4U5IA 4LV4A 4X2RA 3S3GA 1R3RA 4M6QA 4H50A 3LA4A 4W7UA 3Q45A 4HIBA 1YQ2A 4OHQA 4WSKA 2EG7A 4LH8A 4ZTXA 5LNSA 3OIXA 2XVGA 3QHOA 1TJ2A 4X9SA 1SMAA 4PMVA 3RPMA 4AAJA 3VU2A 4JHZA 2V3DA 5AZ0A 2Z1WA 4XVDA 1NDZA 1G9HA 1FY6A 1NAL1 5JVLA 1Y65A 4JR5A 4IIGA 3QTPA 3WLNA 3EXTA 4FNPA 4EXAA 4BHYA 1UMYA 5K9DA 3V5FA 2LLEA 4MWAB 4I5UA 5EBUA 3JS3A 3GHRA 1W5MA 1EEXA 2TPSA 4S3DA 2HZGA 4B4HA 5FI8A 3T4WA 1EF3A 1V5XA 1LOQA 2JALA 3TTEA 3W9ZA 5KETA 4AIUA 1FXQA 2GVGA 2GVLA 2GLKA 1T0OA 3VKDA 1PDZA 2Y5JA 1W54A 3DFTA 1WZAA 4BI5A 4NXSA 2ISDA 3DH7A 4C60A 2WOQA 3L21A 4Z17A 1YTKA 1VCGA 4H9YA 4DYJA 4BQ4A 3LZ3A 4AEOA 3VABA 5CC5A 3G6MA 5KEZA 2WSYA 1FWRA 2PZ0A 3UVIA 2WANA 1OX4A 4O53A 4NAFA 1JUKA 2ZADA 4FX7A 2O4QA 3K46A 2VZVA 2V0TA 2INEA 3M6YA 3WLJA 1KCLA 3RMJA 3TKFA 1HL8A 3R2GA 1UWUA 2XPKA 4CN4A 3G1SA 4U3AA 2QJNA 1CEOA 5BXRA 3FDKA 3IANA 3BG5A 3S9IA 3WEZA 3CH9A 1VRDA 3GH4A 1LP6A 2GWGA 4X60A 4ZSTA 3GKAA 1LWIA 2Y62A 3E49A 1H51A 4A2SA 1WXYA 3H8AA 2RJGA 3K4WA 1ADOA 1Z9AA 5IFPA 1FHDA 3LNMA 3KZPA 4K2SA 3ITLA 4GUIA 2JGYA 2PS2A 2BBFA 1EXPA 2QCEA 2ZZ2A 4R5EA 1Q1WA 1EXBA 4D8ZA 1T3QC 2C19A 1ZK7A 2O0TA 2E4TA 1N63C 5C70A 1W9VA 2WNWA 3P0WA 4ES4A 2FVMA 3WLRA 4WKAA 3G8RA 1TR1A 3I6RA 2VFEA 4DI9A 1E6PA 4UB9A 3TV8A 5FMHA 1TWWA 3AHTA 2RDWA 5H91A 2WHMA 2GQAA 1E3XA 3A4WA 1GHRA 1U1HA 4K38A 3W7HA 1G6CA 3UWWA 2NSOA 4QDWA 3KAOA 1A5BA 4ZE5A 4ZBCA 1YLVA 1AW1A 2H6RA 5D03A 2W79A 1I2NA 1UJPA 2ZZ6A 1YPFA 3GTXA 4S3AA 5FF0A 3D3FA 3CLMA 1YIXA 2JGQA 3C52A 1XGZA 3O2LA 1L9WA 3RLUA 3WMCA 2Z1SA 3VNLA 1GOXA 1XRVA 3ZJ7A 2E0PA 5HNNA 2P8CA 3M0YA 3IIPA 2BHZA 3TCEA 1TPEA 3TW9A 4EPKA 4DO6A 2QV4A 2FPTA 3LDVA 5DXXA 4U2YA 1BGAA 1WBJA 4O1DA 2ACSA 1R9YA 4MJZA 1EOMA 1CXIA 1FH9A 1BG9A 1W9DM 2GJLA 3F4DA 3N6HA 4RNJA 4IX2A 3I68A 4HTYA 4XO7A 3F2CA 2FB3A 1Q7MA 2GR2A 2PGFA 2PTDA 3T05A 1SUXA 1HJXA 2ATMA 4W5UA 3S5NA 3THAA 2WVVA 3GX9A 1ZPTA 1XDLA 3AROA 4GIRA 4Z08A 1RPKA 3G1VA 1XDMA 1UKTA 4B5NA 2HNEA 1E4MM 3RX3A 2VM8A 4Q8QA 4WOQA 3UZWA 4GI8A 5FJRA 3EMZA 4QQ3A 5D4YA 2CFFA 3NWRA 2V6AA 2WP5A 2VI0A 1JCJA 1SZFA 4X63A 1VFTA 1X8FA 3K8KA 1UP3A 3CJPA 3U2EA 4H00A 1ZJHA 4IJRA 4LS2A 2WOVA 5A8QA 1R5YA 5DLCA 2Z0IA 1S2AA 3FNDA 2A3EA 4HHHA 4MADA 3IIXA 1LG1A 1K02A 1OZMA 4HZ8A 1AJZA 3V18A 3N6JA 3I3DA 2G3NA 1MDRA 3LBCA 1E43A 2OZTA 2Q3RA 3R12A 3GC2A 2OU4A 1V6UA 1K7EA 4IMCA 3ID7A 5GRTA 4PUWA 2XH7A 1J11A 1VC4A 1Z32X 3KBNA 2CZ5A 2WZHA 1VDVA 1XG4A 3J7HA 4OGZA 2QCLA 4S39A 5A6BD 3SY1A 3VZXA 3TQKA 3AUJA 5K4ZA 3W1AA 2PDIA 5D2YA 3EPMA 2YFOA 1UR3M 3H7RA 2C3ZA 3MO7A 4AD4A 5CPMA 3NR0A 1BZLA 4MWAA 1UD5A 5LXXA 3WJSA 2RH9A 1IEXA 4GJIA 3FEQA 2VD9A 2GVYA 3FJ6A 2YVFA 4H6RA 1E5NA 4O4VA 3TQPA 4YWOA 4XBJA 1OSEA 2QIIA 4DY1A 7ODCA 3H2FA 1CGWA 4LB3A 1DEDA 3WQVA 2YBTA 1QDSA 4LBUA 1Z6KA 3BQ5A 1EJ7L