3MWCA

Crystal structure of probable o-succinylbenzoic acid synthetase from kosmotoga olearia
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
388
structure length
388
Chain Sequence
LTESARIDGVSLYEIVIPMKIPFQISSGTCYTRRSLVVEIREGDLFGYGESAPFEEPFYLGETLETTKVILKNHLLPMILGKEPLSIEEFNHLIKNGIRGNHFARCGVENAYWDLIAKKNKISLKAMIEKKMKNLGVKQEYLASNNYIESGAALGIPEDGRIETLIHQVEESLQEGYRRIKIKIKPGWDVEPLQETRRAVGDHFPLWTDANSSFELDQWETFKAMDAAKCLFHEQPLHYEALLDLKELGERIETPICLDESLISSRVAEFVAKLGISNIWNIKIQRVGGLLEAIKIYKIATDNGIKLWGGTMPESGLGARFLISLASFRGFVFPADVAASEKWYGKGNDLVENTMTDGKIYVPDEPGASFDMTLSHLEALGKKIWESQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of O-Succinylbenzoic Acid Synthetase from Kosmotoga Olearia
rcsb
source organism Kosmotoga olearia
molecule tags Ligase
molecule keywords Mandelate racemase/muconate lactonizing protein
total genus 139
structure length 388
sequence length 388
ec nomenclature
pdb deposition date 2010-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3mwcA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3mwcA01
2P88A 3FCPA 2OZ8A 2FYMA 3OP2A 3U4FA 2XSXA 4Z1YA 3Q45A 3R11A 1MUCA 3UJSA 4IP4A 3DGBA 4IZGA 1RVKA 2RDXA 4HCDA 2AL2B 3TW9A 4X2PA 2PP1A 5IDZA 2AL2A 3VDGA 1JCTA 2PGEA 3V4BA 2DW6A 3R1ZA 4J1OA 4JN8A 2XH4A 3PFRA 1BKHA 4F4RA 2PGWA 1EBGA 3MWCA 4HNCA 4DXKA 3UJFA 4G7FA 2HNEA 3B97A 2AL1A 6ENLA 3DG7A 3SQSA 2HXTA 3ZVHB 3GO2A 4KPLA 3N4EA 2OG9A 1WUFA 2QJNA 3RGTA 3I6EA 1EC9A 4E4UA 3U9IA 3RCYA 1P48A 1ECQA 2OFJA 3ES7A 3I4KA 4H83A 3OTRA 3GC2A 3R0UA 2GGGA 4J3ZA 3MSYA 3ZLGA 3DDMA 3NZGA 1KKOA 4IP5A 1SJBA 3PWIA 2POZA 2CHRA 2DW7A 2PPGA 3NO1A 1SJAA 3PK7A 2PS2A 3VCNA 3OW1A 3BJSA 1FHVA 1NU5A 2I5QA 4M0XA 1PDZA 3N6HA 7ENLA 4HYRA 3H7VA 5ENLA 3N4FA 3CK5A 3VCCA 4E4FA 2GSHA 3ENLA 4EWJA 3QN3A 3TJ4A 3UJEA 3VFCA 3EKGA 3D46A 2P0IA 5EU9A 3DIPA 4HPNA 4HN8A 2PP3A 3SSZA 3TTEA 1SJCA 4KWSA 3P93A 3VC6A 4FI4A 1OEPA 1R6WA 5FJUA 4HCLA 3OZMA 2QJJA 2OLAA 4ZCWA 4DN1A 3P0WA 2O56A 2P8CA 4IL2A 2P3ZA 1DTNA 1XS2A 4KT2A 4IL0A 3MY9A 2FKPA 2GDQA 2OPJA 3TWAA 3PWGA 4GFIA 3JVAA 4A3RA 3H8AA 3CAWA 3V5FA 1P43A 2PU1A 2XGZA 4HNLA 4GISA 3VC5A 2PCEA 3CT2A 3CB3A 3R10A 3RO6A 4DHGA 1MRAA 3MQTA 2AKMA 2QQ6A 3DG3A 1JPMA 3QKEA 4HCHA 3S47A 3RITA 3DFYA 2OQHA 1E9IA 4GMEA 2XH0A 3ES8A 3FJ4A 3VA8A 3N6JA 5J04A 1W6TA 3DERA 1NELA 3BOXA 3UJ2A 1EC7A 1TE6A 3H70A 1BQGA 1IYXA 3R25A 3TWBA 4MMWA 3D47A 3OZYA 4E5TA 3DEQA 3ZLHA 2MUCA 4JN7A 4E6MA 2PTWA 1KCZA 4K1WA 3TCSA 1FHUA 5FJPA 3JZUA 2QDDA 3QPEA 4G8TA 3TOYA 5FJTA 3SJNA 4ENLA 3UCDA 3NXLA 3ZVHA 2ONEA 3JW7A 3UGVA 3UJRA 3KUMA 3P3BA 2PP0A 2PSNA 3BSMA 4GGHA 3QLDA 3SBFA 2PTYA 4DYEA 3FXGA 2OZ3A 3T6CA 3ZVIA 3I6TA 3GY1A 1TZZA 5FJRA 3DFHA 2OX4A 1XPYA 2PA6A 1SJDA 4Z17A 3MZNA 3QTPA 4GIRA 3H12A 2OQYA 3NFUA 2ZC8A 1KD0A 3THUA 2P8BA 2PU0A 3DG6A 1ONEA 4K2SA 1WUEA 3DESA 3FV9A 2PODA 3GD6A 3ZLFA 3Q4DA 2OO6A 2PMQA 1TKKA 2GGJA 3CXOA 4IT1A 4A6GA 2GL5A 2PTZA 1MDLA 1EC8A 3CYJA 3K1GA 4YWSA 3SN1A 3RRAA 3UXLA 4IHCA 1MDRA 3UCCA 4H1ZA 2GGEA 3R0KA 5BOEA 4H19A 4JHMA 4M6UA 4DWDA 1L8PA 1ELSA 4MKSA 2GGHA 3HPFA 4H2HA 3T4WA 3T9PA 1JPDX 2ZADA 2QGYA 4KEMA 2HXUA 3STPA 1MNSA 3IJIA 3RR1A 3MKCA 2OZTA 2XH2A 1PDYA 2HZGA 3FVDA 1KKRA 3OPSA 3IK4A 3FYYA 1JDFA 3V5CA 4GYPC 4MGGA 3IJLA 1EBHA 2MNRA 3SN4A 4E8GA 2AKZA 3TQPA 2OKTA 2XH7A 4DX3A 2OVLA 1YEYA 3T8QA 3SN0A 1F9CA 3TJIA 2NQLA 2QJMA 4FP1A 3EEZA 5BOFA 3UXKA 2QVHA 1R0MA 2PTXA 4GYPA 2QDEA 3MUCA 5FJOA 4ZA0A 3IJQA 4ROPA 2GGIA 4A35A 4GGBA 3V3WA 3S5SA 4K8GA
chains in the Genus database with same CATH superfamily
3WUEA 1K3UA 2XVPA 4LVGA 1GPWA 1OD0A 3OLGA 3NUKA 5DX7A 4J56A 3UWWA 3PSVA 1CXEA 4CD6A 3F1QA 3NO5A 3WD4A 4CNPA 4LUTB 1GQLA 2YOCA 1I1XA 4PL1A 4LYQA 5A95A 4TX8A 2X8CA 5G1MA 3W3OA 4H9MA 2F2KA 3ZZ1A 3UZJA 4B92A 3E96A 4J7RA 3OYXA 7A3HA 1R3SA 3CQKA 1M01A 4JIEA 3C2VA 2AL2A 4UOZA 2R1MA 3LBOA 4WHBA 3T78A 5DBTA 9XIAA 1W8SA 4F4RA 4S3EA 2CU0A 3C3NA 4A2SA 1NQKA 1WPCA 4BK9A 1OIMA 4WIWA 1FVPA 1GRAA 2VCAA 4E4PA 2I57A 3UBPC 6ENLA 1PYFA 4YHEA 2VGBA 4LS2A 3GD4A 2YFOA 3CZKA 4Q4RA 2HVOA 2ZZ4A 1GKPA 5BMWA 1SO4A 3I6EA 1XIDA 1VHNA 4DZAA 4GVIA 3UZZA 1P48A 4KKXA 4WJEA 3OA3A 4U33A 3NVYB 3WNMA 4I9MA 1ECQA 1B9ZA 2OFJA 5HQMA 3OU8A 3VNYA 3FGCB 4GUHA 1AH3A 4FXJA 4JYDA 3R4IA 5C71A 3NZGA 2R6OA 2WSKA 1D3GA 1OGGA 3KXQA 1TVLA 1LWJA 2C18A 1SJAA 3PBVA 4K7VA 2ZRZA 3P74A 3BJSA 3WIJA 4D8ZA 3B0UX 4JIIX 1U22A 4UQDA 3B9JB 3M1ZA 2H6RA 2ALDA 4UTLA 4BQ2A 1UPMB 4E8CA 1GVOA 3BMWA 3LTPA 5AC4A 1TMHA 3SR7A 5JBFA 2EQ7A 2H3DA 1BSIA 1AMYA 3P60A 3M0YA 2P0IA 5F4XA 2G50A 2VZSA 1GOKA 3U5UA 1N7KA 2OGYA 3TTEA 1OSEA 1PZ0A 1VLWA 3WLPA 1J8VA 3MT1A 4HCLA 5IDIA 5AN7A 2Q8XA 1N63C 4JDBA 4C1LA 2PDPA 2J7EA 1W1IE 3HB9A 4W8LA 3MS8A 3O2LA 3G0XA 1HXJA 2OEJA 3STEA 3TWAA 1NFGA 4CD5A 4JX6A 1KGXA 3JVAA 4W9TA 2E8YA 1DWJM 4JIHA 3W24A 1L6YA 3SQLA 3WQ8A 1QWKA 5LNWA 4UTMA 3MMTA 2C91A 2ACUA 1E5NA 3NQDA 4JPGA 3I3EA 3QY8A 5AZ0A 1AW5A 3CUFA 4B2DA 4KWUA 4AVOA 3EPNA 1ZKQA 2WPCA 4PODA 5BWAA 1ZLPA 2DU2A 1ZUAX 1W1TA 4E38A 4AH7A 2CPUA 3DFYA 2YCEA 4ADWA 4PE8A 2DZPA 3CBWA 3RX3A 2WSRA 3EF6A 3FYOA 3NZ1A 5M1TA 3H70A 1OADA 4L1XA 3KLLA 2C3DA 3L66A 4JN7A 1FXQA 1F3WA 1KCZA 4PH6A 4CVWA 1XLAA 2YL9A 5DCBA 1DOSA 3NZRA 3TUUA 2YLLA 4O53A 1GG0A 1JZ4A 2BY2A 1EUAA 3JZUA 3H21A 5LGZA 3W82A 3SJNA 1I2QA 4FOKA 1QFEA 1B2YA 3CWHA 3QOMA 3W0KA 3KTXA 1VFMA 1WE5A 2ZUVA 1NOUA 1NY1A 1NPXA 1W5MA 3PG9A 2QULA 4H9UA 1DJZA 1B3XA 5AC6A 4XUYA 3DBNA 2PTYA 3AJ7A 3W1LA 3FXGA 1P1XA 3NQVA 3T6CA 3DHUA 3G2GA 1IT8A 5K4XA 5FJRA 2J4GA 1YQZA 1SZEA 2OX4A 3DFHA 1DVJA 1VFTA 5FF4A 2PA6A 3SAZA 3GUGA 3UPMA 4GIRA 3DHDA 3DK8A 4TX9A 3CGDA 1XYCA 4CEXC 3USZA 4GRTA 3NPVA 2Y89A 1PB0A 2XIIA 3ZSSA 4OKDA 1EXBA 3W75A 3QVQA 4K7YA 3XIMA 3G0SA 1Y5VA 3M0JA 1IXOA 1IGWA 1V6TA 5B7YA 4FF5A 1P6BA 1UBSA 3HRDC 1MZRA 4JTSA 3GU2A 2DUAA 2WNWA 3RN6A 3GNRA 4ONVA 2XGBA 1B3YA 2F6UA 3LPGA 4AU0A 4H1ZA 1K8CA 2WQPA 4HHPA 3EB3A 3GDMA 3T44A 1N62C 3DBPA 3RG6A 1DEDA 1WDQA 3KDOA 3OLIA 1I8JA 1XYFA 3NQBA 3RR1A 4AD1A 1PDYA 2FZNA 1SFTA 2DZUA 3DCPA 1K8YA 4KGLA 4NEWA 2V69A 4W85A 3AXMA 1TWWA 1JD7A 3NR0A 1A5SA 4IX0A 1JDFA 4PCNA 1WDWA 1LORA 1J12A 2BV9A 4NNBA 2IQ0A 2Y63A 5DRCA 5I24A 1FDZA 1AQHA 3D0CA 3N4AA 3N9RA 4WQ6A 3IJ6A 3U7VA 1E43A 1BWLA 1CT5A 4IPJA 4M51A 1OFQA 4CD8A 1VPQA 1J6OA 3TJIA 2ZOXA 4YTQA 1F3TA 1XGEA 1JF6A 3VX0A 4ECLA 2C3CA 4O0QA 1GOWA 4H8NA 3V3WA 2DSUA 2HISA 3TXVA 1LWIA 4ZB5A 3GNNA 4S1FA 3RNDA 2DQWA 2BVDA 4A8NA 3DHPA 1LRTA 1A50A 4MAVA 1PCWA 2DDXA 3GM8A 5XIAA 4PMJA 1QXLA 3N9SA 1P0DA 2DFAA 3IWPA 2EPLX 2VR2A 1R3WA 4C90A 3WJSA 1WOBA 4MDPA 3NDZA 3UWVA 1FP8A 1XDMA 2EPHA 3GTNA 2ZXQA 2A6LA 2E68A 4P8UA 4AB4A 1SW3A 4GKTA 4BR1A 4HU4A 4HNNA 1EDQA 1FTXA 1FDYA 4HNCA 3UJFA 3LI1A 4DO5A 3AIEA 1JDDA 2WCAA 5E0KA 2V6AA 4CCZA 2G5WA 3A4JA 3MW7A 3SM0A 1YTKA 4L6OA 1OM0A 3G1VA 3OQ8A 4GQBA 1Q6EA 2OG9A 4Z1BA 2OO0A 2HCVA 2PDGA 3LLFA 4HIBA 3V0TA 3M6YA 3FG2P 4H6QA 3II4A 4AZ5A 1RCOB 3W26A 1TVNA 4ZSUA 1QATA 3S1XA 1RD6A 5A6JA 3W7RA 8CGTA 5G5HB 4V27A 2GZXA 4D1IA 3CNYA 3PUGA 3QY6A 4I7VA 4ZO8A 3TE9A 3UR2A 3TVAA 5EMYA 4GVFA 4QRNA 3THAA 1JUEA 3W28A 3KLKA 1EEPA 4HZ8A 2OB3A 3H53A 2Z00A 4AISA 1QO2A 1VFSA 1PIFA 4EWND 3THCA 4AX6A 1BEUA 1TCDA 2PWFA 4H7ZA 5ENLA 3TSBA 2QR6A 4DYKA 4V2XA 6TIMA 4W93A 1BYDA 2J78A 3OYZA 2QLYA 1D3CA 2CHOA 4JTUA 1XLMA 1FWNA 4LSBA 3P5ZA 5DELA 1F8MA 4KIRA 1E51A 2YB1A 4AC7C 4C6NA 3EMZA 1XDLA 5EKYA 3SY5A 4H7CA 4FF7A 2GR3A 4MB4A 1EOKA 2DJXA 1DE6A 3W7EA 1KA9F 3W70A 3L4ZA 2BVTA 3QPZA 2DIJA 1B1YA 1AFSA 3CU2A 4JZ5A 3TYZA 4PMUA 3H4XA 3M0ZA 4GUJA 3B06A 4JQ9A 1H1NA 4O4VA 2X8GA 3GRSA 3NL2A 4ACZA 2DJLA 2W6RA 3C5QA 5CPQA 4GQGA 3W6MA 2CZVA 4DZHA 6XIAA 1DXFA 2MANA 5LA1A 1MW1A 2VZTA 3QQ0A 2X8HA 3CWNA 3SGGA 3CQ0A 2JE8A 3GR4A 2QQ6A 1LBFA 3QKEA 3W7NA 1QMLA 5TBOA 4L80A 3DYMA 1H63A 3F03K 1E9IA 4OIFA 1VAHA 4LUSB 1HGYA 1S5TA 3ECQA 4H9XA 2HNHA 3RR4A 4AY1A 3A24A 1X39A 3GZ3A 3LCIA 5I03A 5CC3A 4OE7A 5C0QA 2E6AA 4R7OA 1IEWA 1C8VA 1FWFC 1X97A 5EMUA 2B7PA 3GDKA 1QNOA 1M5WA 2QW5A 3GVRA 4MYAA 2OT1A 5D33A 4JXCA 5BXPA 3TC3A 1Q6DA 2WO5A 4DNMA 4LT9A 1OQFA 3ZVHA 2WVVB 3GHTA 3H22A 3BMXA 4IGHA 4XZ9A 2IPJA 1DBTA 4P7QA 1XH2A 1BF6A 5HR6A 5D2YA 1J4EA 1UD5A 3S42A 1REQB 3F2BA 5BYWA 2YYUA 3G3DA 1A5KC 5AFDA 2INEA 5EFDA 3B8TA 2GQ8A 4I9JA 2GK1A 4PTNA 1JYWA 1KV8A 2CYGA 1HJXA 3R2GA 1RLDA 4WKAA 2J3NA 3EDKA 1EPXA 1XPYA 4O15A 1XIBA 3WBYA 4Y9OA 3MZNA 3E6EA 1NOWA 3ZO9A 3WF0A 3H12A 1I9CB 2WSPA 2OQYA 1DWGM 4OVXA 4NQ1A 1WCGA 2VDHA 4RPPA 4IMFA 3GAKA 2P8BA 1KRMA 1VQTA 2HBXA 4FXFA 1GEQA 6A3HA 3VE9A 4FOUA 4FZIA 1TPH1 1UHVA 4Q4OA 4BI6A 3FYPA 4IJRA 3E0VA 3IAPA 4BWLC 1S2TA 1F8IA 3LMYA 4W5UA 4ZR8A 3B0YA 1XRVA 1XLHA 2GFTA 4ZVJA 1P7TA 2W66A 3NVTA 5FEZA 4IIDA 4M6UA 5FAGA 4LALA 1I75A 3H7RA 3WQPA 3CHEA 4GZIA 2ZRYA 3HPFA 1H62A 1P0BA 4MVAA 1OJTA 4JKLA 1TSIA 1VHCA 4TOQA 1MNSA 1RA5A 5BROA 4H4SA 1YBQB 2HZGA 1HP4A 4KQNA 5LHFA 1N61C 5HWNA 4RR4A 3KOZA 3WMLA 1OC7A 4DLMA 1SFSA 4J2MA 1RBLA 1EOMA 3CGTA 4UR8A 4RDYA 1DYSA 3DYPA 5EFFA 4N6FA 3W1RA 5BZAA 7XIMA 1POJA 3IUIA 1EO7A 3W01A 4HK7A 3LRLA 2NV2A 3OVGA 3M5ZA 1GKRA 1XD0A 5CGTA 3FAWA 4M1RA 5LNRA 4FP1A 4XBJA 4EKJA 1ICPA 1OCJA 2PTXA 3RPDA 2QDEA 2R9RA 1T96A 3BAYA 4AD5A 4EMIA 1J0KA 3AU6A 2BWGA 4P7OA 4AZCA 1VCFA 1O1ZA 1RM6B 3W7PA 4LYPA 4F0RA 1AH4A 3LADA 4JDYA 3UA3A 1WBJA 3CHCA 4GLEA 1JCYA 1FIQB 2I5IA 2PWDA 1KR0A 3MKVA 4UTTA 4WOQA 3WLHA 3U4FA 2FGZA 2V5DA 4GIEA 5EMLA 3O0HA 1V3LA 5H8UA 1MUCA 1ADSA 1XIGA 4D6EA 4LY8A 4GR1A 3KP1A 3A3WA 2PLKA 3GG8A 4J3UA 3FFSA 4B3ZA 4PRWA 1YDVA 2VX7A 3AS1A 2Q3RA 2YL8A 3C52A 2NQHA 3AIUA 2RKXA 3V4BA 2J9YA 3MYPA 4JN8A 5C54A 1ALDA 3G1HA 1AJZA 5CC7A 1CLXA 1PZ1A 1QW8A 4S2BA 1AZ1A 2PRMA 2NQ5A 2F5ZA 2C0AA 1QOQA 3SQSA 2FZ8A 2HQMA 2HDJA 4Y8FA 1TE1A 3KL0A 3ELFA 1AJ2A 4BJHA 4B16A 3RJXA 5JCLA 4YNGA 4XAZA 3NQ2A 1XLJA 1OF6A 4BA0A 3EA1A 3CGBA 5HJXA 4XK2A 2QDHA 4J3SA 1XUZA 2EPMX 1DJXA 1OZMA 4LQ1A 3CS2A 2C79A 3T42A 3PTMA 4H4IA 3IARA 2XIMA 1R2SA 4DO4A 5A6LA 1SFLA 1BTCA 1Y5WA 3NDOA 1SR0A 3N4FA 3RAOA 4EM4A 5K9DA 4QS5A 3W1AA 2FVLA 3WDRA 3CHVA 4H7VA 1JI1A 3QRHA 1NQ6A 4KFNA 1G4SA 2WMGA 1P0EA 1ZXIC 3IGXA 3RMJA 2IPFA 2FFIA 4BI5A 3AMCA 3FHAA 2XIOA 1OEPA 4BHYA 4R88A 2ZDSA 3ZXWA 2DY3A 2VZVA 2NSXA 2CLHA 4AEOA 4FR6A 6ALDA 4EM3A 3Q94A 3I68A 3VABA 1Q2SA 5DY3A 1LDCA 3APGA 2WWCA 4B9ZA 2BASA 4LBUA 3WG6A 2D69A 2GJLA 4H4UA 1VH7A 2BFGA 3RLHA 4TV5A 5LYRA 1F6KA 1O7AA 1KLYA 4WY0F 4LOCA 1E9YB 1E0XA 1VBUA 1H7RA 4QLKA 3PUDA 2XGZA 1JZ3A 4CN4A 2B81A 3R10A 4AIEA 3P14A 2Y8UA 1ZY8A 1KFLA 1UUQA 4PB3A 5LZLA 1OYBA 2E25A 2ZX9A 2YDQA 3L5MA 3LV6A 2XZ9A 1O66A 3HOJA 5DMLA 5FF3A 5J04A 4MHBA 3DERA 5I3KA 3VTRA 3NPWA 4K1GA 3UVIA 4O28A 4US5D 5C7VA 1IYXA 4H3DA 5ECVA 3UG3A 2C1HA 4K37A 3DEQA 4WDXA 4DLFA 2Z1WA 4OECA 1XC4A 2CWNA 1BVZA 1KCKA 3L4TA 4MJMA 3VKBA 4G2DA 1GV4A 2W27A 5FJPA 4ZTYA 2Y7GA 3IIPA 3DUGA 5GJMA 5FKYA 1MQPA 2Q01A 1MW3A 1IR2A 5D30A 4GRSA 2NVKX 1B5TA 3M0IA 3MP5A 1XIEA 4OJYA 2BHYA 2CITA 5ABEA 1UPPA 5DF0A 1U1HA 4L1WA 3WD0A 3CQIA 3DAQA 3SGUA 4MWAB 3SUUA 4XKMA 1DHKA 2D22A 2W61A 1J6PA 3CT7A 3QBUA 3L4YA 3OBKA 4C7GA 2GQ3A 5EGRA 4ERAA 5TR3A 4GBDA 1QAPA 1HKVA 4HMEA 1MW2A 3VNLA 1P0NA 5KVIA 3EDEA 1FWJC 4WKHA 1UWSA 3CL7A 1RPXA 5FAJA 3GUWA 2GQAA 3VNZA 1KD0A 4F40A 4AZIA 4PBEA 3O1NA 2WMFA 1G6CA 2VFIA 1GYLA 4UR9A 1NH6A 1S2UA 1WUEA 4DIAA 2RFGA 3Q4DA 3RM8A 3CTTA 3W29A 4N2YA 4LB3A 4D9PA 3DHFA 4HKPA 1OZQA 1VLIA 4LAKA 5J5RA 1DJQA 4JS3A 3CYJA 3FW6A 4H04A 4IPNB 4G56A 1A5UA 3JUGA 4FXRA 1V77A 3TJLA 4FX7A 4N9BA 4P61A 3GKFA 1NHPA 5I77A 4C6LA 3CZGA 4L64A 4HJFA 4AD3A 4L7ZA 3QR1A 1N60C 2Y7FA 2QCCA 5HR7A 3AO0A 4Q4KA 4ZQCA 1PUDA 4LRSA 2QS8A 2RJHA 1QCWA 1KXTA 4XKYA 3VOHA 1Q13A 2BNJA 3KWSA 3HU7A 4RE2A 4MAZA 1OHLA 1XYMA 1UD2A 1W5QA 3UW6A 1XUUA 4UWMA 3EDDA 5EL1A 1I2OA 1GJUA 5CEWA 3R7MA 4LCQA 1Q85A 1JJKA 1V6UA 2VURA 4AYGA 1H50A 1GOOA 1J0YA 3EA2A 4S3FA 1G7VA 2YB4A 4R9OA 2V3GA 1JZ6A 2ABBA 2JEQA 2NQLA 4PCTA 1MXDA 2AAAA 4H4PA 3HGOA 4GYPA 4EMWA 4P7NA 4QE5A 3E5PA 3AICA 5A8MA 3HURA 4ACYA 4K8GA 2GUUA 3EWXA 2FZ9A 1HUVA 3L9CA 3NGFA 4QITA 1I0DA 2ZVIA 3P67A 5EMKA 5JBEA 3TMLA 4KRUA 4LNYA 4KESA 3PTKA 3AROA 3ORWA 1TV8A 5E0FA 2CETA 2HE8A 4NASA 4U2ZA 3C61A 1P5BA 4X2PA 3VO0A 1RPKA 2WMHA 3TAOA 3AMZA 4JTQA 3W1PA 3GFZA 3WFZA 5C8BB 1VDVA 1ZAIA 1N5WC 1CZ1A 2ZTKA 4U4MA 3P81A 3B8VA 3HPAA 2PGEA 3V0UA 2XFFA 1SZRA 3VIHA 1D7FA 2XH4A 1C29A 5I07A 4RNIA 3QFWA 3LZ3A 4Q7NA 3NGJA 3TN6A 5FEXA 2J25A 3B97A 3THQA 1SO5A 1ZP4A 4MNKA 4UMBA 1I2NA 3FVMA 5KMYA 5FA5A 1GVEA 3DN5A 1E6XM 1J9YA 5G5GB 1RCQA 1FWHC 1T40A 3GG0A 2ACQA 2GVGA 5F2MA 2ZA2A 3MB9A 3U57A 2Y6ZA 1HVXA 3ITCA 1QPQA 4XD6A 1O1HA 3ALFA 3GC2A 1J0IA 4PMVA 2WKLA 4UTFA 1PCKA 4AMCA 4ZOCA 1EDTA 4YVPA 1OY0A 4P8XA 4ZSTA 4EAMA 3ZWTA 4PUKA 4OV9A 1F6YA 4PUMA 1FDJA 2EKCA 2GWGA 3CL6A 4FHAA 4IIGA 3WLSA 3NO3A 1QUMA 1XKYA 1H61A 1R3VA 4AVFA 4GXPA 4AY8A 1OC6A 3TN5A 3O0FA 3PZIA 2WJFA 3IGSA 1T41A 2VP8A 4KEVA 3L8KA 4Y6GA 3TJ4A 1XBXA 1ZJHA 1AW2A 3O16A 2NWSA 1RY8A 4OWGA 3ONCA 3T0BA 4HN8A 1TTQA 4PTVA 3SQMA 1KFEA 1VKFA 4NZ3A 4MLRA 2XSBA 2CW6A 2J7BA 1NFBA 1PX4A 3PSWA 1FFRA 3LQGA 4C6DA 1UJQA 3TEVA 2OWCA 4MNJA 5D04C 1D3HA 3IV8A 1EA0A 2O56A 2P1FA 4QR6A 1XS2A 4JGDA 4JIPA 4GH3A 3ARXA 4DZ5A 1KO0A 1WDSA 3H2MA 4A3RA 3H8AA 2QPXA 3TDFA 1G4PA 2EPKX 1LWHA 1C93A 3SB0A 5C9ZA 3NZPA 1K1DA 4HNLA 1W3HA 3EEGA 4I8YA 3E9AA 1TREA 1MRAA 2I17A 1UOKA 3ARTA 3GB6A 3CV2A 4DF1A 1MOKA 3K5XA 2DT1A 1TWIA 3W7CA 2WVVA 1JIBA 3KEHA 4H4RA 1Z69A 3LXBA 4WXZA 1E0VA 1OCNA 4H4VA 4WZHA 3F5JA 5D2TA 3UJ2A 3K1DA 1TQJA 1WP6A 4GY1A 4US6A 2ZWYA 5AC7A 2X41A 1MW0A 2VFFA 4J40A 4FEZA 3PAJA 3A22A 3UFYA 1W3TA 2PC8A 1MRQA 4KIEA 1VCGA 2TSYA 1O6IA 3LHZA 2PDCA 4NJKA 1TRDA 2WZHA 1DWAM 2J9ZA 4CLMA 3E02A 4RUBA 1Z9AA 4JTIA 2XTKA 2ZXBA 5HK4A 2BODX 3CUHA 1GVRA 3TYCA 1OX6A 4GI8A 2GJPA 3JW7A 4Z1AA 4RXFA 5D2XA 2VWTA 3A13A 1DTUA 2PP0A 1LUCB 1VBGA 2PSNA 2J79A 4ZMGA 5I0DA 1SUXA 4DXXA 5D8ZA 4DF0A 1DPMA 2REQA 3SBFA 1KV5A 3CYVA 1WAWA 5A6SA 4EF8A 3TAKA 4EQSA 1W3IA 4DEFA 3IUHA 1TA3A 4U5IA 1C9WA 2ZE3A 1BXCA 4GX8A 2GOUA 2Z1XA 3HGSA 1FX6A 3V1HA 1W9DM 2J9XA 4BCEA 2J66A 3INPA 4JHOA 1IXNA 3LN3A 5BW6A 5FESA 3WJYA 4TVDA 3B4UA 3G22A 5DY2A 2BVWA 3CEPA 2DT2A 3AOFA 2WLYA 3B40A 3MBFA 4I7UA 4HBKA 3L2MA 3AHXA 2OO6A 3RHGA 2TYSA 2GUYA 2CLOA 1JAEA 3P8IA 3WF1A 4J4KA 2YA1A 3B4YA 3B3DA 2ZTJA 1H49A 1IHIA 3FS2A 4OUEA 1E55A 2BLEA 3PPGA 5AOUA 3VDAA 4EXBA 2QPUA 2J74A 2OELA 3U6WA 1HO1A 3XINA 2WJDA 4LPCA 5FS9A 3LNPA 1BFNA 4H2HA 3VGEA 3MP3A 3LCWA 3BG5A 2D24A 1OIFA 1Q65A 3GHRA 3EAOA 3QV6A 3STPA 3L2IA 2AAMA 3MKCA 2YYTA 4RE0A 4IIHA 3IRSA 1W2VA 5REQA 4WJ8A 1RQBA 4OGZA 5HQLA 3I3DA 1FFVC 2R94A 1LP6A 4J57A 4QGCA 1CGXA 1ONXA 4NYYA 6TAAA 5HJYA 1Q63A 4D6HA 3IJLA 2XZ7A 3O07A 3W9ZA 2CFYA 1ZGDA 2Q6ZA 1W1A1 4K6AA 5A6AA 5JCIA 3P7YA 4PTMA 2Y24A 5IM51 1OX4B 3M6DA 3UXKA 1QBBA 4K38A 5FJOA 1WNOA 3WLMA 3IJQA 2XHYA 4MNLA 4YN5A 1GGOA 3HGJA 2J7FA 1F4HA 3HV8A 1P6WA 2IUZA 1FWGC 2OZ8A 2J77A 1LQAA 1OG0A 1FBAA 4OOZA 7REQB 3IVSA 1S1PA 4IQJA 1IF2A 2V2DA 1JULA 3UJSA 4IP4A 3BL3A 2WMKA 4IZGA 3ABXA 3OLDA 3HQPA 4JTTA 2IPGA 5IXEA 3VKKA 2ZZ7A 5CJNA 3FXYA 3W38A 2GVYA 1FXPA 2X1RA 1XV8A 1ZCOA 4YTTA 2ZA3A 4WEVX 3R1ZA 2UZ9A 2E5AA 2V82A 1A53A 4UNKA 1EPVA 5ABGA 3PB0A 4CEUC 1MFUA 2RDUA 4J9JA 1TR1A 2TPRA 2W91A 4GOAA 4NJJA 4N6EA 3G24A 2CKRA 1QBAA 4PUUA 3AWNA 3BWWA 1GZJA 3UG8A 2W92A 4W84A 4IIEA 2FH8A 3R43A 1JL8A 4JYFA 2OX1A 1IV8A 5SWUA 3CMFA 1DE5A 4MB5A 3CH9A 1OCBA 4Q8MA 3VZYA 1UH4A 2YA0A 1I0BA 4L4OA 4V33A 3GNPA 2NPXA 3M5YA 3CIVA 2CHRA 3OIHA 1VEMA 3DGHA 1BAGA 1JNDA 5LIXX 5A8QA 4GNJA 4HP5A 1UG6A 3CTLA 4TIMA 4BKNA 4S2CA 3F7JA 1C7TA 1UZ1A 2I5QA 2A1YA 4IISA 1GSNA 4HYRA 2NVCA 2IKIA 4QNEA 3EKZA 4QLLA 2PI6A 3LU2A 3MUZ1 2GSHA 4GO8A 3WSUA 2V5BA 2XN2A 4AWEA 4DJFD 3BLOA 3BW3A 9CGTA 4M82A 1JR1A 1OCQA 3QHNA 2WMIB 4MLJA 2WWDA 1EIBA 3S46A 3A4WA 3KBSA 5CGMA 2QEZA 4Z2HA 2W54A 3T0TA 3PUEA 3NG3A 4Q8WA 1F3EA 1CENA 1W9XA 2HS8A 3OZMA 1DHPA 4NZCA 4ATLA 1V0LA 1K7XA 4IQEA 3CC1A 3GKAA 3MY9A 3IEBA 2WV8A 4GUFA 1A5OC 4UCGA 3WYZA 1XINA 3V5FA 5HINA 1QU4A 3TTYA 2ATSA 3H54A 2PU1A 4Q8OA 3BAIA 1QOXA 1FFQA 1KXVA 3LSBA 5JCMA 1ISYA 1JUKA 4XSLA 4UXDA 2C13A 3BPWA 3REQB 3L5OA 1YXYA 4IOTA 4Q4PA 1FRBA 3ES8A 1TJPA 3U2OA 1W6TA 2BX7A 1CNVA 2ON3A 2YKKA 1TE6A 2YXXA 3TWBA 4KPRA 3UNDA 1IXQA 1E1CB 3AI0A 3GYEA 1PX8A 5EYWA 1QNVA 3WBWA 1JDAA 2V5JA 3GAYA 1STZA 1JRCA 1YLVA 1FHUA 2QDDA 4E3VA 2E67A 1EP3A 1J79A 1ZHAA 3TOYA 4HD5A 5FJTA 2J24A 1JYXA 4NILA 3IIZA 1FH8A 4O0KA 1N8FA 2YXOA 4ZXOA 4LAOA 5TF0A 3B0XA 3HPZA 5AYBA 1DV7A 3VD3A 2D2JA 4XIAA 5BRQA 4PTXA 3T81A 3HG4A 5CCZA 3ITLA 3CZ8A 4JFSA 5A6BA 1Q6OA 4UNLA 3P0XA 3FGCA 1LROA 2ZUUA 3A4XA 1XLKA 2OZ3A 3PNUA 4PUEA 3JRKA 4JTEA 3VZXA 3OA5A 1ZJBA 3IPWA 3ETRB 3AN1A 1H51A 4IMAA 1WDDA 3WFLA 3GVWA 4Q7IA 4QJ5B 2HBVA 1W56A 4UZSA 3AYRA 2E40A 2VXNA 3N18A 2OLHA 3NURA 2NQ9A 2R82A 4UQCA 4B4FA 1Z3NA 3NFUA 3W6LA 4I6KA 3TLLA 1MFVA 1WZAA 2ZRUA 4QCFA 3GDTA 1BWVA 4MFEA 3BO9A 2YDRA 3OEXA 3WFAA 3LD5A 5JH2A 2Y5EA 4XD5A 3BV7A 2VFGA 1PHQA 4Z2IA 3SO7A 2B31A 4RZBA 2ZRVA 1UR8A 1GERA 1L0PA 2XUCA 2Z6JA 4GQRA 4IHCA 3UCCA 1S2VA 2X09A 4E2DA 4YU1A 4RE3A 3UG5A 1K9EA 2VR4A 3ABQA 1E4LA 4NAEB 4YL2A 2F8QA 1R8LA 4LVBA 3VGHA 1UH2A 4C5YA 5EB8A 1FCQA 3BTNA 4H41A 3L5AA 5CLWA 3FYYA 4JFUA 3TR2A 3B8SA 2ISVA 3L4VA 3V5CA 1TCMA 1VP5A 3GNOA 3EX4A 1F73A 1XF0A 3VIJA 1VEPA 2PRLA 1LQ2A 3W7HA 1PS9A 3ARPA 3C2OA 4JCMA 3E2SA 4WVXA 1JEHA 1A5BA 3KCJA 4QHRA 1FH7A 1AD4A 2Y5SA 1PKYA 1W3KA 2OQLA 1V97A 1E73M 3W73A 3S5SA 2Y7DA 1YTDA 4DPPA 4LEFA 3H2AA 7REQA 3ZT7A 5HANA 3MV11 1WZLA 4HK6A 2YDSA 4PYSA 3NA8A 1QNSA 1P1MA 1FH9A 5DXXA 3P82A 1G5AA 4TVCA 4HN4A 1FO4A 4KERA 2YSWA 3A47A 2IQDA 4NJGA 5I00A 1EJRC 4GE8A 3TW9A 1KM1A 3ABRA 4AWSA 1T6MA 1XFBA 4US5A 3E5BA 1UZDA 3EOLA 1DWFM 2OWXA 3PJUA 3DGZA 3QGKC 3H55A 3Q67A 3UETA 4IQLA 2PGWA 1EBGA 5KTLA 5AKQA 4DXKA 3APTA 1TYPA 1GVIA 3M0HA 4WCJA 2XVGA 4LH8A 5A1AA 3VOJA 4D6DA 3KM8A 5CG7A 2NUYA 4HK5A 1EH9A 3H26A 1ODUA 4JEJA 3DOPA 1LUCA 4ZOEA 4DJED 4U31A 5A6TC 4HMNA 2VGFA 3WNKA 3TC7A 3CZLA 4ZGYA 3M44A 1IR1A 4EXAA 4GJJA 1T0OA 3ATZA 3WLKX 4GY7A 1U83A 4NNCA 2D0GA 5J8LA 4K3ZA 3TKFA 3MKKA 4O1CA 2UWFA 1SJBA 4GQQA 3AQUA 4H01A 3QGVA 4LTSA 2I5GA 4Y9PA 1XQKA 3VNMA 1S2WA 4IJCA 4GH1A 4UFLA 1TPVA 2VCCA 3ZS4A 3VDHA 4AZHA 2QCEA 3BLIA 3UD6A 4ZQPA 2VQUA 3CK5A 2BXVA 4AWUA 3R89A 2OCZA 4PRRA 2I14A 5LNSA 1ICQA 4MOZA 2O4QA 3EKGA 4I8DA 3K30A 5LNUA 1H11A 2QPSA 3SRHA 4IIBA 4DAIA 1M7XA 4NXSA 3K8KA 1QR7A 4C1KA 3GSMA 4JL2A 3TJXA 1AQFA 1OYAA 4DNHA 1M1BA 1SO6A 4X22A 1K7EA 2QJJA 5BU9A 4RNHA 1IT7A 2YJQA 2V67A 4Q7BA 3V75A 4C6FA 4FNUA 4GI9A 1YHTA 5FJJA 5FL0A 3WQVA 3EOSA 4DF2A 4RLIA 1A3WA 3LXCA 1X1NA 4PMRA 3SRKA 2QCHA 1J0HA 5D32A 1UD4A 3AIQA 2NSOA 3RO6A 1GQNA 4W7VA 4FX9A 1ZBVA 4JY9A 2CZDA 3PR2A 3RO8A 3B0PA 2J7CA 1TB3A 4D6FA 1JPMA 2F61A 3EPMA 4GD0A 5DQPA 2V5KA 1V79A 5BCAA 1UB3A 4H6RA 4LC6A 3FJ4A 5KZDA 3VCRA 3UP8A 2XINA 5I02A 1TVPA 1JOAA 4MMWA 1V8EA 2WKGA 1BZLA 1GJPA 2FVMA 2QHAA 2OSWA 3QKZA 1H7NA 4LUYA 4M19A 4E6MA 2YZRA 1VD6A 3O63A 4H8HA 3DYOA 4DO6A 4GPNA 3VDCA 4IPPA 3DC8A 3BC9A 1UR0A 3E3HA 4AD4A 4AC1X 2DSVA 4P7LA 3F4DA 3O0KA 3H2OA 3LHUA 3N2MA 1VENA 2Z7GA 3ITTA 4O13A 3USBA 2EGZA 2EQ8A 1T7LA 2PD9A 4IFKB 4DUXA 1EJVC 1VZWA 3BH4A 1HP5A 1W1ZA 1ONFA 4B2DD 4Q4QA 5CPLA 2O9RA 1ME7A 3BCJA 3LB8A 2WW5A 4EPKA 2DV0A 1BSLA 1KBKA 5D03A 4I5UA 5KVHA 2X50A 4JTCA 4LVAA 5HJLA 2XM1A 1TR9A 2OYKA 5L6UA 4C6JA 4O16A 3BGJA 3RU8X 4CUCA 4LAMA 2VVNA 1R47A 5PTDA 2VTFA 4EX4A 4JOMA 3SRFA 1XLLA 2KZHA 4W87A 2Y8VA 1HL8A 1HNYA 1P7TB 3V36A 1WYGA 5A8GA 5K9CA 1JD9A 5DT7A 4FB7A 3GU9A 2VHLA 1TKKA 2G41A 1YYAA 5C9XA 4IT1A 2WBAA 2WP5A 1E15A 1PZ3A 2NX9A 5A2BA 3K1GA 1KRBC 5HMSA 1GCYA 3C8FA 3PBUA 2CHNA 1R7OA 4QG6A 1UC5A 2JALA 4TO8A 4AIBA 3QFBA 4JHMA 4PEKA 4LUIA 4MKSA 2GGHA 4NZFA 1TX2A 3NQEA 1G7UA 3GH4A 4PTWA 3LQLA 1ZNNA 1JPIA 1HTIA 4HMCA 2HXUA 3WENA 1GVSA 5KINA 3S9ZA 1Y7VA 2ZC1A 1VYPX 1V6VA 1RSCA 1AQMA 1V02A 1VPYA 1HKMA 3N2OA 3QZAA 3S1UA 2GDUA 3STGA 3VGBA 3OVPA 4R27A 2V0TA 3A7RA 2PGFA 3SEPA 3R8RA 4E8GA 3WCZA 2NV1A 3Q65A 3WD3A 4FX6M 2PFHA 4B5TA 3VM5A 3SFWA 3L7RA 5IBXA 1H7WA 4TMCA 1IWAA 3K8LA 3WJXA 4RW5A 4DBSA 3EBVA 5IHSA 1PPIA 1QI2A 3C0QA 3WK3A 3N9KA 2X2YA 3SJ3A 4C6OA 1AOGA 3U3HA 2VC9A 1EJ7L 1R3YA 3FX4A 3AYSA 2PDNA 4EANA 4H4QA 3NSXA 2Y7EA 4MYXA 3OG2A 4JNYA 3QTGA 3IVUA 2BC0A 5MKGA 1JGIA 5EMJA 3VD5A 4Z1YA 4UTIA 1IE7C 2ZUWA 2O55A 1XICA 2PZNA 1NWRA 4Q6XA 2JKPA 3WF3A 3S2NA 3WMBA 5DMNA 2VZOA 4LY4A 1FHDA 3KRSA 3GXDA 3H4KA 4P5UA 4GK8A 4R3UA 2A6NA 4G9PA 3TX9A 3LZ5A 2GR1A 2PP1A 4QBXA 5IDZA 3HTWA 4NSBA 3WQDA 4J3VA 4EPBC 3WN6A 3UWZA 1FY6A 3HQOA 1YKWA 5CZSA 3H6OA 4IXXA 2HROA 3CJPA 4Z42C 1JQXA 3F5LA 1KM5A 4K39A 3WBEA 4ZZ9A 1XRSA 2BGNE 1FWBC 4YTSA 5FCZA 2QJNA 4H9VA 3AZRA 1G94A 1C8XA 3VGDA 5FJIA 4R9XA 2W3SA 1GQJA 5GNYA 1H4PA 3ES7A 1EJUC 1H1ZA 2E0PA 2Z2AA 3OHMB 1FWDC 1KKOA 3IJ8A 2QNEA 1N5XA 1TPWA 5KSWA 1KRCC 3QFEA 1OINA 1KXHA 4HU8A 4MG4A 3F4CA 3L0NA 3PS7A 2J6VA 4C1NA 4RV3A 4CQ9A 3S83A 2VC7A 3TFXA 4L1GA 1ME8A 3H7VA 4S3GA 3AS0A 4IMCA 4NUWA 4S23A 1HJVA 2WPGA 4BY3A 3VKJA 3TROA 4HSHA 4S3CA 5REQB 2BB0A 4MDOA 5AECA 3SSZA 4B3LA 2FFCA 2PBOA 1SJCA 2EHHA 3VC6A 3SSJA 1E9LA 1HZYA 1B3VA 1QI4A 6REQB 4ILSA 4QIUA 2V68A 3W7LA 1BRLB 3GLCA 4U10A 3BCFA 4LU0A 1EDGA 4V28A 1XYAA 5M2FX 4O10A 1Q1WA 2C19A 4JNMA 3NSNA 4GCXA 4CKQA 4ICCX 4P8VA 3WLIA 3HZ3A 3U5YA 4O12A 3EDJA 4BF9A 3SCQA 3MU7A 1Q7QA 2ZUMA 4PUJA 1P43A 2GUBA 4TTUA 3MV01 3QJAA 4F2BA 3BVJA 3HGRA 4CN1A 1AA1B 1IEQA 4JY8A 3T05A 5JH1A 2WXDM 3NQGA 1LG1A 3CZJA 1A4LA 4IUOA 3CMGA 1JCNA 3GFYA 2XH0A 3E0LA 3SCSA 3VA8A 1UUOA 1NP0A 4PSRA 4RZ5A 1RJRA 2E8ZA 2A3CA 2QIWA 1YE4A 3PZGA 3BE7A 1AH0A 1G4EA 4ICNA 1UR1A 3FAXA 4JBRA 2V2CA 3RFAA 3GVGA 1S1RA 1UC4A 4C6EA 4GKLA 2XIJA 3MBDA 2SFPA 5HNNA 3V1PA 1TELA 4J2PA 4ENLA 1PTAA 2Z2UA 4F2TA 4B5SA 2PDQA 2NT1A 3IJ7A 3WEMA 3LHWA 2G3MA 1C91A 4LV9A 3DJJA 2FB3A 1ZMDA 1G9HA 2YCJA 3W53A 1K9TA 1M04A 3G5EA 1EX5A 3G3MA 1GUVA 1FEAA 1TUFA 5JRBA 3KRBA 4UUIA 3ZR6A 1DWHM 3RILA 1UZHA 1W1B1 1S2CA 3BGAA 3IIOA 3CUZA 1GVYA 1PKNA 1FECA 5A8PA 4O8AA 2DSKA 2HTMA 3FLUA 4K68A 3DFOA 3VD9A 5DANA 1BXNA 1TPUA 4JQ3A 1U1JA 1PL9A 5K7JA 4AXKA 4LYKA 2ZX7A 3EPOA 3DKLA 1DJYA 3DG6A 3QHMA 4UR7A 1PV8A 3AMDA 3P62A 3BW4A 3QR3A 4XD3A 2G96A 2BXZA 1ZDLA 3LBMA 1GEHA 3PY2A 4FXSA 4TMBA 3VM7A 5A3HA 4WSHA 3EX6A 2F6KA 5D9NA 4JTJA 4FPSA 2WBKA 4HA4A 3UXLA 4AD2A 3KW3A 3UT0A 3ABOA 2CNCA 3ICJA 4QS6A 4ZB0A 2BY1A 4MZ8A 4KWWA 2PWGA 3M9YA 4ZQNA 2V8ZA 3NOEA 2OXNA 3W07A 2AQOA 3E0FA 8XIMA 3LCLA 5F7UA 3H2CA 3C8NA 1E1EA 1GOMA 3EUB3 4MJZA 1RV8A 2C15A 2DUZA 4RL3A 1HKJA 1KKRA 3HMCA 4GC3A 4LIIA 4XV0A 3U2CA 5KZEA 5AC8A 4NRRA 2V5CA 3IK4A 3C0JA 2ZRWA 1SMAA 3GRTA 1BF2A 1YQ2A 2XYLA 1CPUA 2JGYA 4BQ5A 4TXEA 4CQCA 5AYIA 3QYSA 3KBVA 5CPMA 1FWAC 3DH7A 4IFOA 2DIEA 4IICA 3UR8A 1X1OA 2QVHA 4KH2A 2CZ5A 4M7SA 2G3NA 3CQHA 2I9UA 4O57A 3HN3A 3VDBA 3LGGA 3WLOA 4Q32A 2P88A 2WCSA 4I90A 3WELA 4RK8A 1ZBKA 1E4MM 3GW3A 3W7OA 5IFTA 1SVDA 3W76A 1CX9A 2OGJA 4F0HA 4G6CA 3GZAA 4JYEA 5M5DA 3N11A 2FQIA 2JGQA 3P5YA 3TR9A 4TV6A 1GRGA 2VX4A 5FS7A 1V3MA 5HULA 2W3RA 1VBRA 2P10A 3QQ1A 2A3BA 2VEPA 3WH9A 4IM4A 3LGDA 3SCNA 1GORA 4KRZA 4FLRA 2PDLA 2D2OA 1US0A 3NVDA 1NP2A 2E5BA 4GXWA 3RLUA 1RY0A 1X2GA 4K8HA 3RNMA 2E1DA 3P61A 3T2OA 2AL1A 3L0GA 3W7MA 4L65A 2YA2A 3WBXA 2J47A 4X2RA 3SECA 4KPLA 1K6WA 4JIQA 1O5QA 2C0HA 2WMIA 3N2BA 2AMXA 1XL9A 1A0CA 2O0TA 2PAJA 2C8NA 4XIMA 3RYSA 3G18A 5G4WA 3TYUA 2YW4A 5TNVA 3C6CA 4ZQOA 2GSJA 1FHLA 3EOOA 4IP5A 4B3KA 1VF8A 2P3EA 1ONRA 1PX3A 2POZA 2VDIA 2EXOA 3WQOA 3FDKA 2XN0A 1FHVA 4AEEA 4HU0A 3PZ9A 4HOWA 4QJ4B 3R94A 1GRBA 3ITXA 3NPUA 1HGWA 1AJ0A 1TMLA 1DWIM 4LW7A 3MCMA 1Q7ZA 1QASA 4RNJA 4CCCA 3QMSA 3B9DA 3HQ1A 1R9YA 2E9LA 1XIJA 3RXZA 2W0HA 4NZ5A 1RR2A 1BYCA 4LWWA 5AHEA 4M1BA 3G8RA 2PP3A 3BXWA 1BRLA 1RP9A 2Q71A 1S39A 3U2ZA 4UFHA 4Q3MA 2FH6A 1Z41A 2NXGA 2NT0A 4FNQA 4XZMX 4YVVA 4DN1A 3NS1B 3HO8A 1DIEA 4F9JA 2CBUA 3FNDA 1E9ZB 1JXKA 3URBA 4JTAA 4MPQA 1GOIA 1ZX9A 4TR9A 5AHIA 3WD2A 1X1ZA 3WK2A 4AEFA 3NQ7A 1R3TA 2D23A 5BU6A 1LTDA 1SU5A 4S3BA 3NQ8A 4GISA 1JCXA 3SCOA 3OGSA 1JPHA 2WQDA 4IH3A 3EWZA 3MQTA 4GHRA 4FMVA 1GPFA 4WGXA 3UQNA 2HE5A 2X1UA 3M47A 2WZTA 3NRZB 2VM8A 3LA4A 1QRQA 2OQHA 3Q6JA 3BLLA 4ORMA 1LVLA 3I10A 1TPDA 3QW3A 4RDVA 5DBUA 1EWDA 2GLKA 2J27A 2OWWA 1BQGA 2FTWA 4CD4A 1Z89A 3ARUA 4ZBCA 3A3HA 2WBGA 5DO8A 2YBTA 1TJ0A 1PBGA 1TIMA 3S5YA 4W5ZA 4D1JA 4I3GA 3WUGA 4POCA 2YVFA 5A5WA 3WY1A 2V9DA 2VFDA 3QFAA 5FOOA 3ANVA 5JBDA 2ONEA 2ISFA 1YDOA 2G3IA 3SGZA 3DFSA 3EWUA 4HQVA 3UGVA 3N12A 3BICA 1GW1A 3AHYA 5K3VA 3IK2A 2Z29A 1UYQA 3QF0A 4TVWA 4Y7EA 5C55A 4HHHA 1BG9A 2BS9A 2PDHA 2HWGA 3CH0A 4MWAD 3AMKA 5CZKA 5AY7A 2WB5A 3VOCA 2Z24A 1YW1A 1A3XA 1JCLA 3PZOA 2DZXA 1XFCA 3NL3A 2FIQA 1V08A 3UPBA 1OD8A 1FKWA 4KRTA 1LT7A 4AQLA 2WSYA 2H3BA 1DP0A 4LB4A 1PO9A 3MA8A 1F07A 1LBLA 1NDYA 3OO2A 4NVTA 3SADA 2WNQA 4GYFA 1VFOA 2VUYA 4TUFA 4DWSB 2FGLA 1AK5A 3KVLA 4WY0A 5D09A 1VC4A 4JEQA 3QC3A 4PN2A 3D9XA 2WP6A 2BOFX 1BQCA 1QI0A 3O6YX 3O9NA 2V81A 1IIGA 3IC9A 4HZMA 4LANA 2A2IA 4PMZA 2VRKA 3EWCA 4B5WA 1ELSA 2FB2A 2FZMA 5F2LA 3A12A 4KEMA 3G1YA 3FSTA 3S6DA 1LOLA 1XLEA 2I1OA 2DUXA 3LDVA 3WBAA 3JR2A 1CWYA 3MMUA 4KFOA 1A5MC 1Q6GA 1JCMP 1U2YA 5LGXA 4RZ4A 3KZSA 3I6RA 3OHIA 1PYMA 1TPFA 4DJEA 3G6LA 1TV2A 1ZBWA 4XZWA 2MNRA 3FIGA 3TC6A 3C3UA 2RGMA 1S5VA 3L23A 3G1AA 4DX3A 1KCXA 4TU1A 2CXGA 4XBKA 4N7QA 4QSFA 1EJSC 4REQB 4IPIA 1GJWA 3LCXA 3LBCA 3ARZA 4WX2A 4ADUA 3GC5A 5ABFA 2Y8KA 2Y61A 1O5XA 2EEXA 3I65A 4I5XA 3CUJA 2GGIA 3MSGA 3B9NA 3N73A 2W5FA 1E0UA 3HV9A 1M03A 4WDUA 1HQTA 2PDMA 1UD6A 1UQYA 4ZOHB 1IXPA 2XDFA 7TIMA 4GG9A 1RLCL 3R11A 1WKYA 3QH2A 4C7DA 2OOGA 1W91A 1V0MA 2PURA 4JTRA 3GFXA 2Y85A 4R53A 3PBWA 1X6LA 2PE4A 3R8GA 5I7GA 3W1NA 3UCQA 1QWGA 4CNUA 2VNCA 4H9ZA 2YLAA 4S3AA 3GBDA 4A05A 3AC0A 3PZQA 4QXIA 2CKSA 1KC7A 3DGRA 4F0KA 1BKHA 1LRQA 3FJLA 2AGKA 4S3KA 3TQ0A 2E3TA 3GDRA 3W88A 4L56A 1PTGA 2HNEA 3AJXA 1I4NA 2A0NA 4TX6A 1A5LC 3RJYA 4G5DA 3EWYA 2NQJA 2PZ0A 2RUSA 4RDWA 5EA9A 2EO7A 1O68A 3LLXA 3EB2A 2H9AB 3B05A 3R07C 1E5JA 1V0KA 2QCGA 3S6TA 5G1YA 3S4TA 3CPRA 3GTHA 4GO9A 4KW2A 3AAMA 1CGWA 1X8CA 2X40A 3NVVB 3ZM8A 3OZOA 4IWWA 1SSGA 2GGGA 4A3QA 4AZ7A 1AUSL 3GS6A 3DDMA 5A6KA 5JVLA 3OB8A 3W74A 4KBXA 1KM2A 3FSUA 4GI6A 3WQWA 4EE9A 4A29A 1ITQA 3A6OA 4QE1A 3W71A 3C0LA 3EWBX 5CBIA 4K7ZA 4D6GA 3T1GA 4KETA 4DNAA 3GNXA 1YX1A 1VJSA 1GRFA 1DJGA 4NI3A 2VGGA 4BQ3A 2Z26A 1EJTC 1JYVA 4OBTA 3PBGA 2EJAA 1RK5A 2XISA 3AYTA 3RM4A 1ICSA 3S9IA 1D2KA 4M80A 4L5ZA 1J01A 4O4WA 1WQ5A 2A5HA 1XIIA 2PF0A 1OF8A 1GOXA 2WHJA 4CGTA 8TIMA 5LIUX 2NXIA 5FJUA 3E0WA 1US3A 3KRUA 1T5AA 3ZJKA 1B3OA 4ACZB 1UKOA 2DGAA 1HO4A 2FTYA 1LLZA 2VUNA 3K2GA 2ZZ5A 4JL1A 5I06A 1I45A 2WAGA 3QW4B 4U28A 1L2QA 3KOXA 4GFIA 3W02A 3W87A 1N2VA 2GVLA 5C2CA 2WC7A 1IGSA 1NF0A 3CAWA 1RAKA 1ADDA 3M5VA 2C16A 1BYBA 3AXIA 5G4EA 3WEOA 2G97A 4ZB2A 4YCPA 3PJXA 5K9XA 1OGBA 3URQA 3PJWA 1C7SA 1X7IA 3TIMA 3CAVA 1T99A 5JU6A 2W4XA 3WO8A 2G95A 3S1GA 3P80A 1J2BA 3S47A 1M53A 4UQ9A 4QE4A 1XYLA 4L61A 3WDHA 1DORA 1E56A 2W0UA 3G6MA 3S2JA 3AYVA 5H8PA 3VNDA 2BVYA 2VRJA 3I7SA 1EZ2A 4MJ4A 2RABA 4GWEA 2P50A 4E5TA 1B0IA 4Z2KA 4HNOA 5A2CA 1EHAA 3ZLHA 2WYSA 3RIKA 2BOGX 3WK1A 1Q4NX 1YNQA 3QV7A 1ZY9A 3PULA 4BEUA 4O17A 3T0CA 1LOSA 4B4HA 3VOFA 2JBMA 4F79A 2NXHA 1H6VA 5CGQA 3WF2A 4ZQMA 3UCDA 1WO2A 2W67A 3GWQA 4O50A 1Q1RA 5I3IA 4K8DA 5HUPA 4ZODA 5IOBA 4HYWA 3VZZA 2VWSA 1Q6CA 1WX0A 1VFHA 3QLDA 3NWRA 2R14A 1EB3A 1ZAHA 3VGGA 4B15A 4EF9A 4PRTA 3M0LA 3A23A 1W37A 5C2XA 4X9YA 1ZQ5A 1H5YA 1ZFJA 4NKCA 4DJFC 2JIWA 3C2EA 2PWEA 4PL2A 3APYA 3MZ2A 1JVNA 1MXSA 2VOMA 1T8XA 2NVAA 3SW6A 3L4XA 4NXKA 5FF2A 4NZJA 4H6KA 3GE7A 1XRFA 2ZZ2A 1R9XA 3W4RA 4Z08A 4HU3A 4PCSA 4C6MA 5BXSA 2Z2BA 1OBAA 3PZVA 1QO5A 3W1TA 2QDGA 2QUNA 3ZR4A 4HNVA 3TXZA 3EMQA 3EZ4A 4LEQA 2QCNA 4IIFA 1UD3A 3BUVA 2GGJA 4HOXA 1CB7B 3SCRA 1EP2A 3GW0A 4DJFA 1WZKA 5HMFA 2ZICA 4XO7A 4I7WA 1N82A 5JCKA 2CEQA 3BZGA 3GVVA 2EF9A 4H9TA 2YIHA 4H19A 1L8PA 3GXTA 2WC3A 4AXNA 3IRDA 1YNPA 4LAZA 3L5LA 1KFCA 2GOKA 3DK4A 1JPDX 3BQ5A 3LY0A 4R7JA 1DJIA 4XISA 5HA7A 1GTHA 4PCFA 4W7WA 3RM9A 1V6XA 5D2WA 4BF5A 4A8IA 3TNOA 5GRTA 3AIVA 1VIZA 1EEXA 3W2KA 1ADOA 2DSWA 2GYIA 3TN4A 1Z6KA 3EX2A 4F66A 1PXGA 1ZL1A 3BCDA 2YPIA 4GY0A 1XSJA 3EAUA 1OABA 4B91A 2RH9A 4Q8UA 3LPFA 2I56A 2VX6A 1DJWA 2OKTA 3QSRA 4GUGA 3PTQA 3ARQA 1ISXA 2H9AA 2PDJA 2ZIDA 1NARA 1S3TC 1PIIA 3PUOA 3W2NA 3TYAA 4D6IA 4WXYA 1WKEA 5JUVA 5CXPA 3F5KA 4AZCB 3EEZA 1EP1A 3KAOA 4AIUA 3ALGA 4FOJA 2E9MA 2Q3OA 2WVSA 4LA1A 1F5ZA 4MF4A 3GG1A 1RQHA 1V03A 2VKZG 2Y0FA 5EBAA 1KWKA 5DRIA 2BG5A 2OMAA 2J13A 1SO3A 1LJYA 3OP2A 4FK9A 3Q45A 2FTPA 4YTUA 1VFUA 3TOPA 1H7XA 4QDMA 4OV4A 1HKKA 2X0YA 2RDXA 4YJ5A 2EG7A 1V5XA 1J2WA 4GVGA 1RCXB 1NDAA 1B90A 1X2HA 4UBPC 2VEIA 4Y2WA 3DXIA 3KS5A 2ZZ6A 1UZ4A 3VDGA 3R58A 2DW6A 1AVAA 4F48A 3WNOA 4DQWA 3SR6B 5CZJA 3W00A 4NG3A 3H7UA 4G7FA 3HQNA 4L9ZA 1K8ZA 1QVBA 1OFRA 2EKGA 4IMDA 1JZ2A 3K8MA 3ZVHB 2TODA 3VGFA 1XGZA 4JFVA 1WUFA 5T8GA 5GQBA 2Z6IA 3TYEA 3RPTA 4CNSA 3LI0A 4UZUA 3VIFA 5JIPA 1M41A 1VR6A 1B3ZA 3R0UA 4Y9NA 4ERIA 4LVFA 4LS1A 3WNLA 2BBFA 2QMKA 1QOPA 2CXEA 1EFZA 4MUPA 4ATWA 3L0KA 3TSMA 3A3XA 1R2RA 3Q37A 3CL8A 5GNXA 4WR3A 2ICSA 1QK0A 4NAFB 2EBNA 2XFRA 1WA3A 2TRSA 2QCLA 2Y2WA 4M0XA 4ALDA 2D0FA 2WZIA 3RMEA 3VAVA 1NWTA 1KTBA 3QXBA 4HB7A 1FA2A 2AQVA 2C71A 5C6MA 2UY2A 2G8ZA 4IG2A 4OOUA 4EWJA 3NQ6A 1M7OA 3UJEA 3VFCA 2PTDA 3KL3A 4DVOA 1ML1A 3VI2A 1SQ7A 4MKNA 4AZGA 2YVGA 3OBEA 3BLKA 1OX5A 2OYMA 3ARVA 4ATDA 1XRTA 5D9MA 4B5XA 3ARYA 3CHFA 3UZ5A 3P93A 3F4VA 4QDPA 4Z0SA 1AODA 5JIWA 4E0CA 5DEZA 1TWSA 4BZYA 4DBUA 5I3GA 4M29A 2HK0A 4LXFA 3VIKA 4S3DA 4INFA 3NSMA 1NDWA 1H7OA 4FDCB 1R3QA 2DH3A 2OPJA 4I5RA 3V5OA 3FDGA 3WQCA 2J8FA 4XZNX 2DP3A 3GH7A 3S8HA 5F4WA 5KEZA 1X98A 3CM4A 3VIIA 4WOZA 1O95A 3VK5A 2Z4GA 3II1A 3ITGA 5CPTA 3JZEA 2QIIA 1WZMA 1LM1A 3GHUA 4PGLA 1W2PA 3W37A 1W31A 4NYUA 4JX5A 3VD7A 4L9XA 4ZE4A 1BVWA 3AISA 4GVHA 4UNIA 2WHKA 4BWLA 1UROA 1XDIA 1C92A 2YX0A 5A69A 1DQXA 2JF6A 1ODZA 3WMCA 2XIQA 3GDLA 2JF7A 5ABTA 3ONBA 2ZFAA 4ZQRA 3O6DA 2PC4A 2PTWA 4E2VA 1XD1A 2C14A 5AC5A 5FS6A 2YCLB 4OT7A 2J7DA 3BAXA 1YDNA 2ZZBA 3LOTA 3IGUA 3LG3A 4EPDC 2FZBA 3EXTA 3BZJA 5IBXC 2JQXA 2Y70A 1E0WA 2W79A 2ALRA 1GZ1A 5A2AA 3B03A 2W55A 2YZ5A 2IS7A 1BGGA 3W6YA 3PAOA 2BC1A 2V2HA 3NQFA 3L68A 4P8WA 2FMOA 1F4AA 3RLGA 2IXUA 3BSMA 4GGHA 4Z1DA 3WX7A 4M8UA 3MO7A 1AQ0A 2X16A 4DELA 4GNVA 2UY3A 2NWRA 2PDIA 1EJXC 1TFVA 2XWDA 1NWSA 3E74A 5CJ5A 1MO9A 1NTHA 4AZ6A 2VO5A 3S3GA 1KFKA 3KLJA 2ZXAA 3UYCA 4GQ0A 1WBHA 2J8TA 2FJUB 4W8BA 5CZTA 2O9TA 1I2PA 1WKDA 4EVZA 5E0CA 4CN6A 3GTXA 1N8WA 1WYIA 5E6YA 2AAQA 4ZEPA 1NHRA 4XZHA 2FZDA 5G2HA 1O60A 3NTYA 3I4EA 2A3EA 4ZO6A 1EUNA 4QDWA 1TA3B 4QEHA 4CD7A 3KS6A 3EKLA 3DESA 3GD6A 1TG7A 5I5RA 1HKWA 4S39A 3MCNA 4YPJA 4QG8A 4X3ZA 2E1WA 1L6FA 3AFBA 2ZX6A 4ZXLA 4LGXA 2NVDA 2OU4A 1BGAA 2OSXA 4O14A 2XFYA 2GL5A 1P4CA 3WQEA 1EC8A 4JQ1A 4CCEA 3CWOX 1CXKA 4ASTA 3WK0A 3CB8A 2PLMA 3WL0A 3ABZA 1NOFA 1GHSA 1RALA 1XLFA 4IF2A 1UA3A 3WLNA 2HSAA 4U3CA 1YNYA 4CQ8A 2HK1A 1CXLA 3EOEA 3T4WA 2E28A 4QCEA 2YCKX 2Z1VA 2GSEA 5CBJA 5F4SA 1KLZA 3VMOA 1F8WA 4LF1A 2R24A 1XLGA 4E2BA 2CLMA 3NNTA 3OPSA 4PMNA 1UWAA 5KZMA 1GETA 4Z2LA 3N2TA 5HPOA 1W1VA 4XVEA 4O19A 3O15A 3W1XA 1A49A 3SCTA 1UR2A 1XBZA 2GQ9A 1AD1A 2RAGA 5E6ZA 4EMJA 5F2GA 4JR5A 4APNA 4D71A 2V63A 4GXMA 3W2UA 3LX9A 4B9YA 1CTNA 4LF2A 4ZO9A 3WLQA 2DVUA 1YEYA 5JXQA 4UTWC 1YDYA 3MUIA 3SN0A 4A4AA 5FSEC 1F9CA 4QG9A 2WOQA 1NDVA 3W1MA 4KS0A 4HGXA 1NVMA 3BLDA 1QPKA 5F2IA 4DM1A 3M0KA 4A35A 3VIPA 2DZTA 4FIRA 2GJXB 3PFMA 4DJDD 3ZT5A 3C4UA 1IEIA 4HSNA 3S1WA 1ZRQA 1W17A 4H4TA 3C2RA 1OX4A 3V35A 2WHLA 3BAJA 4H8VA 1U30A 1XISA 4PBFA 3CXBA 1CGVA 1OK6A 1RVKA 4HCDA 1IEXA 3LEPA 4NJIA 3BLFA 2IMRA 1JPKA 5HAOA 4X9SA 1H3GA 4HPHA 1R86A 4JHZA 2WVTA 4HA0A 3UXAA 4XTIA 1DXLA 1OFOA 4IMGA 3HM7A 2E09A 3MJMA 1K4GA 1VBHA 3H23A 3N14A 2E5DA 4UMAA 5T26A 3S1VA 1KR1A 3QEZA 4XO6A 3DG7A 2E6FA 2BHUA 1EF3A 1E71M 4E8DA 4W86A 1LF1A 3TH6A 3OZPA 3W2LA 2ZWZA 4Q8VA 2VYOA 3LXDA 5B80A 2G4FA 1JROA 4PFHA 3LM7A 1LYXA 4PFMA 1UUMA 3T7VA 5AB3A 5FEWA 3M46A 3L4UA 4N9DA 2ZUTA 3PJTA 3LLDA 4J35A 2Y1HA 4IX2A 2WMJA 1QHPA 1V6YA 1CB2A 5CH9A 3N25A 3PHAA 1NHQA 3PANA 2V3FA 3MPGA 1KFBA 2CBIA 2W63A 4UIOA 3CLWA 2PPGA 3M07A 1RK6A 3U8GA 1Q45A 3CHDA 2YQUA 6PTDA 2JKAA 1QPRA 2P0OA 2X99A 1JG9A 4C6BA 3N6HA 4TVUA 3IUDA 1FWIC 3VPLA 5TD4A 3AALA 2V6OA 2EAWA 2QF7A 4E4FA 2VJXA 6REQA 3AS3A 4XB3A 3WJZA 1GONA 4GJ1A 2VDGA 4S3JA 1UCWA 4YWIA 4L4MA 1X6NA 1PJ9A 2E7FA 2V3EA 2WANA 4AIOA 1P6CA 2CZEA 3WH5A 4AW7A 4L6DA 5T91A 3TZFA 3THDA 2YVJA 3EOUA 4AAJA 5DCDA 4BEQA 1UKQA 1OJXA 1TTPA 4UFJA 3VUPA 3TN3A 2G4JA 2V3AA 4IL2A 1DTNA 4LVDA 4C1NB 4KT2A 3W7JA 2FHFA 4MWAA 4E3TA 1OK4A 3BK0A 1TMQA 1I60A 3F2DA 3MCOA 2XU2A 1W3NA 1S2AA 3O7UA 4KEZA 3PZMA 1X96A 4O18A 3PZTA 3PBYA 3BOLA 3NQMA 1UR3M 3AMLA 3HFYA 1ESWA 3DG3A 2FMNA 1K70A 1G0CA 2XVKA 2XN1A 3O8AA 1MI3A 1N55A 1V0NA 3R5EA 3BANA 3E2QA 1LL4A 5DXYA 1X8FA 4EQWA 1NELA 1RHCA 6XIMA 2W3ZA 4LBRA 4DUOA 1SFJA 3RCMA 1EL3A 3OQEA 2Y5JA 3D47A 5CPSA 1ITXA 5I23A 1E0TA 3PF3A 4M5PA 1GZGA 4IP7A 3FKRA 1MQRA 1D7YA 2ISDA 4EIVA 2PEVA 1YPIA 5CC6A 1L8NA 2QUMA 3QR0A 4H2CA 4HPGA 4HTBA 1TV4A 1UKTA 1XBYA 2WKJA 1XX1A 3G0UA 3ZYZA 4XAFA 1CW2A 2ADAA 1K6AA 1B9BA 1PEZA 2YBUA 4NNAA 1KW1A 3A64A 3W23A 2PB1A 3KBNA 1WB0A 1W3LA 5G4HC 3ZFHA 3OGVA 2EQDA 1O4UA 4GCAA 4HTYA 3LRMA 3HPXA 4DYEA 4Q8QA 1GREA 2PDWA 4GIAA 3ZVIA 3L21A 3I6TA 2ODOA 3GY1A 1CECA 1POKA 1E1FA 1FWEC 5CKSA 1OFEA 4CNOA 3EWDA 1ZSXA 2WLZA 3QTPA 3PC0A 3A5VA 3LENA 2FLIA 5HATA 2QXWA 3A7AA 2ZC8A 3TTOA 3GBEA 1UASA 3KOWA 3ISIX 3TV8A 5H2ZA 4K2SA 3MANA 2GJRA 3NL5A 3ZLFA 3CAKA 1TJ1A 2F2HA 3QZ6A 4OBSA 2V3DA 3OBAA 3VNKA 1JI2A 4A6GA 1V02E 2E77A 2JEPA 4PA8A 1Y65A 4Z1CA 1KGUA 3NEHA 1TZ7A 4O52A 1HT6A 3ZR5A 3AUJA 1XP3A 3F2CA 4HPXA 4G7EA 1Q6QA 1VRXA 1PKMA 3W7KA 4JAWA 2QT3A 4UTHA 4FLOA 2HRWA 2NX3A 1RH9A 3UGRA 1OC5A 5U4NA 4DM2A 4C6KA 4H4XA 5H8MA 4IGSA 1ISZA 1U1UA 1DXEA 4GC4A 2ZDRA 5HWMA 1B54A 5CBBA 3OOQA 2D2HA 3GXFA 3MUAA 1XCWA 1R2TA 2HEJA 3QHOA 1QHOA 2CLEA 3DFNA 4N4PA 3SDOA 3TYBA 3VOIA 2ISWA 4LFYA 3PB2A 4YYFA 1IZJA 5AHMA 2QAFA 2OR2A 4GX9A 4J5NA 2OTDA 2QCDB 4Z0JA 4HT3A 3HPSA 2R91A 1KWGA 3KVKA 2XVNA 8A3HA 3CAQA 2WOVA 1X38A 4REQA 4NAFA 3DKJA 4NU7A 3I7RA 4HMDA 5LA2A 3H4WA 3QQWA 5BWFA 3B9OA 5DN1A 4W7UA 2YFNA 1E3ZA 3DU0A 2XVLA 5E9XA 2ZVRA 4OZOA 3O6AA 8RUCA 4XUGA 2JK2A 4D6JA 3MTWA 4MWAE 4DUVA 4B5UA 4EQXA 2P76A 4K8EA 3VMNA 3PBMA 2AL2B 3MWAA 2HQAA 3HG2A 3VKAA 1Y8BA 3VNIA 3PPFA 4D8LA 3W81A 2WJEA 4U5KA 1XCFA 4PMDA 2QMJA 2D20A 3W25A 4DJDC 3PVFA 4O1DA 5DMYA 2R1LA 4XAYA 1GXFA 4OU1A 3DC0A 3P6LA 4FS9A 1JCTA 1NM9A 3SCUA 1RUSA 1KTCA 3A21A 3W27A 2PDXA 5ECUA 2HVNA 3PFRA 2YCLA 3C2YA 3FHQA 4OQVA 4CU6A 3VU2A 4KF1A 5U25A 4UOJA 1IWPA 1Q8JA 1CIUA 4UOQA 2CFFA 1ZPTA 3I7QA 4ZFMA 1M6JA 1XHCA 1SZNA 3NQAA 1QNQA 1I1WA 1HG3A 1HX0A 2PDKA 1PKLA 3RGTA 4GFSA 2VZUA 3A9BA 4E4UA 1EBDA 1QJWA 2DQXA 3ZSTA 1V93A 1SW7A 2E3ZA 4M7TA 4Q4SA 1KQZA 3GIYA 2WM0A 3BAKA 3OODA 2FHBA 5G2IA 2QUVA 1UJPA 3BLEA 1W8GA 1B3WA 3HFTA 2DW7A 1QI3A 4HYVA 1L6GA 3UPWA 2GVEA 2DIKA 3EGJA 1NU5A 1BG4A 4GUIA 2J62A 1ZS2A 4LS0A 2RDWA 4UB9A 4JTFA 5I2UA 5GJNA 3GXMA 5IHRA 2X0HA 4YS1A 5I78A 3MMWA 3JU2A 4MWAC 3D46A 1BTMA 5LIKX 1TV5A 5EU9A 2H8ZA 3STCA 1HL2A 3UR5A 1NFPA 3N34A 3LYEA 3XISA 3QV9A 3HJEA 2XM2A 3D3AA 1FFUC 5T9BG 3VIOA 4JD4A 3RLVA 3P0WA 2DVXA 4DY1A 2J75A 1IIHA 2P3ZA 5D4YA 3HJZA 1KN0A 3FA4A 5MF5A 3T07A 1OFAA 1B31A 3EB4A 4UFKA 1QNPA 5HPCA 4ZE5A 4F3HA 4DPQA 4NIRA 2WZMA 3VC5A 2PF8A 2OZ0A 3POHA 4RCXA 4R34A 3A4AA 5E9AA 5F1UA 1OT1A 1DIOA 1JRBA 1B4KA 2E4TA 2OSYA 4WGHA 1S5MA 2B7OA 4UMCA 1E40A 3LPOA 1F7BA 4HVXA 3SCWA 1BD0A 3N6JA 4IFKA 1R7AA 4GABA 2FDMA 1UBPC 4R5EA 1ISVA 1QTWA 3NOYA 4DB7A 1TTIA 2V30A 4GZJA 4R85A 1EQPA 4GIYA 2AMGA 2WPFA 1VQZA 4BS0A 5A8NA 2OYLA 1SM9A 3H2FA 5BNKA 5K4ZA 3LRKA 4DXVA 4MB1A 1IZCA 2WNZA 4ADTA 2VEGA 1XIMA 1RBAA 1TRIA 3NXLA 4DO7A 1KBIA 4F2UA 4EP8C 1JCJA 1H7PA 2EQ6A 3OVRA 1VYRA 5LNVA 1TIWA 1XXXA 1Y0EA 3TMQA 4F0SA 2BXYA 4LCRA 2A8XA 2JFEX 3KX6A 3VNJA 1MEIA 1XYBA 4WK9A 2ZE0A 1Q8AA 3MUXA 3MJYA 4QSHA 3ZIZA 3DZ1A 3IANA 3W7GA 2VEKA 3GG7A 1KM6A 1ZBCA 4KCTA 2A85A 3G1DA 4B90A 2PBGA 1TZZA 4CNNA 3W84A 4G1KA 4UFMA 4X60A 3VXGA 1JQVA 4Y90A 1BHGA 1SJDA 1CDGA 3GXPA 1CXHA 1ENUA 2OEKA 4FLSA 2V3BA 3IVTA 1AW1A 1Z7AA 3R12A 1GVFA 9RUBA 1PWLA 1FP9A 3J7HA 2A21A 1QPNA 1WXYA 4WF7A 4A8LA 1J5TA 2PU0A 1E4IA 3CO4A 1F3PA 4OFCA 1Q66A 2NUWA 5LA0A 4UTWA 2WPEA 3NJ3A 4GACA 1K9DA 2PMQA 3VILA 1Q6LA 3CXOA 3EX3A 4C60A 3VFLA 3L2LA 3GIPA 3K4WA 3C56A 2HJPA 1K77A 2VD8A 4BQ4A 5HNTA 2INZA 4URIA 3VE7A 1XPGA 1K8XA 4RZ6A 1YPFA 1FCVA 1M9HA 1K4HA 3B9AA 2BP1A 3HBLA 3P8JA 4RPQA 1B30A 4L4LA 3FEQA 1XR2A 3DFPA 2ZADA 3N6QA 4MJ2A 2WZEA 2YBVA 1IZKA 2ZYFA 2ZZ1A 2VMFA 2TPSA 3ABSA 3G8EA 5HDRA 2DZAA 3C86A 4RV8A 4I9TA 1EKOA 4AHQA 5B7ZA 2J8GA 4WRHA 3E38A 3N2CA 2E6DA 3M41A 3HMJG 2X05A 2GR2A 1RD5A 3WEZA 3ARSA 1QI5A 4XKYB 3HF3A 4GYPC 1W9UA 1I2RA 2CDUA 1KM3A 5CAHA 1VGAA 3AXXA 3BMVA 4Y9MA 3TQPA 1W9PA 1UWQA 2A7RA 3N1AA 2CESA 2OKOA 1NIUA 2NLIA 2OVLA 2VRQA 4HA3A 4IG2B 4D6CA 4NY2A 4KWVA 1ME9A 5D8WA 1CXIA 1R0MA 1D7KA 1FWWA 4G7EB 1KXQA 2F9RA 1G67A 2WJZA 3QSTA 1FEBA 4DBWA 1NJJA 1W32A 1XLDA 2WHMA 1W9VA 1TJRA 3WH7A 1OGSA 2FYMA 3W22A 3SY8A 1R87A 1R46A 2ZBTA 3MHUA 2J7GA 1H0IA 3GH5A 3KE0A 1SZFA 3BJFA 4HHLA 4WDTA 3HG5A 1EYEA 1MVYA 4TVYA 5FD0A 1KBLA 4Y96A 5CG0A 4DAFA 4H00A 3KBMA 5J5DA 2OT0A 1EGVA 3OVQA 4J1OA 3TFCA 3G1FA 4D8AA 1DNCA 1FUYA 4C91A 1PWMA 2BOEX 1H09A 4KCWA 4UFIA 1W5NA 3B8WA 3VD4A 1F61A 2DH2A 3WLTA 1M3UA 4N42A 2HXTA 3KBJA 4FX8A 2DZSA 3VIGA 2PRHA 4X61A 3LGEA 1BWKA 1GQKA 2DPEA 4NT0A 5H1WA 3ANYA 3O05A 4JTGA 4ZFCA 3UF9A 4NAEA 2QJHA 3TYDA 3CO8A 2GH5A 5XINA 2X8RA 2EPNA 4MSSA 4LBSA 2WSQA 2YGYA 3MI3A 2NLYA 3AIBA 4FIQA 3PZNA 3GQYA 1ZMCA 2PGRA 1C9DA 3NO1A 2PS2A 1CLVA 3WDPP 3TA9A 3VCNA 3OW1A 4O1AA 4MUZA 1GVQA 4MZYA 4JX4A 3LUTA 3I3BA 4QJ3B 4MFDA 4QQ3A 1VFFA 1V4YA 3BW2A 5GPRA 5AHLA 1BXBA 5HBFA 3EMCA 4LAUA 1H2JA 1UWUA 4EQRA 1Z44A 2O9PA 2ZKMX 1K02A 1H0GA 2XG9A 4QNWA 4GJIA 4HNUA 2BGSA 3DIPA 4QM1A 1G69A 1QHZA 2Q02A 3OG3A 4IMEA 4FNPA 1KRAC 3GDBA 4XZIA 4QX4A 3V16A 2O9OA 2BMBA 4UQAA 4FI4A 3NVZB 4YWOA 1R6WA 2R8WA 2DZVA 2GRTA 3GNDA 1EO5A 1O12A 3S6OA 3KVMA 4FNSA 2GWNA 3NCOA 2OLAA 3SI9A 2J7HA 3LTYA 2P8CA 1UQZA 4J27A 5CSSA 4IL0A 3ZJ8A 4F9DA 5D9OA 4ERGA 3EANA 3W1UA 4AY7A 1CYGA 3SCPA 3FN9A 4FALA 1GHRA 2VENA 3AU2A 3A9IA 2CLFA 1F6PA 2A3AA 5LKYA 1HFBA 1BYAA 2OOFA 5I6SA 2NV9A 3H2EA 5KZ6A 1HJSA 3VUSA 4PC8A 3RITA 2VOTA 1VCVA 3GR8A 3LM3A 2G3JA 3TZNA 3E2VA 3HA1A 1J18A 2ZUSA 3S2MA 1GYMA 2PWUA 3BOXA 1W1YA 4XZBA 3OLEA 2AGTA 1P0KA 1EC7A 3TTQA 4QLJA 2D2GA 2F7FA 1BPLB 4N4QA 1XW8A 3CPUA 3BQ6A 2WC4A 4RW3A 3GR7A 3D5HA 1DKWA 4NRSA 3M0VA 1XLBA 4XWUA 3AXKA 2BDQA 4O1EA 1XHGA 5D2VA 3E0IA 5EBUA 3AHTA 3B04A 3TCSA 1DQUA 2Z7KA 1ZENA 1QW9A 4OTKA 3UY7A 1OB0A 1H5VA 5DMMA 2QAEA 2C6QA 4J3XA 4UCFA 1W54A 1M65A 5G2WA 2UY5A 3UJRA 3R79A 7CGTA 4QP0A 1A5NC 3C2FA 2Q8LA 2A3HA 5TAOA 4BI7A 1GYNA 5CSYA 2QYGA 1TTJA 1Q6FA 1NEYA 3E2RA 4IJBA 3LXAA 5KETA 4HSOA 5HWJA 3CIXA 2ZZ0A 3DJGX 4O11A 3WQ6A 2PWHA 1OFBA 4HOZA 3LCHA 1VYSX 5MHBA 5TIMA 4M6PA 2IQTA 3UESA 3AM9A 4K36A 1OG6A 1JFXA 2FPTA 4BF7A 5D38A 3POCA 3LTSA 5K2ZA 3RCNA 1CXFA 3G1RA 4LUSA 2D0HA 1KM4A 3NYDA 3T0DA 3PP7A 1OFDA 3KCOA 3W72A 1GESA 5FF0A 1S5WA 3CV1A 2QCFA 5BXRA 1ZJAA 4UQEA 3UR7A 5C7HA 1DQWA 1PHWA 3R13A 2P5NA 4ZL1A 3BG9A 2V5LA 2YXGA 4EK7A 2IXVA 5I09A 3TSDA 2G0WA 2Y62A 1XH1A 1TPEA 2PDFA 4YIWA 3K4DA 4XBSA 4XG1A 4NL1A 2OEMA 5MKGB 3QYQA 1WXJA 4YWSA 3SN1A 4WDWA 5EBKA 4MKVA 4PCPA 2CLPA 3ME3A 1K7FA 2R1KA 1WXZA 1E4NA 4GINA 2QUUA 2CBVA 1V3JA 1ITCA 4ML4A 5BRBA 5CPOA 4JQ2A 1SR9A 1S3HA 4F0MA 4EAYA 4DZIA 1TWDA 4Q8PA 4PUDA 3BLPX 4UTTC 3M0XA 2FJKA 1LLOA 3FVDA 5C2GA 1C90A 1E72M 3W7IA 3JS3A 2QJIA 1R38A 2JIEA 2CERA 4CQBA 3PG8A 3GRIA 4XX6A 3CUIA 3CIWA 1AZ2A 4GI4A 1GTEA 3UXIA 4PMYA 3ARRA 3T0AA 1FCUA 3B8IA 4PUWA 4M24A 4QJ1A 3KVJA 3BSGA 4LCSA 5AVHA 4PBGA 3KP0A 5AVNA 2VELA 4HHMA 4EACA 2XH7A 3SFKA 3N2XA 1XBVA 2CIPA 4R33A 5D9PA 1V6WA 5LIYX 4XTDA 5CQ1A 1CEOA 1TYTA 3TCEA 4ZA0A 4ROPA 4TQTA 3TQVA 3AUOA 1H60A 4A21A 1DIDA 3GYCA 3M4HA 1WV2A 3R8HA 1LL7A 1US2A 2VGIA 3PPHA 3MP4A 1HN1A 1SB3B 1YMYA 4NZ4A 3L67A 3URAA 1ZTVA 5ABHA 1L6SA 4DI9A 3K13A 2QV4A 1B57A 3CASA 4KGJA 1EZWA 3T2QA 3AWOA 3IS4A 5H6HA 3S0CA 1FCBA 4KCVA 1QW7A 5HXMA 2EJ1A 4JN6A 4LJ3A 2Z27A 4WD0A 1SMDA 3SUSA 4M6QA 5FACA 2ATMA 2VT0A 3ITOA 3WQ4A 2GQWA 3UG4A 1J11A 9XIMA 1W5OA 1RZMA 1VJIA 4IFRA 1GKQA 3REQA 2HPIA 1VEOA 2ANUA 2VFHA 4IXHA 1UKSA 1MMFA 1UW9A 4ZOBA 4ROQA 4PTDA 5A6BD 2YAUA 1BVNP 1Q5MA 3PG6A 1XYZA 1MQQA 2F84A 3O3RA 4GYKA 4C65A 1Q4WA 1EC9A 5RUBA 2ABAA 4DJDA 5AHNA 3U9IA 3RCYA 1M7PA 2QF8A 1B4EA 1DJHA 3G77A 1FWRA 2TMDA 3E1F1 3I4KA 4AF0B 2DEPA 4IQDA 3T09A 3OTRA 1WDRA 1CBGA 3LK6A 3LSCA 3P84A 4MM1A 3KWXA 2DT0A 4J3TA 3DENA 5CSRA 1TX0A 2NW0A 3ZJ7A 3WNPA 4YLWA 3COTA 2DT3A 1HIZA 4Y8EA 4PMOA 1JRPA 1FOBA 3MSRA 5IFPA 4FNTA 4DWSD 2FVKA 3KOFA 3URNA 5TQLA 2YDAA 3WMSA 5CC5A 3RUBL 3FEMA 3T40A 1V3HA 4RKAA 3H2NA 4MY9A 3NDYA 1HF6A 1Y5XA 1SZGA 3N3TA 3QMTA 3CUXA 4YCOA 1U33A 4FLQA 3VKCA 4JDRA 1UOZA 5C9RA 2UY4A 4XAGA 3PWAA 5F1VA 3FA3A 3GD3A 2GVJA 2VEFA 2E9BA 2QGHA 3M43A 3SY1A 3IGHX 1R85A 1D8CA 3N29A 2CLIA 4DI8A 3MI2A 5D02A 3EXRA 3Q2DA 4E2OA 5CSUA 4OBRA 1MEWA 5A6MA 4U3AA 4M3PA 1E6PA 5GJPA 1V51A 5E09A 3BURA 1JF5A 3UXDA 3BJTA 5AHFA 1QNRA 2NX1A 3CB3A 3WQFA 2X7VA 1MUMA 3UA4A 4DHGA 4Q22A 3G1XA 4C6QA 5M03A 1OFPA 3W7QA 4NF7A 5ER0A 5GNZA 3W83A 4CCDA 4AX7A 1LOQA 3P2VA 1M7JA 4O8RA 4GMEA 3W86A 4HJWA 3S2LA 4NI8A 3UVAA 3T08A 4Q33A 3UWUA 3T55A 2HS6A 4YHGA 3GC4A 4OHQA 3WKZA 3R25A 1REQA 1ZJIA 4J28A 5DT5A 2VX5A 1HJWA 2ISSA 3OZYA 3LV5A 3OC4A 1W3JA 2MUCA 1QT1A 5G5IA 4K1WA 4PMQA 1XIHA 4CQDA 4MZ1A 2D3NA 1PVNA 3ITVA 4WSJA 1SW0A 2HMCA 1KBBA 5BXTA