3MWCA

Crystal structure of probable o-succinylbenzoic acid synthetase from kosmotoga olearia
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
388
structure length
388
Chain Sequence
LTESARIDGVSLYEIVIPMKIPFQISSGTCYTRRSLVVEIREGDLFGYGESAPFEEPFYLGETLETTKVILKNHLLPMILGKEPLSIEEFNHLIKNGIRGNHFARCGVENAYWDLIAKKNKISLKAMIEKKMKNLGVKQEYLASNNYIESGAALGIPEDGRIETLIHQVEESLQEGYRRIKIKIKPGWDVEPLQETRRAVGDHFPLWTDANSSFELDQWETFKAMDAAKCLFHEQPLHYEALLDLKELGERIETPICLDESLISSRVAEFVAKLGISNIWNIKIQRVGGLLEAIKIYKIATDNGIKLWGGTMPESGLGARFLISLASFRGFVFPADVAASEKWYGKGNDLVENTMTDGKIYVPDEPGASFDMTLSHLEALGKKIWESQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of O-Succinylbenzoic Acid Synthetase from Kosmotoga Olearia
rcsb
source organism Kosmotoga olearia
molecule tags Ligase
molecule keywords Mandelate racemase/muconate lactonizing protein
total genus 139
structure length 388
sequence length 388
ec nomenclature
pdb deposition date 2010-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3mwcA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3mwcA01
3U4FA 3ZLGA 2O56A 4FP1A 3N4FA 3SN0A 1ONEA 2P3ZA 1BQGA 3UJ2A 2PTYA 2OO6A 3JZUA 1BKHA 2FYMA 1ECQA 3UCDA 2OX4A 3T6CA 2ZADA 3D47A 3DESA 4HCDA 4Z17A 2I5QA 4E8GA 1KKOA 4E4FA 4Z1YA 3JW7A 3MQTA 3CB3A 3EEZA 1EBGA 3VCNA 3FYYA 4JN7A 3IJIA 3Q4DA 3B97A 2PTZA 3RRAA 1JCTA 1MUCA 4GGHA 4G8TA 2XSXA 4HCHA 1SJDA 4H2HA 4ZA0A 6ENLA 3CK5A 4K8GA 1PDZA 3CAWA 4J3ZA 2OLAA 5FJRA 2MNRA 4H83A 4IT1A 3TWBA 1KCZA 4DN1A 1EC9A 3IK4A 3N4EA 3JVAA 1L8PA 1EBHA 3DERA 3S5SA 2CHRA 3K1GA 5BOEA 3CT2A 3PWGA 2GDQA 2QJNA 3THUA 3N6HA 1PDYA 3IJLA 3FXGA 4DX3A 1ELSA 3UJRA 2OQYA 2DW6A 4K1WA 1JPMA 1KKRA 2QDEA 3SSZA 3FCPA 4K2SA 2PGWA 1E9IA 3VC6A 3OZYA 3QPEA 3I4KA 3DEQA 3TWAA 4DYEA 4GYPA 3TTEA 4X2PA 4GIRA 4MKSA 3VDGA 1WUFA 3NXLA 3ES7A 4HYRA 1TZZA 2OG9A 3DDMA 3PWIA 2OQHA 5J04A 4HNLA 4IP4A 1NU5A 3P3BA 2DW7A 3ENLA 2POZA 3DG6A 4IZGA 1WUEA 4HNCA 3I6EA 2QVHA 3CXOA 3PK7A 4E4UA 2OZ3A 2GGEA 4HN8A 4E6MA 3MY9A 3Q45A 4M6UA 3STPA 4ENLA 3RITA 3GC2A 3BJSA 3H70A 2GGGA 3ZVHB 3R25A 5BOFA 2HXUA 4ROPA 3R11A 3UJEA 5FJUA 2OZTA 1R6WA 3QKEA 2PMQA 3TJ4A 3MUCA 3P0WA 2QQ6A 5FJTA 3SN4A 3OZMA 4M0XA 3MWCA 4IP5A 3FJ4A 3RR1A 1SJCA 1SJAA 3TJIA 3MSYA 1RVKA 2XH2A 4KEMA 3V4BA 3HPFA 1MRAA 3ZVIA 4KT2A 1NELA 4G7FA 3D46A 1P43A 4IL0A 2GSHA 3DG3A 4GGBA 3UXKA 3FVDA 2OZ8A 2QGYA 3NO1A 2FKPA 4IL2A 1MNSA 4H1ZA 4HPNA 3VC5A 2XH4A 3DGBA 4H19A 2ZC8A 3TOYA 3NZGA 3IJQA 3MZNA 2GGIA 3N6JA 3GO2A 3SN1A 2ONEA 4KWSA 3QLDA 4DHGA 3VA8A 4YWSA 3OPSA 2QJJA 4GMEA 3KUMA 2GGHA 1YEYA 1XS2A 1EC8A 5FJOA 3T9PA 2NQLA 3OW1A 3S47A 3ZLFA 2OPJA 2PU0A 3NFUA 4GFIA 4EWJA 4HCLA 3R10A 3V5FA 2PPGA 1TE6A 2PODA 2PA6A 3OTRA 4F4RA 2MUCA 2PS2A 4MMWA 3TW9A 3V3WA 4IHCA 3TQPA 2QJMA 2OFJA 2AL1A 2PU1A 2QDDA 2PCEA 4J1OA 2PP0A 3T8QA 2AKMA 4A6GA 4GISA 3SQSA 2GL5A 3U9IA 2P8CA 1IYXA 1SJBA 2HXTA 1W6TA 3RGTA 3UGVA 1MDRA 2HNEA 5EU9A 3H7VA 2AL2B 1TKKA 1MDLA 3FV9A 3VFCA 4MGGA 1R0MA 3DIPA 3SJNA 4ZCWA 4KPLA 4E5TA 3CYJA 2RDXA 2PP3A 2P0IA 3DG7A 2XH7A 3DFHA 3R0UA 3BSMA 3RCYA 3ES8A 4A35A 3RO6A 4DXKA 2GGJA 2OKTA 2PTXA 4JN8A 3QN3A 3UJFA 2XGZA 4DWDA 3H12A 2HZGA 1F9CA 1KD0A 1P48A 3UJSA 1EC7A 5FJPA 1JPDX 2AKZA 2P8BA 3ZVHA 3T4WA 3EKGA 3I6TA 3R0KA 2AL2A 4FI4A 4GYPC 3DFYA 3ZLHA 5ENLA 2OVLA 3GD6A 4JHMA 3UXLA 1FHVA 3V5CA 3OP2A 3R1ZA 7ENLA 3SBFA 2PP1A 3P93A 3BOXA 3QTPA 1OEPA 2PTWA 2PSNA 3PFRA 5IDZA 3H8AA 1JDFA 1DTNA 3MKCA 3GY1A 1XPYA 2XH0A 2P88A 3TCSA 1FHUA 3UCCA 3VCCA 4A3RA 2PGEA
chains in the Genus database with same CATH superfamily
3AXXA 3M5XA 5D2VA 3W76A 2CHNA 3UG3A 2Y24A 1GKRA 4KCVA 1BQGA 1UR4A 3NURA 1UKQA 4QE5A 5C71A 2YA1A 1TJ2A 3NGJA 4J3XA 3T6CA 4WY0B 1ZJAA 1TE1A 3WDIA 4G2DA 2I17A 3CB3A 3EEZA 3EWYA 3ALFA 4C6EA 1XI3A 1XLAA 1CYGA 3LLDA 3VCNA 2DJLA 1FDJA 4GUFA 1UR0A 5I3KA 2DEPA 3OJGA 1QW7A 3K46A 4NEVA 3G3DA 4PL1A 3RRAA 4Y7EA 2WLYA 3I7RA 1LPFA 3LCFA 4N9BA 3NEHA 3AS0A 1OT1A 2YVJA 1TVLA 4EQXA 3AROA 1K6AA 4H2HA 1XX1A 4JQ4A 3FW6A 2VR5A 2TPSA 2GQAA 2MNRA 2YYUA 5RUBA 1KCZA 3BG3A 2OWWA 1EJVC 1Z89A 3AC0A 1UUQA 4Q8PA 3IRSA 2BOFX 1EO5A 5REQB 4D6HA 3P7YA 4EMIA 4WK9A 2EQDA 4MKVA 4LALA 4DJED 3BV4A 3SCVA 1PYFA 4K39A 4LFYA 1UD8A 5CPTA 3MCNA 4JX4A 2WHLA 3GIPA 1SPQA 5I07A 3GDLA 5HXMA 3WMBA 1S1RA 4O1CA 4QDPA 3G0UA 1Q63A 2CHOA 3LG3A 4S3FA 1E3XA 2OEKA 4Y2WA 2EG6A 2WMIB 3ZSTA 1H41A 3OZYA 2V81A 1E0VA 3AHYA 3QTGA 3FAWA 2YAUA 2J8FA 4JNYA 1J6PA 1O5KA 2J7DA 1HVQA 1OC6A 2V5BA 1Y7VA 2WJFA 2DW7A 1I4NA 3LCWA 3TZNA 5JUVA 4EXQA 3NSXA 2POZA 1RR2A 1JR1A 1XPGA 4S3CA 3UD6A 4PTMA 3QY7A 4B5UA 4MJ4A 3TYCA 2YXXA 1JUBA 2WQPA 1EQPA 2E25A 4M7SA 4R5EA 3IACA 1V6VA 2ZZ2A 3MV01 1RLDA 2HJPA 2WO5A 4OUIA 4B92A 3CLMA 3S9YA 1EJUC 2WHMA 5AHIA 2E6AA 4ACZB 3KDOA 1EYWA 1H1YA 1JCXA 1DBTA 3FN9A 3P84A 1F5ZA 4A21A 4K68A 4G1KA 5F2LA 2GOUA 3PPGA 2J9XA 2QJIA 2W0HA 3CTLA 1VLIA 5F4SA 2VVNA 5FS9A 4Z42C 3CGBA 2VFHA 1K6WA 3WQDA 3G22A 4KEMA 4RW5A 3TZFA 5A2CA 1LRTA 4X61A 4JPGA 5EBUA 1WE5A 3QFWA 3H54A 3LXAA 2BV9A 3CEPA 3KRUA 1MSSA 2C0AA 2RAGA 2XVGA 1U83A 5EKYA 3VKCA 1V6TA 4LB3A 5E6YA 4AD0A 2A6LA 3L4VA 1HF6A 3NXFA 3GHTA 4UBPC 4MB4A 3B4UA 3CHDA 3TONA 3F7JA 4H19A 4JGDA 3VNDA 3N6JA 1XIEA 2ONEA 3W2NA 3LCXA 1W5MA 4FR1A 1XBXA 5B7YA 4RXFA 3H2FA 3M44A 1NWUA 3SCOA 3KUMA 4G56A 3A4XA 1TZ9A 3ZLFA 3M64A 4WCJA 3W1RA 1UKTA 4O28A 1TE6A 1EF2A 2GJNA 5AVHA 1OX6A 4FPSA 1FVPA 3WMSA 3GR4A 4FIRA 1SW7A 4CCEA 5LNVA 1P7TA 3M5VA 4Q8NA 4AF0B 2IKHA 2AQWA 1W3HA 4P8WA 4B5WA 4ZQPA 4TVYA 3I6RA 1J2WA 4OIFA 4QAWA 3UP8A 1FKXA 3T55A 3UG8A 1RY8A 1JEHA 3ZJ7A 2VR4A 2R1PA 3SECA 1WDPA 5I09A 4CNNA 1VB9A 3EWDA 5DMMA 1R38A 1ME7A 1F74A 1XRVA 3SY5A 3QZAA 1ME8A 3DOPA 3GHUA 4W7WA 3RM4A 1UBPC 3LY0A 1G9HA 4PN2A 2Y2WA 1XD0A 1HL2A 1M1BA 2IS7A 3D3AA 3TNBA 4DXKA 5HPCA 2RGLA 5E9AA 1UR9A 1F8WA 3WF4A 4OHQA 5LIYX 4AX7A 2R91A 3P8IA 1TTJA 1G0CA 4LPCA 3AFBA 3HF3A 3LHUA 4NG3A 1KGWA 4ZENA 3LTSA 1BFNA 2CXEA 1VRXA 4RV3A 4JQ2A 3L5AA 2CPUA 4MY9A 4WOQA 1E73M 1JNEA 3F2BA 4K6AA 3EWCA 3E2VA 4UNIA 1Q2RA 4GYPC 2X1SA 3V35A 3WMCA 2NX1A 2LLEA 1JDAA 6A3HA 2WCAA 1IT0A 4GNVA 5EMJA 2QCCA 4A3YA 2ZRZA 2WC3A 4BI6A 4IICA 1IIHA 4FA3A 1U1HA 2KZHA 4JEJA 3AZRA 4LU0A 1A3HA 3EA2A 3D9XA 3CUIA 3W4RA 1UJQA 1Z9AA 2CYGA 3TCSA 2ICSA 3VCCA 4Y9AA 1Q45A 2O9PA 3SCPA 5BCAA 4KFPA 5JBFA 4QG8A 3WBXA 3WLSA 2GUBA 3UJ2A 2PTYA 4JKKA 2OTDA 4F0RA 2CLOA 3WQGA 4KGJA 2VEFA 1HUVA 3G8RA 3UWEA 4L56A 5AYYA 4EMJA 1BG4A 2OQLA 4QISA 4HHHA 1X7IA 4Z1BA 5HQLA 4F9DA 1QRQA 4IFKB 1B1YA 2CLMA 4ZSUA 1VYPX 3O6AA 4WXZA 1FHDA 1FH8A 1BTMA 1WBJA 2GOKA 1WDRA 1JI2A 1XLBA 4G8TA 3FSTA 3TC7A 4IXXA 1Q4WA 5I78A 2V82A 4YCOA 2OCZA 2PDYA 4IQDA 4M3PA 1PDZA 4CKQA 1DIKA 1W2VA 4RE3A 1HFBA 4H83A 3D5HA 4PMUA 2VL4A 2WMJA 4EOUA 3SAZA 2BGNE 1NHSA 1ZK7A 2QV4A 1LQAA 1HJUA 1TJPA 1GSNA 1EDTA 2V2DA 3IGHX 3BW2A 3WZ0E 1XWYA 2FLIA 1AL8A 1I75A 5E9XA 1RBOB 3CV1A 1K8XA 1JZ8A 3LADA 2Y7EA 2WXDM 4DJFD 3W00A 1XXXA 4HNVA 3THUA 1GYLA 4DYJA 1R3WA 3LCLA 5D38A 4DO4A 3DAQA 4NY2A 5F1UA 1YBQA 4ZQNA 3GQYA 5D8ZA 1HVXA 4H01A 1LCOA 3AYTA 4L1WA 3GM8A 3IIZA 2OELA 3B04A 3L2LA 2CNCA 5G1TA 4W7VA 3C5QA 4TX6A 4DAFA 2P1FA 4JTTA 3M0IA 1EXBA 4V1YA 1UB3A 2I7GA 4DYEA 3OA5A 1CB2A 4H6QA 5JRBA 3GRIA 4Z08A 4UXDA 5KSWA 1XQLA 3CGEA 2QPSA 1XUUA 1TZZA 4HNLA 3SRDA 1R7OA 2W61A 1YDOA 5LIUX 5A94A 3GZ3A 1FWWA 3PJWA 4IZGA 3QMTA 1RVGA 4EPEC 1B3XA 2UV8G 1E6QM 2V5JA 1N60C 3BOFA 3A9IA 3VUPA 5CPMA 3B0YA 5EY5A 4F8XA 2NV2A 4UQ9A 3IIXA 1LLZA 3HQPA 1IWPA 3OIXA 1XJBA 3POHA 3A9BA 1E40A 3DFTA 1CPUA 4V28A 1VFSA 1V02E 4IPPA 4H8HA 2HXUA 4M80A 1NQ6A 1D2KA 1EPXA 2WZEA 2Z28A 4JTGA 4H8NA 1KR1A 4YJ5A 3M0JA 3P0XA 1O94A 1GPWA 4LAMA 3RIKA 1T41A 5JH1A 5BXTA 3L4UA 3HG3A 3PTQA 4QG6A 9XIAA 3MWCA 3IUHA 1YMYA 1A4LA 1CXLA 3A4WA 5ECUA 2UY3A 3GG0A 4E2VA 2WNNA 3N34A 3O15A 4AIUA 5G2HA 3Q2DA 5FKYA 3SEPA 2QKFA 4MKNA 3RUBL 2EPOA 1DWFM 2JQXA 2BWGA 1NVMA 1FWIC 2PRMA 3A24A 4IL2A 3LYEA 3PG6A 4UZUA 1XKYA 4YTUA 1ZKQA 2C6QA 1KXTA 2WOWA 2CLFA 4JX6A 3H2EA 1DIOA 3IJQA 3NZGA 3ZJKA 3SN1A 2WBGA 1R9XA 4E3TA 3BK0A 1R5YA 4LEFA 1VQTA 1REQB 1XLLA 2WZIA 2TMDA 1BLIA 3AXMA 1Z44A 2POTA 2GR3A 2X1IA 4XWUA 1JULA 2WCGA 4DZHA 2NQLA 3QY6A 1CLKA 3PZOA 1O60A 3L7RA 3PZGA 4IIBA 1B3OA 1XG4A 2VO5A 4YYFA 2OR2A 3BG9A 1TZ7A 4I90A 1MEWA 3WUEA 4OE7A 2D3NA 4PMQA 4R88A 2XPKA 1DQUA 3WD0A 4PTWA 4ZOEA 2WBKA 4IHCA 4TU1A 3RLUA 3RPDA 2WM1A 2CWNA 3WH9A 1QOPA 4RL3A 2BXZA 1VBUA 3KBNA 4D6CA 2R9ZA 4HK5A 2XN0A 4XO7A 4XV0A 5H8UA 3OOQA 2Z24A 4B16A 2QJHA 3ZO9A 2AL2B 3S1UA 2VEPA 4HN4A 1Y65A 1D3GA 3N2OA 1X1OA 1AJ2A 3JRKA 5AFDA 4E5TA 2H3DA 3ZM8A 3RR4A 3WLMA 4C6BA 4FNTA 3P60A 2C0HA 2GUUA 3W7PA 3A7AA 2ZZ3A 5G1MA 1XLMA 1TJ0A 3EDKA 4MWAD 3LPOA 4IQLA 4ERGA 3EXTA 5BMXA 1XBYA 2ZUWA 3H12A 3QKZA 1K9EA 4Q8OA 4XD6A 5AC5A 2W67A 2GJXA 4CCZA 3TYZA 1F07A 3B0XA 1JPDX 4CEUC 3K8KA 4B2DD 3S46A 3F4NA 3DK9A 1YW1A 2VEGA 3GTNA 1WX0A 1L9WA 2P3EA 4CD5A 5DN1A 3DFYA 1V5XA 1V0LA 5HULA 3VMNA 3W71A 3Q37A 3V5CA 1BSLA 1BAGA 4GIYA 4E4PA 2V69A 3EBVA 1BYCA 4R27A 3VVGA 5D32A 4HU0A 1L6WA 2IPFA 3F1QA 3F4CA 3MSGA 1PWMA 2EG7A 2A3EA 3OHIA 3HOJA 1AFSA 4DEFA 1MNZA 2C19A 4ONVA 1ZAJA 2WPBA 2F6XA 1HJQA 5F2GA 1F3XA 3QQWA 2V30A 2O56A 4XIMA 3ARRA 3DH7A 1K8YA 3TTOA 1YADA 5H1WA 4MUPA 3OVPA 2YDRA 2Z1BA 3TJXA 4BQ4A 4FF7A 4GIAA 1Y5WA 2ZDRA 1VRDA 5CGTA 4FLQA 3W02A 4NNBA 2V5CA 1TX2A 1A5OC 2V3AA 1EP1A 3WQ5A 3HB9A 3VI2A 1GRGA 4H41A 3DKJA 1I9CB 1Z3NA 1P6WA 4WVXA 3WLLA 1EBGA 4WSHA 4XAFA 3EMCA 5KZDA 4UWMA 3UA4A 3S42A 3QR3A 3GW0A 3QPZA 1YXDA 4PMJA 1BD0A 3PP7A 4LEQA 4PODA 4LUTB 4IGMA 4GA8A 5M3WA 5DT7A 3AYSA 1IZJA 2ZRVA 4R7OA 1EX5A 2DZSA 3WH7A 4JN6A 2EAWA 3VKDA 1GVQA 4IT1A 3LUTA 4J3VA 4GE8A 4I5UA 3U8GA 4DWSB 4R33A 3N4EA 4JY8A 3RLHA 4RDZA 4IIEA 4M7TA 4PEEA 2JBMA 5I5RA 1HP4A 1QHOA 1F73A 5GJPA 3G1FA 1IEWA 2ESCA 1W2PA 4PBEA 3BE7A 3F5KA 4CCDA 3MB9A 2W66A 2ISWA 2REQB 1E6RA 1I8JA 4W8AA 1GQKA 1LRNA 3MMUA 1TYGA 4GIEA 4PMOA 4PR4A 4AHQA 3TMQA 1EYEA 2PDMA 5C7HA 4H4QA 1Q6DA 2QF8A 1XGZA 4JFVA 4IIDA 1JDCA 1J01A 3CLWA 1IXOA 1EJ7L 4S38A 2BZNA 3CV6A 3SCRA 4PUJA 3VDGA 1WUFA 3NXLA 1VGAA 3FS2A 1XD1A 5KZEA 1GREA 2HQAA 3ANYA 2EPMX 1PYMA 3HGJA 4IJRA 2PDJA 3TE9A 1NDYA 2OSYA 3FY1A 3VO0A 2FVLA 3O05A 4GJIA 1LL6A 2Z7KA 3W7EA 1QBBA 2HVOA 3UEQA 2E6DA 4L1XA 2H9AA 4ZE5A 4QQ3A 2GR2A 1LOQA 4LJ3A 4WDTA 1A5AA 4AIEA 2X40A 2WSKA 4OV4A 3U5UA 1JQXA 4E4UA 2X0YA 1VC4A 3OB8A 3TYAA 3MY9A 1YHTA 2DIEA 2PLCA 3GC2A 4OTKA 3VGBA 3SJ3A 3W7CA 4J2PA 2J74A 3KTCA 1M41A 2BC1A 1G4EA 5A8PA 3UJEA 3WD4A 3MANA 2GVGA 3TROA 1E0WA 5D37A 3T1GA 1QAPA 4BI7A 1TUXA 1FKWA 1H3GA 4GQQA 1H61A 4C6MA 5C7VA 4YIWA 2QS8A 4GFSA 4IGSA 1RVKA 4XK2A 2ZVIA 3BMWA 4MYXA 3HMJG 4RXGA 1P43A 3GTXA 4IL0A 1KV8A 4FIQA 1YNPA 1BWCA 3LA4A 1GVSA 2Z1KA 1ADSA 1EIXA 1V3KA 1CXHA 1TPC1 5LA1A 1X2HA 3SUVA 1A5NC 1IEQA 1KM6A 3S6TA 3DGBA 1XRSA 2G3MA 3SY1A 4UFIA 5K9XA 2XM1A 3TIMA 1YNYA 5A6AA 1UA3A 3HG2A 3DFSA 4UMBA 2OSWA 3K30A 2J79A 4P7LA 5E70A 3NDYA 1FWHC 2ZUUA 4AF0A 2E8YA 1F76A 1GW1A 4HSNA 3NFUA 4NNAA 1M9HA 4UR9A 4W93A 4NKCA 2ON3A 3HTWA 1VCVA 1L8NA 3NQDA 3AXHA 4JKMA 3ATYA 5D2WA 2WVUA 2E5AA 3WH5A 1FDYA 1DE6A 3DI1A 3VIIA 8A3HA 2PU1A 4DJDC 2GSEA 2ZQ0A 1LP6A 3T8QA 1IT7A 1W5QA 1DQWA 3URBA 4HSOA 5FF3A 1G67A 3S1WA 1W6TA 3GDKA 3NZ1A 1I2RA 3H7VA 2DSUA 4K36A 5FJJA 5IHRA 4AMAA 1XISA 3WK1A 5KMYA 1XC6A 3SR7A 4RZ5A 3FXYA 3ARWA 5I0DA 1PV8A 5I06A 2WMFA 2YZ5A 2BOEX 3R0UA 3AU6A 4HU4A 3M46A 2B81A 1HKWA 1ZAHA 1EIBA 2AAAA 2Y6ZA 3WQPA 2PTXA 1XIDA 1U5JA 4A3HA 2VHLA 4AISA 1JL8A 4N2YA 3A5FA 3FA4A 3HG4A 2HZGA 1OFRA 1PX3A 1OWQA 1SO4A 3E0LA 2W3ZA 4B4HA 1F6PA 2QUMA 2RABA 5CBIA 1ZLPA 1W9VA 5KITA 1C7TA 3T4WA 2O4QA 3RF9A 1S46A 3H21A 5JCIA 1BGAA 5LIXX 3DFOA 1XCFA 1RJRA 4KWUA 3MT1A 1ZMCA 4LUIA 1YTEA 3PZNA 1W1A1 5EL1A 3STGA 3ZT7A 5K4XA 3LRKA 1W1TA 3T07A 1KCLA 4H2CA 3PFRA 1JAKA 1JCLA 5IDZA 4LB4A 1KTCA 1PL9A 3BSHA 3W0KA 3BC9A 3NM1A 1DWGM 4ORIA 1XRFA 5A8MA 1YIXA 1R47A 4G7EB 3UT0A 2BS9A 4Q7BA 5EMMA 4A8NA 3MVTA 1SSDA 2ALRA 3ITOA 5JVLA 4DJEA 3POCA 3WUBA 3KS6A 1T0OA 4F0LA 2PTDA 2OYKA 3W86A 3AXKA 3E38A 2J62A 2YXOA 4N4PA 4AAJA 2Y5JA 1DJXA 2OYLA 3EKLA 3LB0A 5FF0A 1TPVA 3JW7A 4AD2A 1DIEA 3AISA 4QDWA 2JE8A 2XFRA 4KFOA 4URIA 2PDGA 4JTAA 1NEYA 4TVWA 3M4HA 2J27A 2X41A 3E6EA 1MUCA 5CPLA 3QV7A 1V8EA 2Y8VA 3RM8A 4O1FA 4HCHA 1AL7A 4ADTA 3M16A 1E9LA 2DZBA 4M29A 1TWIA 4NZCA 2ZXAA 1KR0A 2WOIA 3ARXA 3USBA 2EQ6A 5BROA 3IK4A 1RV8A 1Q6QA 2DGAA 1E0XA 4AHOA 3PAOA 3ATZA 5H2ZA 1O6IA 3GIQA 1EZWA 4HA4A 4PUWA 3EXSA 3CIXA 1RK5A 5EA9A 3RX2A 3VNZA 1FWCC 3WQVA 2V68A 1UP0A 1WXYA 3SR6B 4HOXA 4MWAE 5GNXA 3PPFA 2DW6A 2XJ7A 2QMKA 1KFCA 4FO4A 1QNQA 3O0FA 1IGSA 1HKVA 4L64A 1EWDA 2YCIX 1R8LA 4MLRA 4BJHA 4WDXA 2YCKX 3U2CA 4OV9A 3VNMA 3GVWA 1JNDA 3K13A 3T0AA 4AXNA 2ABAA 5GPRA 3QHMA 1E70M 4K8HA 3NL2A 4GYPA 3GIYA 1V4YA 4NJIA 5TD4A 2AAQA 4H9UA 4HYRA 3W82A 1JUKA 1GWJA 3DDMA 5I3IA 2BFGA 2P0OA 4IIHA 1GQJA 4JFSA 2ZXQA 1E55A 4UR7A 3CQJA 1LLOA 3CGDA 1ZJIA 1I60A 4NU7A 1V0KA 3EX2A 4HMDA 2ZWYA 4U3CA 1LM1A 1ZXIC 4JTFA 3U2EA 1E6NA 3AIUA 5D9PA 1HJXA 1OB0A 4GY1A 1DQXA 1LDCA 3BVJA 3DI0A 3EDFA 2VZUA 1OT2A 3NQVA 3QLLA 5K3VA 5A5WA 4ML4A 3M7SA 3WENA 3M0KA 1JYXA 2O92A 3PB2A 2QUUA 5CGQA 1E56A 5BOOA 2DV0A 3IARA 1DHKA 2C16A 4DJFC 2VX6A 4Q22A 2D20A 1GOMA 3VD3A 3CO8A 2BVTA 3KHDA 3OVGA 3M43A 5XIAA 5HR7A 2FDMA 4FLOA 1SR9A 2PDQA 1XLGA 1LBLA 4A8IA 2P5NA 5AKQA 2FMOA 3EB2A 4IQJA 4J3WA 1XFBA 3OG3A 4NAFA 3Q94A 1OX4B 1P7TB 3D6NA 4V15A 3ZR6A 4D6DA 1QI3A 2PWVA 5HNTA 2CU0A 1HGWA 1ZX9A 1GRTA 4O12A 4H1ZA 1YTKA 2ZKMX 3QQ1A 1UD3A 2BXYA 1ONXA 3RHGA 2PDNA 5EYWA 3R89A 4H00A 3GTHA 3EB4A 4Q8MA 4PRTA 3VZZA 4DJDA 1QWKA 8XIAA 4JTEA 2JIEA 4X3ZA 4DHGA 2DT2A 3NUKA 3ORWA 4DF1A 1TVPA 3UG5A 3CXBA 3BUVA 1CI1A 2I14A 3T2PA 3EX1A 4G7EA 4DBUA 4HCLA 2BVWA 5A6TC 1GQIA 2PPGA 4KQNA 4H4VA 3CWOX 1UWIA 3H7RA 1NIUA 5HJLA 1NHRA 3BXWA 4RX0A 1JD7A 2X2YA 3THQA 3NDZA 1LUCA 3NA8A 2RKXA 4BFAA 4QJ1A 4WEVX 2CFYA 2AL1A 3LSBA 4YYCA 4IIFA 4FOJA 1JGMA 3DECA 5HNUA 2PP0A 2ACQA 1PX8A 4TXEA 3W9ZA 4EANA 3U9IA 4MNLA 2P8CA 4LVFA 4W5ZA 1RZMA 3RGTA 3N12A 2WPGA 3UGVA 2QCDA 3F4VA 2VEMA 4B3LA 4BHYA 5IHSA 3HV9A 4N7QA 3BAWA 2BB0A 3RAOA 2XH7A 1DKWA 1GORA 1M65A 2W27A 3KXQA 4D9PA 3MJMA 4NNCA 3VOFA 1XCWA 2E09A 1VEMA 3NZPA 3W1TA 4JN8A 1VFLA 5A69A 3UG4A 1KFWA 4NZ5A 2A5HA 1PPIA 5G4HC 3KL3A 3HG5A 1P48A 5HNRA 3ZS4A 3KCOA 2FHCA 5TIMA 4RPPA 4QCFA 2D3LA 1SB3B 1EBDA 4NYUA 1TRDA 3WX7A 4O13A 4QLLA 2NX3A 3IGSA 5I3FA 3WELA 3H55A 2TRSA 3L66A 4A2RA 1W1IE 4HB7A 5CPNA 3RX4A 5FI8A 4CQ8A 1DIDA 3C0SA 4ZXOA 1RBLA 1ZSXA 4LTSA 4E8CA 2B7QA 1VPQA 4JIRA 4P5UA 3DZ1A 3LHYA 3R8RA 4L9XA 3IJ6A 1TQJA 4UQBA 3DC8A 4UTTA 3UR2A 3B06A 3AIWA 2P88A 5HMEA 2NVCA 1U22A 3DGRA 3E3HA 3GUWA 4XAGA 3UA3A 3KLJA 3EMZA 1W3NA 3OGSA 4PB5A 3ABXA 1NHPA 4I9JA 1W9XA 1I2OA 3GNPA 3L4TA 3LXCA 1T8QA 1GHRA 2FZBA 2CZ5A 3QBUA 5U7SA 5FJIA 5KINA 4N6FA 1H1NA 4M51A 4HCDA 1XIJA 1A5LC 5DBUA 3OG2A 4QDMA 5GJMA 4JIHA 1HL9A 4NVTA 3QF0A 2A7RA 4S2BA 4FAMA 1F3WA 2WV8A 1J2BA 1P6BA 3AXIA 4B9ZA 4DQWA 2XGIA 4HK6A 1TV2A 1AMKA 4PMNA 1UR3M 1Q1WA 4CNSA 1DJQA 2PDKA 1FDZA 3GNXA 5CC7A 3L65A 3KOWA 4QS6A 5CJNA 1JPHA 3A4JA 4U10A 4BF5A 1TA3A 4JZ5A 5HDRA 2IXUA 3REQB 5C2GA 3LTPA 4UMAA 1JZ7A 2NPXA 1OFPA 4ZQCA 1T7LA 1L8PA 1XH2A 1UC4A 4NYYA 1QHPA 3GBEA 3NTYA 3DK4A 1JCJA 4L80A 1Q6OA 4HBKA 3G1RA 1VS1A 4GKLA 2Z1VA 2FQIA 4L6DA 4FXFA 5AC6A 1GKQA 4EX4A 1LZOA 1UUOA 1BF6A 1IT8A 1Q6RA 3DJJA 1KXVA 3H24A 1DXLA 1K9DA 1B5TA 2OKOA 2C1HA 2W6RA 2ZRUA 1ELSA 1NOWA 1YDVA 5JU6A 1QI5A 3RO8A 2Z6JA 1EX1A 3LXDA 1DXFA 4GI8A 3EB3A 5DMLA 4Q4MA 3IC9A 4DY1A 1ZBKA 4KF1A 1L6FA 3WUGA 2ZTJA 1JDEA 1Q2SA 2DP3A 2HS8A 1LOLA 4JTDA 3LHWA 3VPLA 1YE4A 1GJUA 1KQZA 4JCMA 1ONRA 3ES7A 3TYUA 3EPOA 1HJWA 2UZ9A 4GBUA 3V0TA 2X99A 2H9AB 1IZKA 1FXQA 5F4WA 1EEPA 1VYSX 1IV8A 4RPQA 2NQZA 4UQCA 3GXIA 5FCZA 2DSWA 4I6KA 1C8YA 1FWSA 2JFEX 4DO5A 1GZGA 2FFCA 3COTA 3WK2A 1IEVA 4OUEA 1TWWA 4KMQA 4EXBA 4PZVA 2WAGA 5M5DA 4GZIA 2OGJA 5T91A 1RHCA 4AG0A 5GJNA 4AB4A 4E6MA 3AZSA 1UUMA 1XRTA 1N7KA 4KETA 1J8VA 4WD0A 1IGWA 1VFFA 4R7WA 3W22A 1XLCA 4QG9A 2X7VA 2RGMA 4YWOA 1KFJA 4O17A 2ACSA 3NG3A 2OZTA 4PE8A 2GK1B 4PUDA 3GVVA 3UYIA 5DXXA 4FX6M 3DUGA 1QK2A 2DIKA 2XIOA 4MF4A 2Q6ZA 2QVNA 3P14A 3SUTA 5A6BD 3LCHA 1JZ2A 3CQIA 1UP2A 4D71A 2C71A 3TP4A 3UZXA 2DZAA 2WHJA 4DO6A 1JXKA 3BW4A 4GACA 4EKJA 1QNRA 1FP9A 2CBIA 4LWWA 1GZ1A 1I1WA 4AEOA 4G7FA 3TLLA 3VU2A 1M5WA 1JZ4A 5L9FA 2HQMA 3MKVA 3VDBA 2VZVA 4L61A 3DYPA 2NXHA 1V79A 2UY5A 2X8RA 1GOQA 3MKKA 3AUJA 2FZ8A 2J7BA 2F61A 3ITCA 4TMBA 1Z42A 3FSUA 1GQLA 4YTRA 1TO3A 3RG6A 1X96A 3QLDA 1FBAA 1VQZA 3AZTA 3VA8A 4MFDA 3P80A 3RJXA 4A05A 5TF0A 2YX0A 3WUFA 1KRCC 2GGHA 5C54A 1EC8A 5BXRA 4NRRA 1O1ZA 2XHYA 1Q6CA 3GC4A 1OFQA 4S39A 4JICA 3W85A 4LNCA 4CCCA 1UWRA 3S5ZA 2VVSA 2Z7GA 3FGCB 1N5XA 3GDTA 3TQVA 2GLKA 4BR1A 1OD8A 3BMVA 4GXMA 3CHVA 1MQQA 3LRLA 1OX4A 2QJMA 2NQHA 2OFJA 4WJ8A 5CZJA 4L9YA 2GDUA 5U4NA 7REQB 1V6YA 4AZCA 2X8CA 4LYKA 3ARSA 5FA5A 2WKGA 4H9ZA 1JPIA 4APNA 3WLTA 1ZZMA 3ONCA 1RK6A 2E3ZA 1QATA 3C2OA 5EGRA 1GJWA 1GT8A 1JCMP 3PG8A 8RUCA 4AZIA 4QJ5B 4H6RA 3IVUA 2PP3A 1PKNA 2QULA 1UIPA 1K02A 3DHPA 2ZUMA 1W31A 1XDJA 1UKPA 1AVAA 3MC5A 2DT1A 3NM3A 1YNQA 5B80A 3TLQA 3MUZ1 3FJNA 1VBHA 3BDKA 4Z1DA 4DWDA 1Z32X 2D2GA 2DY3A 2W3SA 2CFFA 3OYZA 4AFYA 1EC7A 4XZNX 2JK6A 3MHUA 3O63A 4QRNA 3W26A 1MEIA 3KAOA 3LMZA 2NXIA 2XIJA 5FMHA 1W54A 1UKSA 4OT7A 1YYAA 4LUYA 2F8QA 3GKAA 3RLGA 3W74A 3UW6A 1E71M 1K3UA 2AAMA 1OK6A 3HBLA 1CGYA 4HKPA 3OQEA 3RMEA 3DXIA 4EM3A 2ADAA 3L4ZA 1PO9A 2V3DA 2GWGA 2XUCA 4JIPA 4LYRA 2PP1A 1FH9A 3ECQA 4C6LA 3VZYA 1FIQB 5MKGB 4ZMGA 3B8IA 5A95A 1P1XA 1UOKA 1JF6A 5HK4A 3EAOA 1ESWA 3M41A 1ZY8A 5IOBA 5FSDC 2XVPA 3SGUA 1V3IA 1AD1A 2NT1A 2YYTA 3G1XA 1WXZA 3IS4A 3M0HA 1HXJA 4QGCA 4MB5A 3PUOA 3ZSSA 2OO6A 2QIIA 1JD9A 2R1KA 3BV7A 1K8ZA 1Q8JA 5GRTA 3G18A 1XLIA 7A3HA 4J9JA 1ECQA 1SMDA 1N55A 2FIQA 2NUXA 1SO6A 4NXKA 4GI9A 4QEEA 1R86A 3DESA 5AC4A 3GLCA 4LT9A 1B4EA 4Y8FA 1US0A 3WEMA 3OVQA 2V63A 2QCEA 2BY3A 2ZA3A 1B57A 3NZQA 5G2IA 4HPGA 4D6IA 4EQSA 3ABZA 3CZLA 1KWGA 1FWAC 3NQ8A 5CJMA 2DH3A 3V5OA 3TW6A 3BTNA 2AGKA 4R85A 4YHEA 2QCFA 3PF3A 2HISA 2VFGA 4QHRA 4LGXA 3M0ZA 2FVMA 3BJTA 4DBDA 1TV5A 1GUVA 1D3CA 1LLWA 3UNDA 3PR2A 3W7OA 2OLAA 1L2QA 2B7PA 2YDSA 1TVNA 1KB3A 3LSCA 1CIUA 5IFTA 1PKYA 2VT0A 2WKJA 1EJRC 3A3HA 3N18A 4HT3A 1OFBA 3AS2A 1J0IA 1TWDA 4QX4A 1S2VA 4QSFA 1UP3A 1WP6A 5C9XA 4O15A 2GDQA 3PBGA 3UWYA 2A3LA 4PEKA 3N6HA 3TR9A 1ZS2A 1ZDLA 1B2YA 2PBOA 4MWAA 3BCJA 2OQYA 1RCOB 4JCLA 5AYZA 2XGBA 1QNSA 2XISA 1TREA 2PI6A 1Y5XA 2A79A 1VENA 3CAQA 4HA3A 4E3VA 2QW5A 3GH7A 4JFWA 1FFRA 2NV9A 1KGUA 1R30A 4EVZA 4FLSA 4LCRA 3TWAA 2PC4A 2C3DA 3QOKA 3OU8A 1M7JA 4CU8A 1FH7A 3IVSA 2OU4A 5E93A 4HNTA 3WH8A 4GO8A 3AHVA 1QK0A 4RNIA 1M53A 4Z2IA 3R13A 4ZB5A 1E6ZA 3KVLA 4QTGA 1T96A 3VNYA 1ICSA 4RR4A 3NR0A 2WP5A 1ADOA 1V03A 5C8BB 4GPNA 4I3GA 3OGRA 3SCQA 5JH2A 3K4AA 3W2MA 1HNYA 2OZ3A 3WEZA 2C91A 3NCOA 3RM9A 1V59A 4LBUA 2NUWA 1GG0A 3PUGA 3GX9A 1J11A 1XYFA 1D7YA 3GB6A 4AVFA 4UOQA 1JXJA 3R11A 3O8AA 2ZUNA 4ZB0A 2VEIA 3AS3A 3MUCA 1X8FA 5DRCA 3ITYA 2QIWA 3PWAA 1OHLA 2X2GA 1O5RA 5JCKA 1VPXA 3VOJA 1TA3B 1NOFA 3B8SA 4IIGA 5BMWA 3L5OA 2D22A 1UR2A 3UESA 5D30A 3V4BA 1BF2A 1SM9A 3EA3A 4KT2A 2Z29A 3W28A 2XFYA 5G1YA 3DG3A 3EYPA 1NFBA 3RYSA 5A8OA 4IMGA 1KTNA 1MNSA 4AEEA 3CGCA 3LS9A 4AMCA 4BQ5A 1KCXA 3TOYA 1BHGA 3I10A 4H4SA 1C8XA 5DY3A 1V3JA 1M04A 3W23A 1S38A 5TNVA 2YL6A 4OJYA 3PTKA 1WB0A 5GVJA 4NX5A 1XDMA 1UPMB 1XS2A 4A4AA 3LI0A 1RY0A 4QBXA 5A6JA 5BRPA 1EPVA 1MRQA 4AWSA 4E0CA 1K7EA 2E9LA 3BQ6A 4MADA 1PBGA 4H9VA 5CAKA 1UD6A 2Z1XA 3XINA 3WEOA 3W73A 2HS6A 4PMYA 4NIRA 5BRBA 2WZMA 4D6JA 2X05A 4HU8A 2PDUA 3WQOA 3FVMA 2PWFA 5JMUA 4P8UA 3C8NA 2VFIA 4TOQA 2F6KA 1XLHA 2OEJA 4F0MA 3NL6A 3U0HA 3SCNA 1Z8AA 2WVVA 4ASTA 3TK7A 3TN6A 4B2DA 3FV9A 2E8ZA 3T44A 1ZJBA 2W54A 3ANUA 4KPLA 4K7VA 2XN2A 1NWSA 5HPOA 4P8XA 3SO7A 3EWUA 3TDFA 5C0QA 4C90A 2XYLA 3QXBA 3CUZA 1BRLB 4IFRA 4JTHA 3CH9A 4Q4SA 2OKTA 3QN3A 4AWTA 3SGGA 3IPWA 4NUWA 4BS0A 4GABA 1WDSA 1NH6A 5D02A 1DEDA 5FSEC 3TC6A 1OG0A 5AYBA 2VNCA 3BW3A 4XZBA 3ZVHA 4N9EA 1MQRA 3L5LA 1FUYA 1GPFA 2OXNA 1HQTA 3R0KA 2PDWA 1PS9A 4RV8A 2EKCA 2PURA 2PWHA 2RDUA 4XKMA 4Y9NA 5BRQA 5AN7A 1OFDA 5G2WA 3OP2A 4US5D 2F38A 2Y70A 5ER0A 1MVYA 3O2LA 3NYDA 4FALA 3NQ7A 4BKNA 1LRQA 4J3SA 2VZOA 3L23A 3NZRA 3LQLA 4V2XA 4L7ZA 1PX4A 1BXCA 1BWLA 5I3DA 2QZRA 3EX3A 4MTVA 2ZUSA 1XPYA 2YL8A 1WAUA 3S2MA 2HK0A 4Y90A 2DUXA 1OINA 5CSRA 2I57A 4KWWA 3QFEA 7TAAA 1J10A 2J6VA 2OEMA 3BH4A 3WNPA 4YMZA 3SRKA 5GNZA 4DWSD 4AZBA 1FWTA 1EGMA 5H8PA 1R7AA 4MDOA 2Z4GA 3BLOA 4TUFA 5FOOA 1C92A 4P7QA 2I5QA 4DUOA 3LQGA 2GSJA 1ZGDA 1CDGA 5TR3A 3REQA 4GX8A 4U31A 3Q4DA 3IEBA 4H04A 4GCXA 2ZX5A 4U2YA 4B5NA 4GI6A 1JCTA 2Y7DA 1GOIA 1UZ4A 4HA0A 3LU2A 3GNNA 1J79A 4JDYA 4D6GA 5F4XA 3VNKA 5CLTA 3VNIA 4X63A 3AM9A 3G77A 2C8NA 1E1CB 1XLKA 3ZYZA 2XTKA 3CAWA 4ALDA 2W5FA 4UFJA 3L9CA 2FGBA 1XKJA 4MZ8A 3V7PA 3UFYA 4DRSA 2B31A 2VEKA 2ZRWA 3OO2A 1UJPA 3MP4A 1CCWB 3UZYA 4GXPA 4IISA 3S0CA 1OGBA 2G41A 1H6VA 3PWGA 3R5EA 2VYOA 1H2IA 1A53A 3IJLA 2A4AA 4DX3A 2BC0A 1OC7A 2E1DA 1O68A 3VNJA 1O95A 6XIMA 1IHIA 1N82A 3HQOA 2V5KA 4JNZA 1GKPA 3A7UA 1LOSA 5HNNA 2YFNA 2WSQA 2PD9A 1TMHA 2J13A 4X2PA 4ZO7A 5E0CA 4TQTA 3WLKX 4JYEA 1MZHA 1JZ6A 2IMRA 2OQHA 2CLKA 3CHFA 2Y0FA 2P53A 2IQ0A 2W0UA 4Y9PA 4A8LA 1KGXA 2CZFA 1B9BA 3CMJA 3NWRA 1OG6A 3CGTA 2ZZ6A 2Y5EA 5D2XA 3H2NA 1NDAA 4LAZA 1OADA 4MJ2A 3E96A 1THFD 2E6FA 3URAA 4UTJA 2INZA 4WKFA 1NQKA 1A5BA 1WPCA 1XIFA 3W7QA 2DIJA 3KBVA 3OYXA 2PRLA 1TTQA 3ALGA 4C1NA 1UR8A 3CPUA 2GPTA 4YL2A 5CZTA 3MVIA 3NPWA 2G95A 3R25A 5FAJA 3DHUA 1XYMA 4ROPA 5FJUA 1LL4A 2CLIA 3GK0A 3PZMA 3LB8A 5LSMA 1Q66A 3SN4A 2FB2A 4U5IA 2HROA 5ABFB 4UTTC 4K8DA 3AIBA 2WCSA 3VE7A 2I56A 3TKFA 4XX6A 4C6IA 2YB1A 5KTLA 1AH0A 3VTRA 5T9CE 3CTTA 4B91A 5LYRA 2MANA 4XUGA 2FJUB 3NVYB 6TAAA 3N73A 1LF1A 4XZHA 4EF8A 4F66A 4AZHA 1KLYA 4S3JA 2F2KA 3BLLA 1QBAA 3AMDA 2E77A 1KM3A 1SSGA 5BWFA 5CZKA 3VINA 2O55A 3AMCA 5FL0A 1GYNA 3MP5A 4P8VA 4PMZA 3SB0A 4FX9A 3H23A 1SZFA 5CBJA 4B5SA 3V5FA 2PA6A 5LA2A 3H2CA 2EPKX 1DVJA 4YNGA 2ZC1A 1PIIA 4PCTA 4U5KA 3T0DA 2HE8A 3PHAA 4O11A 4CEXC 4MNKA 1TB3A 5AOUA 3MA8A 3WDQA 1PJ9A 4GI4A 2V5LA 3W83A 3AWOA 3WBEA 1UHVA 4KPRA 5EBKA 3ME3A 2GL5A 2J7FA 2WVSA 1ZALA 5DQPA 2EPHA 2HXTA 1MDRA 3C0QA 3OODA 2UWFA 3W84A 3BG5A 1Q4NX 5CSSA 1OABA 5AZ1A 3G6MA 3DJGX 1DP0A 1H09A 3FOKA 2Q09A 3W81A 4KBXA 2E9BA 3TN4A 3W7IA 3A3XA 3EWWA 2XZ7A 3TJLA 4GZEA 3LV5A 3KVJA 3WFAA 1Y5VA 3NQFA 5A8QA 3IJ9A 4UTLA 3ES8A 3H7UA 2YVGA 2JKAA 4PBFA 4Z2KA 4WX2A 4IJBA 1VBJA 1X2GA 1EJXC 4GVIA 2XZ9A 3VZXA 3DFQA 3FFSA 1SU5A 2Y4SA 4ZO6A 4AWUA 4LV9A 4UTKA 1AH4A 3HFYA 3KE0A 3SI9A 3PBWA 3QMRA 1OJTA 1CW2A 2FZNA 2OZ0A 3I6TA 1QO2A 2I9EA 4K7ZA 4H4UA 1E9ZB 4A22A 3RU8X 3WJWA 4WY0A 4ADSA 1XIGA 2EQ7A 3SUUA 1DJYA 1K70A 1UWAA 1X6NA 2OVLA 4FOKA 3RCNA 3BLEA 5I3GA 1UYQA 4E2BA 1JUEA 3NPUA 5EPDA 5LZLA 4DXVA 4UC5A 3P67A 1S7MA 3E1F1 4JHOA 4DYKA 2QNEA 3BLFA 2Z2UA 2EG8A 2GDVA 3BLPX 1VHNA 4C6FA 1EWEA 1O66A 3BGJA 3LLFA 1GHSA 3CL8A 3I7SA 3LX9A 4QP0A 4Q8UA 1F3TA 1KFLA 3U4FA 2HEJA 3BARA 1XLJA 1A0CA 2VRQA 4AYGA 1ZCOA 4W9TA 4X0VA 5I79A 4RE2A 3WD3A 5JXQA 2QAFA 4YVPA 3P6LA 3GE7A 4UTWA 3UXDA 1IQ8A 1QU4A 2ZADA 3IAQA 3V0SA 5AHLA 3EMQA 4M52A 3UZJA 1OY0A 2DZTA 1B9ZA 1W3TA 3BWWA 3IK2A 4RZ4A 5KZMA 4I7UA 1QVBA 1NDVA 3J7HA 1S2WA 4PMXA 4D1JA 3MZ2A 3E2RA 5K2ZA 1FWBC 1VCFA 1VFHA 5ABEA 6ENLA 1TPEA 2ZFAA 3WLOA 4ZQRA 4PRRA 2FJKA 1J12A 1PTDA 4DN1A 3HRDC 1FQ0A 5EFFA 1G4TA 2IQDA 2JF7A 1F4HA 5C55A 1O4UA 1DL3A 1PIFA 1I2PA 2JEPA 2XSBA 3KM8A 1RJPA 4MB3A 2EGZA 3GFZA 2PDLA 3ZR4A 3VKKA 3VIFA 2YR1A 3BJFA 1MZRA 3QFAA 2C14A 4JKLA 1ME9A 4XISA 4YPJA 3QY8A 3MHFA 3NDOA 1UD4A 3IIVA 3EF6A 3W7GA 3MSDA 3VE9A 2F2HA 4UCGA 3QR1A 3VDAA 2PDHA 4MB1A 5AECA 4HJFA 1KA9F 1S2AA 2W62A 3ISIX 1IR1A 5C9RA 1TTIA 3THDA 1OSEA 1YQ2A 3ITTA 3L2MA 2KX9A 2HPMA 2VUYA 1OCNA 4S3AA 1OD0A 3FHQA 1AQ0A 1P0EA 1ZUAX 4L65A 1HKIA 4E2OA 4J3TA 3W7LA 2FZMA 4CD6A 1XR2A 3KBMA 1R87A 3D3FA 3V0UA 2D2OA 3KLLA 4JX5A 2I1OA 1WKFA 4Q4QA 3U7BA 4LS0A 4TIMA 3WLRA 2V67A 3IJ7A 3WDHA 1KWKA 3S3GA 3W1PA 1M03A 3ABQA 4ZGYA 2VI0A 2BG5A 1J0ZA 1YXYA 4O1BA 4QNWA 1ISXA 1RSCA 4KEUA 1MUMA 1LWJA 4HJWA 1TPB1 2INEA 3H70A 1IE7C 1DOSA 4RKAA 2Q8ZA 2WMKA 4PA8A 2J75A 4DM1A 3MI2A 1KO0A 5DX7A 1QTWA 1UWSA 3W1AA 1ZB5A 3KBWA 1OIFA 2IUZA 5D05A 3AI0A 3II4A 4C91A 2B0MA 1N63C 1HJSA 3ZWSA 4YVVA 3W1MA 3CUGA 2GYIA 1MMFA 2V3EA 3BSGA 1S2UA 2E5DA 1KFEA 4C6NA 3D46A 4W86A 1NWTA 1R3QA 2XIBA 1XGDA 4PCPA 1HJVA 3IRDA 3L12A 4GGBA 2BMBA 1A5MC 3BAXA 3MW7A 1RM6B 5HR6A 4AY8A 3TXZA 3ICJA 5C9ZA 3GRTA 3ABSA 4OOUA 3KX6A 2D2HA 3S1VA 3CUHA 1B54A 4XZIA 3VDCA 3Q58A 4KWSA 4WQ6A 4OWGA 1HTIA 2FHBA 1YBQB 2YJQA 5DMNA 2GQ9A 1OFAA 1VIWA 3TMLA 4K38A 2INFA 1CECA 2OSXA 4DM2A 3T9PA 4EACA 3OZPA 2FMNA 2PODA 1BXBA 3EPMA 5I3HA 3DX5A 5LXEA 2TPRA 4ZODA 4JYFA 5J8LA 3S9ZA 2WW5A 1K4QA 1H11A 4BEQA 3XISA 1SZGA 3VGHA 3HMCA 1BSIA 4JFTA 1W9UA 3ONBA 6REQA 4NT0A 3GWQA 1Q6LA 2CZDA 3PY2A 1FHLA 6XIAA 5EFDA 4CVUA 2AKMA 3SSJA 4DI9A 4JQ3A 1XUZA 4KEVA 2NQ9A 3MDUA 5G5GB 2E7FA 2BASA 4RDYA 2J66A 1FA2A 2EJAA 2HNEA 5JBDA 5KETA 3SCWA 3CYVA 4ZO9A 3LV6A 3G1AA 3VFCA 3NNTA 5CCZA 1WDQA 1AZ2A 4LW7A 3OQ8A 4XTDA 3W7MA 3CYJA 3QGVA 2A8XA 3BO9A 3KRBA 3N19B 4PUMA 1SW0A 2VJXA 3VOHA 4AIBA 1J93A 1E0TA 1P0NA 3HPAA 3P74A 3W6MA 4GVFA 1Q8AA 5HWNA 1R9ZA 4BI5A 3S2JA 3GAKA 3M5ZA 1GG1A 1KBBA 1X97A 2G4FA 3RPTA 5HMDA 2EF9A 2XGZA 3CB8A 1FWDC 2V9DA 3MWAA 1V0NA 1ZL1A 5KZ6A 3B05A 4DJFA 2WQDA 1E6XM 4KWVA 2VX5A 1L2UA 1JZ5A 1BQCA 4F40A 1OZQA 3PZUA 3CQKA 4JNMA 4Q4PA 4FI4A 2E1WA 1CLXA 4DZIA 2J47A 1ML1A 5ENLA 4O14A 4B15A 2IW0A 3L2IA 3N25A 2Y1HA 3ZJ6A 5HQMA 3KL0A 7ENLA 1EDGA 2DQXA 3WNOA 6REQB 1MWOA 1C7SA 1GK8A 1ISYA 1XHGA 4HMCA 4QIUA 3LTYA 3BLKA 5CGMA 4M1RA 3B8TA 2DSKA 2F5ZA 2O0TA 4A3RA 2PGEA 1AQFA 3V18A 3ZLGA 8CGTA 3VX0A 7ODCA 1ONEA 3EX4A 4XZMX 4TR9A 5AZ0A 2AGTA 5E0FA 3P82A 4TO8A 4GVHA 1PUDA 2ALDA 3CZGA 3II1A 4L4OA 1O7AA 1P1MA 2BP1A 4ZO8A 2DZPA 3W88A 4Z17A 4XAPA 3T0CA 7XIMA 1ICPA 1BRLA 1D8WA 2ODOA 1RPKA 1W1B1 3MQTA 4HYVA 2E3TA 3OC4A 3CL6A 3AO0A 2GVLA 4KCTA 2PTZA 4ZXLA 3T78A 1AZ1A 2YA0A 1TPDA 2DFAA 1XYAA 3VAVA 2EXOA 3K4WA 5AHNA 3KBSA 1N8IA 2XSXA 1WCGA 3WLNA 1TPH1 2YQUA 1E6SM 4HOWA 3TSBA 3WH6A 1ISVA 4C6JA 1MI3A 7TIMA 1CENA 3KLKA 4RNJA 1JG9A 3B3DA 1EC9A 2PD5A 3B8VA 2QPUA 1O1HA 3OLGA 2OMAA 3ETRB 1NHQA 5LGXA 1ZP3A 4C60A 4AC1X 3VOIA 3S5SA 1X38A 1F8IA 1Q6FA 3C0JA 1VZWA 3ARTA 1NTHA 3W70A 1P0KA 1DJZA 4EE9A 3SGZA 4N6EA 3G1YA 3S5OA 2FGZA 9XIMA 1GOOA 5AYIA 3WD1A 5LNSA 3AU2A 5A8GA 1GXFA 1AQMA 1S39A 3E0WA 1W8SA 4BF7A 4JIQA 3CU2A 2Y62A 3FCPA 3SSZA 3QW4B 1GRFA 2HRWA 1V0MA 4D2JA 5XINA 4I9MA 4AD5A 2ZZ1A 2A3CA 1GVYA 1VEOA 1ZNNA 4JDRA 3G24A 1R3VA 3HURA 3C52A 5DCDA 2L5HA 1H51A 4IXHA 4WSKA 1E1FA 2HE5A 4LYPA 1GESA 1DV7A 3SIMA 3W2UA 1SFSA 3MCOA 4OGZA 1NF0A 2E0PA 5G5IA 1UWQA 1VLWA 3MDWA 4AH7A 2J6XA 1RP8A 2VZTA 3RNDA 1Q1RA 5B7ZA 2RJGA 1GEHA 3FYOA 1JVNA 3K5XA 1IEXA 1GRAA 1EA9C 3AMGA 2XWEA 3HPSA 3RXZA 3UNTA 4C5ZA 2WOQA 1A80A 4AQLA 2IXVA 4TTGA 4FNPA 5EB8A 4GO9A 3S2CA 1QR7A 4UTWC 1JDDA 1IWAA 4J5NA 5CG7A 1GCYA 1ZENA 2YA2A 1F2JA 1M6IA 2GGGA 3PJTA 1VIZA 1DNCA 3GG7A 3DCPA 3RILA 3BZJA 2BBFA 3G5EA 1XDIA 3S2LA 2FZ9A 4KIEA 1XLEA 3P2VA 3CZ8A 3WFZA 4M56A 1IF2A 3LZ5A 3PJUA 3LENA 3N15A 4PTVA 2VGBA 3CJPA 1KM1A 3JUGA 2WC4A 2Y8UA 1U1JA 3CO4A 3I7QA 4NJJA 2ZBTA 3DYOA 3NPXA 4PRWA 3DHFA 3W2JA 1B30A 4AZ6A 1I0DA 3CPGA 4AUBA 2VTFA 3U6WA 2R24A 3DBNA 2YCEA 3UQNA 2EQ8A 1ZRQA 4REQA 2IPGA 2FKPA 1JZ3A 3DH9A 2J3NA 2HCVA 2CLPA 3EDDA 5DF0A 4CU6A 2TAAA 3EAUA 4MZYA 1DJWA 2QAEA 2G4JA 1H0IA 2DZVA 3GYCA 2GRTA 2PWUA 1MXDA 2VURA 3NSMA 4LUSB 4GQBA 3L67A 2QJJA 3BLDA 5HUPA 4AIOA 3WY1A 2ZX9A 1NM9A 1B3VA 4LOCA 1UA7A 2OPJA 4I5XA 2DZXA 2ZDSA 3CV7A 3I4EA 2JKEA 2E4TA 1WQ5A 5KVHA 3W1UA 1ISZA 4GY0A 4OBTA 4AHPA 1EF3A 1WO2A 2R94A 2X8HA 4V27A 3S6DA 4WRHA 2VOTA 3VIJA 4WY0F 1JCNA 1JF5A 4PUUA 1A3WA 4IG2A 2QDDA 4IF2A 5HJXA 3ELFA 1OM0A 4J40A 1CGVA 5AHMA 1OK4A 2V0TA 4UZSA 3EX6A 1KFBA 2YLLA 3LHVA 3W27A 1EB3A 4H7VA 1XYZA 3CM4A 1U2YA 3PB0A 4HPXA 3ARPA 2QEZA 3ARZA 4Q8VA 2I5GA 4ILSA 4H6EA 3APGA 3GAYA 1V3LA 2SFPA 3RCYA 6PTDA 1WZLA 1Q3NA 2Q8XA 4HZ6A 3W7HA 4YXGA 3FK4A 5EMYA 4Z2GA 4IOTA 1FCBA 4O1EA 4DLFA 3GR8A 3M47A 4MJMA 4S3GA 2PGRA 4GD0A 3WSUA 3O0KA 1F9CA 3ARYA 1W3KA 2ASHA 2NZLA 5FJPA 4TMCA 1W3JA 2CWXA 4F48A 1RQBA 4O0QA 3VNLA 4GHRA 1CXFA 3UPBA 4RK8A 2CLLA 3B0UX 3OVRA 2AMGA 4WKHA 2X42A 1US2A 3PNZA 5CPOA 3AAMA 1LBFA 1T99A 1CNVA 1YKWA 4H4PA 1QOQA 1QPOA 1CGWA 3BAYA 3H8AA 2QXWA 3MKCA 4PTXA 4RE4A 3KTSA 1DHPA 5H6HA 3W2LA 1Q65A 1S1PA 1CEOA 4B3KA 2GUYA 3NQBA 4AZGA 1L0PA 3MTWA 3JZEA 4XBSA 5C2CA 1CX9A 2R1MA 2VWTA 3E2QA 1BVZA 1BYAA 4U28A 1TG7A 2PWGA 1YX1A 2J88A 3N4FA 2TODA 5FS8A 2ZA1A 2ZTKA 4WF7A 1CWYA 5BNKA 1O5XA 4DBEA 3STEA 3FKKA 4EMWA 3UCDA 3ZWTA 2UY4A 1ITCA 3UGRA 4GCAA 1CB7B 4C1NB 2X0HA 1TIWA 3M6YA 3ERPA 1C8QA 1QI0A 1J18A 3URHA 3M6DA 4AZ7A 3VDHA 5DRIA 5FAGA 4QSHA 4MLJA 3TSDA 3B97A 3MS8A 1OQFA 4IPJA 3EOEA 4GVGA 4I8DA 4YVXA 5LA0A 4R9OA 2X09A 4GGHA 1X7FA 1B3ZA 2W9MA 1PEZA 1AW2A 1GETA 2ZCGA 3FJLA 3HFTA 5HANA 3UETA 3PTDA 1W91A 5BXPA 1GTEA 3N4AA 1Q13A 3H4WA 7CGTA 4KERA 2R9RA 5FJRA 4NRSA 3VOGA 1PZ1A 4KGLA 4EAYA 4B9YA 1T3QC 3T40A 3M0XA 2R1NA 3W87A 2CHRA 4Q8WA 1ZY9A 2VCBA 2QR6A 4UFKA 4B5XA 4ICNA 3CT2A 1O12A 1EP2A 1OCBA 4LS1A 1VCGA 1XFCA 3VD5A 3TTQA 5TAOA 3NQEA 2YIHA 3VGGA 4IPNB 3FXGA 1A47A 1SVDA 4UFMA 4US6A 3UJRA 1XH0A 3BAJA 4LBSA 4ORMA 4Q7NA 3M7WA 4H9TA 2VGIA 5FEZA 3VM5A 1GVIA 3RNMA 1DE5A 1K8CA 3O6YX 4GUGA 3CT7A 3WLIA 4K37A 1E3ZA 4W85A 3E74A 1KM0A 4LNYA 3NSNA 1K7FA 1QCWA 3INPA 4BQ2A 2E40A 3W1XA 2KAUC 3QC3A 2WM0A 2D23A 4QNEA 3QOMA 3C2EA 2QHAA 2VOMA 1QWGA 5DCBA 1ZBCA 3E0VA 3GH5A 2V2HA 3KOXA 1DWJM 3TW7A 1PE1A 3DGZA 1SQ7A 1RH9A 2XINA 4CQ9A 3Q6JA 1VR6A 3IANA 3AMZA 4G9PA 3FEQA 2DQWA 3GG8A 3HQ1A 2A3BA 1RUSA 1ISWA 3CXOA 3WK3A 3USZA 3W75A 1LWHA 5HMSA 4H4RA 1UPPA 2FFIA 4NX0A 4RE0A 3N29A 4ENLA 3WJYA 2W4XA 3RRXA 4I5RA 3IUDA 3NO5A 4CNUA 3EDEA 2QLYA 4US5A 2PDPA 3D0CA 1DJNA 3UWZA 5FEPA 4A2SA 3B8WA 3QR0A 3PC0A 1NPXA 4BURA 1OC5A 1XC4A 4GYKA 2ZZ0A 1RAKA 4LUJA 3TNOA 4UQDA 1ODZA 3QVQA 1G4PA 4NEWA 1E5NA 1N61C 2PLMA 3IUIA 4LV4A 3HJZA 3QH2A 2E5CA 4M0XA 1KFKA 4DAIA 1WNOA 5E5CA 4QE4A 2PZNA 4FNQA 1KBIA 2QUTA 1QHZA 2G50A 2RH9A 2XH2A 4F2TA 3C3UA 4KFNA 5I00A 2X0SA 4LVGA 4Q33A 4RJEA 4W87A 1K1DA 3NAVA 3O0HA 4PL2A 2V6AA 3AMLA 1DYSA 3GBDA 3FAXA 4HD5A 3NL5A 2DPEA 5C6MA 2VFEA 2A3HA 3PUEA 5LHEA 2QYGA 4HP5A 3WF2A 1SZRA 3ABRA 4D8AA 1GRBA 3C56A 3M07A 4N4QA 1R3TA 5ABGA 4NJGA 5CLWA 1PZ2A 1S5TA 3KWXA 1A0EA 3KCLA 3CV2A 4LS2A 4C1KA 3AALA 2PC8A 3DC0A 4IMCA 3VX1A 1ITXA 5D2YA 3S47A 2WSRA 3Q65A 1YPXA 3LEPA 3VD7A 2AOSA 4XVDA 2C7FA 2PAJA 2WHKA 2YL9A 1TMLA 2PS2A 4IM4A 3KS5A 2NVAA 1G7VA 2NLYA 1R2SA 3VUSA 4HTYA 3UU0A 1ZTVA 2HVMA 4J57A 2QCLA 1EZ2A 2ZZ7A 2FPYA 4GQGA 1VEPA 4GX9A 3UZWA 2E6YA 4LRTA 2WP6A 3SQSA 3WQ6A 3RN6A 3THAA 2A21A 3VK5A 3WD2A 1IYXA 2Y8KA 4H9MA 3CHCA 5EMLA 4LAOA 4BZYA 1QPQA 2W63A 3GRSA 1V97A 4QCEA 1D7FA 2X1RA 2Y89A 5EU9A 4A8RA 3HU7A 1S2TA 4MGGA 1QO5A 2BHZA 3SJNA 5AHFA 3B8UA 1Z7AA 2QDHA 1DXIA 2IKJA 1XINA 4DBSA 4EIVA 4LCQA 3MI6A 2D2JA 3GDRA 4Q4RA 1W1YA 4I9TA 3W25A 1PZ0A 1UMYA 2ANUA 5BW6A 3PVFA 4H3DA 2BNJA 2VCAA 4NZ4A 4JQAA 2JALA 1GOWA 2J9ZA 1H1ZA 1SMAA 3E2SA 3WQEA 4CD4A 1P6CA 4HZ8A 4UOJA 5CZSA 4IMAA 4F79A 3ZIZA 2CXGA 5K7JA 2WYSA 1LL7A 3U48A 4K1GA 3L0KA 5CQ1A 1M01A 1XYLA 5JCMA 1X1ZA 3NQGA 2JF6A 4PULA 3TA6A 2X16A 1M3UA 3VIOA 3VIHA 3C4UA 1U30A 4REQB 3OBKA 3AIQA 4JHMA 2F9RA 2VRKA 3WJSA 1H49A 4NZJA 4RW3A 4M6QA 3SBFA 3L0GA 3A23A 3P93A 3BOXA 3W7DA 5A6SA 1RA5A 5FS6A 4TTUA 1H5YA 4GINA 2WK2A 4GK8A 3LLXA 2XSAA 5ABTA 4FX8A 3ZMRA 1OFOA 4DUXA 4UTIA 1UH4A 2YLAA 4C6OA 2GJXB 3KDNA 3UXIA 3UCCA 2Y61A 3IAPA 4PYSA 1H7XA 3WNKA 3UR8A 1ZCCA 3SN0A 3N04A 4PTNA 3ANVA 1CXIA 1IXQA 1JGIA 3TCEA 4GRTA 2FTYA 4JD4A 1F3PA 4GJJA 2WJZA 2NUYA 5AC7A 1PTAA 3GG1A 4QQUA 4ZBCA 2G3IA 1XH1A 3WLPA 2PDFA 1QPRA 4E8GA 4Z1YA 3N13A 4GUJA 2ZRXA 4U33A 3AWNA 1WDDA 4AC7C 1GYMA 4MDPA 4KS0A 3FYYA 4JN7A 4HNUA 3CEUA 1K7XA 4YHGA 4Z0SA 1QW9A 4E2DA 2J25A 2V38A 1RLCL 3N3MA 3BPWA 5A8NA 5BZAA 1V3HA 5M1TA 4K3ZA 4HZMA 4QR6A 5JIPA 5D2TA 5CC5A 1SJDA 3FEMA 4ZA0A 3SCSA 3TH6A 3JU2A 1XGEA 2BTMA 3QV6A 2CEQA 4J3ZA 3C8FA 5LNWA 3LD5A 4ERIA 4ACYA 4M82A 3R43A 1FFQA 2X30A 2Q8LA 3LK6A 1C91A 5ECVA 1GGOA 3ID7A 5CXPA 1J0KA 1K03A 5K9DA 3TTYA 2CETA 4O53A 1FWGC 2QAPA 3VXGA 1G69A 1F61A 2J7CA 2WPEA 3BMXA 4TV6A 4HNNA 3N14A 3TYDA 1IZCA 3M0MA 2H3BA 1LT8A 3K2GA 4K1WA 3N17A 1PIGA 4X9YA 5HINA 2QDEA 1G6CA 1MOKA 5I02A 4DF2A 5JCNA 2VX4A 2BVDA 3LNPA 3VMPA 3UY7A 3NJ3A 4GYJA 3DEQA 1PTGA 4ATDA 3VMOA 1MW1A 4MKSA 3PTMA 2ZYFA 1MEHA 2X1TA 2UBPC 1QPNA 3GSMA 2G8ZA 1TELA 2OG9A 2V2CA 2YVFA 2VRJA 3MBDA 5DY2A 1TV4A 1KLZA 2D0FA 1G5AA 3E02A 4DVOA 2Q02A 2ZZ4A 2CLHA 1RP9A 5ABFA 2R1LA 3NVDA 3NS1B 1HO4A 3I6EA 1GVRA 3CAVA 3K8MA 4IX0A 4UUIA 2EJ1A 3G0SA 2WJDA 2D0GA 1G01A 1KM5A 2C13A 2XVLA 4D72A 2DDXA 4B4FA 3RK8A 3FDKA 5A6KA 3MSRA 4OBRA 4IFKA 1ECEA 2NWRA 3URNA 5BOFA 2E67A 4MY1A 1X8CA 2HTMA 3I68A 3VKJA 3KZPA 4F2UA 3QZ6A 3LGEA 3NVVB 2PBGA 3IIOA 4MPQA 4EQRA 1F6KA 3TAOA 1PZ3A 3EOLA 3S8HA 2E9MA 2BOGX 3QEZA 5LGZA 1SGJA 4W8LA 5BYWA 1OVDA 5HA7A 2G0WA 4NASA 4XBJA 4AD1A 3GHSA 2WZTA 3P62A 1ODUA 1M7PA 4LCSA 4AY1A 4AX6A 2VWSA 1VFOA 2OGYA 3TU9A 3IVTA 2GSHA 3KCJA 2RJHA 3G3MA 3FVDA 4DNHA 1O5QA 1IEIA 2QGYA 3WBAA 1S2CA 4JTLA 4K7YA 1X1NA 3RDKA 2XH4A 3NYZA 3HPZA 2NXGA 1XIIA 2CLEA 5D09A 3SDOA 1P0BA 1TV7A 3VGDA 4R34A 2WB5A 4NI8A 1CTNA 3DFNA 3S4TA 3B0PA 1HW6A 1QMLA 3IGUA 3L68A 4YWSA 1K9FA 4O8RA 1E43A 1BPLB 1R3RA 2RHGA 3H2AA 1Q7QA 2HPIA 3OW1A 4D8ZA 1FWFC 3BURA 4GFIA 4Z2JA 4EWJA 3N9RA 4HYWA 2PGFA 4L9ZA 1D8CA 3HN3A 2DU2A 4HHPA 4ZTYA 4KH2A 3WK0A 1OIMA 4GQRA 5DBTA 4MMWA 5U1OA 4I9AA 1AH3A 3QHNA 4ES4A 3TW9A 1TSIA 1XHCA 1H7WA 1I1XA 2PE4A 2E5BA 1LQ2A 1H60A 4KRTA 1U5VA 3LHZA 4J1OA 3V36A 4TVUA 4YTQA 3WQCA 2YSWA 4J4KA 2GJLA 1VP5A 3LM7A 4TX8A 4XG1A 4DXXA 4H4ZA 4RNFA 4DBWA 4LSBA 3EEGA 4H9XA 3BZGA 1MDLA 2DH2A 3B9JB 1E15A 4LY8A 2ZE0A 2Z27A 3N2BA 5JBEA 1W8GA 1EHNA 3T05A 4NAEB 4P2VA 2ZZ5A 3BSMA 1Q6GA 2TYSA 5EMUA 3NQCA 4O8AA 1UW9A 1RJQA 2ZUTA 3F03K 1H7OA 1EGVA 1XIMA 4C7FA 1ZBWA 4QITA 4GWEA 1MYRA 1EXPA 3CWNA 1WKDA 4PSRA 4GXWA 2F6UA 1HN1A 1E6PA 1PVNA 3V75A 1UZ1A 4HPJA 1MO0A 2VXNA 1XM3A 1FWJC 3WNNA 2C79A 1XYBA 1NFPA 1TRIA 2AL2A 3THCA 5I03A 2C1GA 2WMGA 3NIYA 3O1NA 1KRAC 1F7BA 3GD6A 3AN1A 2C15A 3UXLA 4BCEA 2A85A 2J7HA 2VCCA 4ZR8A 1NSJA 3W07A 1WYIA 5LIWX 3GDBA 5KEZA 3FKRA 3M9YA 2NW0A 3CH0A 1JDFA 5I2UA 3PZVA 5JIWA 2DT3A 2OO0A 7REQA 3RCMA 3R6IA 4Y6GA 1W9DM 2WBAA 1PXGA 4YN5A 1Z41A 2P3ZA 1JROA 2YCJA 4DZAA 3L0NA 4PB4A 1FP8A 3E5PA 1PHQA 2FYMA 4NI3A 1RPXA 1FRBA 1KTBA 4AD3A 1JYNA 3T2OA 1AMYA 3A64A 3CBWA 1JAEA 2IKIA 2CKSA 4JBRA 1KKOA 4E4FA 4KEZA 3GFXA 4MJZA 4GJ1A 4P7OA 2I5IA 4GZJA 4CU7A 4IMFA 5F1VA 1CGTA 3PG9A 4Z1AA 2NV1A 4PGLA 2FVKA 4Q6JA 1L6GA 3NQ2A 3VKBA 3TXVA 4UFHA 1MUWA 2XG9A 1TMQA 1KCKA 3C2YA 2IPWA 1YDNA 4K8GA 2Q01A 4S3KA 4ADWA 3TV8A 1VFUA 4FLRA 3IJDA 3W1LA 3U5YA 4ZFCA 3N9SA 4R9XA 5HOSA 2QUVA 1CXKA 3NGFA 4IH3A 1EA0A 4H4IA 2CIPA 3F5LA 1C3FA 2DVUA 2VQTA 3I3BA 3EWBX 3PZQA 1Y0EA 4GRSA 4LF2A 4ZVJA 4WJEA 3F4WA 1GVFA 5BOEA 4D8LA 2O7QA 3WN6A 1UCWA 4UR8A 6CGTA 3QHOA 4C5YA 3WO8A 4RDVA 4HNOA 4C7DA 3PBVA 1S3TC 1UH2A 2O4MA 3VABA 3A12A 3DBPA 4Q3MA 2C3CA 1VPYA 2WPFA 3H6OA 3QM3A 4FK9A 3O06A 3N2TA 4TX9A 5CC3A 1KRBC 1EFZA 3LBMA 1UIOA 2DVXA 1I2NA 1A4MA 3EGJA 4AD4A 4Y9OA 3UZZA 2IKGA 3GFYA 5C70A 1DTUA 4ZOBA 3LXBA 4GH3A 1SFLA 3CPRA 5BXSA 3OA3A 2Z26A 1U5HA 4PCSA 1HKMA 1SZNA 1R9YA 1A49A 3GKFA 2VC9A 5D9NA 4P61A 4I7WA 1BWVA 3MPGA 4NP7A 3ENLA 2R8WA 2DZUA 2WNWA 3MMTA 4Q7IA 4DLMA 3IGXA 4Z1CA 4WLCA 4LY4A 1WZMA 3W01A 3EANA 5FF7A 3U3HA 1UQYA 4GZ7A 3PK7A 3CZJA 1W17A 3ARVA 2YDQA 2PF8A 2VDGA 3ARUA 3E12A 3Q45A 2EPLX 1MFUA 4Z2LA 4PMVA 4U4MA 4S3BA 4H4YA 5D9MA 4B5TA 1Z6KA 5MF5A 1FFVC 2ZZBA 4UTUA 4CD7A 4NJHA 4LAKA 2NQJA 1IWBA 1J0YA 4UCFA 1CBGA 2PEVA 3QKEA 3P0WA 5K4ZA 4GUHA 4C6QA 2HNHA 3W2KA 1V3MA 2FZDA 4FS9A 3RR1A 4B3ZA 3TJIA 3MSYA 3N3TA 3A21A 2PWDA 1T5AA 1PKLA 3MP3A 2EO7A 1ITQA 3GD3A 4D1IA 1UBSA 1ZU8A 1NJJA 3ZVIA 1XANA 4POCA 4UTFA 4CN6A 2D0HA 3UXKA 4EF9A 1VBGA 4IG2B 5E1QA 1HL8A 4QROA 3G2GA 1CGXA 3SUWA 1OBAA 2QCHA 2OYMA 5LXXA 3QW3A 1UD2A 4AY7A 3DKLA 1PSCA 2D69A 1H2JA 3GO2A 3LPFA 3HA1A 4ZEPA 4JQ1A 3BLIA 3LCIA 3PBMA 4W5UA 4H8VA 3SY8A 3A5VA 5AYXA 3CUFA 1AK5A 3KL5A 2PF0A 5CG0A 2D73A 1V77A 4KRZA 1DJIA 2YFOA 3LZ3A 5FIPA 2WVTA 1SW3A 3OLDA 1WV2A 5CZ0A 2ISSA 1PAMA 3F4DA 3AHTA 4BA0A 3FHAA 3V3WA 1SFTA 1AD4A 4BEUA 1XW8A 3CQ0A 3TTSA 1JFHA 4MZ1A 1T8XA 2ZXBA 4MUZA 4NILA 1UKOA 3R2GA 2RFGA 1IXNA 1WDWA 1H63A 5HAOA 3YPIA 4RZ6A 3IV3A 4IMEA 1QASA 3MHGA 3R07C 2H8XA 1DJHA 1Z69A 5E6ZA 1GV4A 2Z1WA 4PH6A 2PCQA 3HIJA 3VIPA 4GNJA 3VYLA 3ITXA 2WMHA 4U2ZA 4EPBC 1VYRA 4IGNA 2ACUA 4ZQMA 3RX3A 2RUSA 4C6DA 4DWSC 1IIGA 5CJ5A 3B40A 3GVGA 4ZOHB 1UWTA 1K4HA 2QCNA 5A6BA 3UJFA 2A0NA 1DPMA 3MUXA 3WYZA 4EM4A 4R7JA 2PZ0A 1FFUC 4JOMA 1AUSL 4FHAA 3LGGA 1ZAIA 1G4SA 1E51A 1E1CA 1S3HA 2BGQA 1AQHA 3R12A 4HPHA 4FNSA 5DCEA 2ISFA 1XICA 2XN1A 1OYAA 4X9SA 2CKRA 3OGVA 5MKGA 4FSAA 3R1ZA 1YRRA 4M24A 3VIGA 2JK2A 4KESA 3S6OA 3OEXA 3VGEA 2PSNA 1QNVA 4GR1A 3DU0A 2YBVA 5H8MA 4WR3A 1OYCA 5I3JA 2BHYA 3ZR5A 4OQVA 1I6NA 1MXGA 1NARA 1FHUA 5HMFA 5M03A 4CD8A 4X60A 5IBXC 3MJYA 1OYBA 1JYVA 3G1HA 4FP1A 3LOTA 1N8FA 2HK1A 3R4IA 3H22A 3SQMA 2XVNA 1TV8A 2AQVA 2O9OA 2Y5SA 1T40A 1A5SA 1TJ1A 1S5MA 5T26A 3T8LA 2G37A 3CL7A 5DMYA 3F5JA 5E09A 1GERA 3TQ0A 3CS2A 3B4YA 3IJIA 2DUZA 1HP5A 3ITVA 4AYSA 2P10A 3EDJA 3R79A 4AEFA 1QI4A 2WSPA 3A4AA 1VJIA 2QCMA 2H90A 2Z2AA 4PMRA 3B03A 1A5KC 3OLIA 1W9PA 3KWSA 4XUYA 3CQHA 3TWBA 2O7SA 2WSYA 1NP0A 3N2XA 1YXCA 4D6FA 4WZHA 3SM0A 3M5YA 5D9OA 3QRHA 5HJYA 3W3OA 1ZPTA 2P50A 2QUNA 3DERA 2QPXA 3E49A 4LC6A 1BGGA 4E38A 3BGAA 1FXPA 1PKMA 3H53A 3FYPA 3OLEA 4PBGA 1H4PA 2QJNA 4ZQOA 4AW7A 3QSRA 2IQTA 3ITLA 3T0BA 1PDYA 1UMLA 3UPWA 4KRUA 4H7ZA 4PUEA 4AVOA 3QGAC 4RDWA 1XP3A 2BODX 4ZZ9A 5DT5A 1JPMA 1KKRA 3CHEA 1IR2A 1EGZA 1TCMA 3WMLA 4BV6A 1DXEA 5CPSA 5CBBA 4LVBA 3OBEA 3IIPA 3GZAA 4ZFMA 4NQ1A 3L8KA 1W56A 5A6LA 3A22A 4IWWA 4QLKA 1E9YB 3TTEA 3GH4A 4XAZA 1XDLA 3AS1A 3O6CA 4E8DA 1JRBA 1RA0A 4LRSA 3V1PA 3GXPA 4XZ9A 1WKYA 1K77A 3MUIA 3UWVA 3DENA 4W89A 5JQ9A 4X22A 4ZOAA 3TOPA 3KP1A 2QDGA 3O3RA 1WUEA 3MU7A 4NZFA 5C9UA 4M5PA 3AMKA 1TPFA 4ECLA 4UNKA 3MI3A 3QJAA 4YCPA 3RFAA 1XF0A 3W7JA 1LROA 1UH3A 1L6YA 1UZHA 2Z6IA 2BY2A 3WL0A 4XTIA 3AIVA 2GGEA 2O9RA 4PCNA 3S5YA 1B3WA 4PFHA 1D7KA 1M6JA 1MW2A 4M6UA 3B9EA 4CGTA 1FECA 3WQ4A 2NSOA 1HO1A 1XBVA 3NVTA 3B8DA 3M0LA 5M2FX 2FPTA 3DGHA 3WJZA 4XD5A 4L4LA 1J96A 3FX4A 2ZZCA 2PMQA 4LQ1A 2B7NA 4XAYA 5T8GA 3PUDA 2WANA 5A1AA 5EMKA 3UXAA 1FO4A 1W1PA 2QQ6A 4MVAA 2XWDA 4GH1A 3L4YA 1HZYA 1QW8A 3FG2P 2G3FA 3NRZB 1SJAA 1BG9A 2J7EA 4LVDA 3A6OA 2VD9A 3GXDA 4JTKA 3Q67A 1PB0A 5IDIA 4IPLA 5D03A 3EUB3 4CLMA 3MMDA 3BCDA 5FL1A 1OJXA 3NVZB 1NELA 4LX4A 1EUNA 7PTDA 3KRZA 2WZHA 1OCQA 1LORA 2ZE3A 1KBLA 4F0SA 4ATLA 3NO1A 4NAFB 4GLEA 3GVQA 1W9BM 2V8ZA 1VBRA 3UY8A 3ZXWA 1J5TA 1V6UA 2Z0IA 3CZEA 4BF9A 4RLIA 3MUY1 3V1HA 1LTDA 3WL1A 3C2FA 1A3XA 4GMEA 1W0MA 3NEVA 3PM6A 3KHJA 1H5VA 2PU0A 4GC4A 2Y7GA 4MAZA 5TQLA 2QCGA 4BWLC 1B31A 1TR9A 2BX7A 4F4RA 5D33A 4K8EA 5C5YA 1V7AA 1EOKA 2DJXA 2OLHA 1FOBA 1E1EA 3GNRA 4MFEA 2CBJA 2OT0A 1VDVA 4MIMA 2OODA 4F9JA 2WPCA 4DWSA 1JRCA 1STZA 2WWCA 1FY6A 1RCXB 3N9KA 1D9EA 1RQEA 1N62C 2PCEA 3H2MA 3UPMA 4AZ5A 2GZXA 4GISA 1E4MM 2GR1A 3BANA 2WVVB 3BCFA 4ICMA 5DELA 1E4NA 8TIMA 4DB7A 3CZKA 5MHBA 3EKZA 4MAVA 1R0MA 3ABOA 3H26A 1UWUA 2R14A 3U2OA 3IWPA 1MW3A 2QV5A 4WOZA 1H0GA 4ML9A 4LF1A 1ALDA 3DK8A 1QDSA 4MHBA 2YZRA 1XSIA 2V5DA 2W92A 4A35A 2ISVA 2D24A 1XSKA 2X8GA 1QNPA 3WF0A 1KNWA 5CAHA 1KD0A 2QGHA 1U33A 2JEQA 3FA5A 3SQPA 4A3QA 1POJA 4W4QA 1LWIA 3W29A 1BVWA 2AKZA 1BWKA 2P8BA 1W5PA 2R6OA 2W55A 1EL3A 4XB3A 4MSSA 2GVYA 4WUIA 1NAL1 2NT0A 3WF3A 3MYOA 3CMFA 5CSYA 5C2XA 4QEHA 1BYDA 4I6VA 4JTSA 3ZLHA 4HIBA 2CERA 3LMYA 3VIKA 5FESA 3KZSA 5K9CA 4Y8EA 2YCLB 3AJXA 3ZZ1A 1XCXA 2VFFA 4DJDD 3WG6A 1K9TA 5HQEA 3C6CA 4KKXA 4FDCB 4G6CA 1H7RA 3P8JA 2OOFA 2VC5A 3ZJ8A 4XSMA 1R3SA 5DFAA 4UTMA 2NQ5A 4EWND 3SRHA 3PPHA 4JTRA 1J0HA 3ZFHA 4OKDA 8XIMA 1DJGA 2VELA 1EDQA 4NZ1A 4Q8TA 2ZOXA 3DHDA 3IV8A 4MWAC 4IX2A 3W1QA 1BKHA 3HPXA 1Q5MA 4D6EA 5AB3A 3GU1A 2OX4A 2GQ3A 2YKKA 3TYBA 1W3LA 1NDZA 3I3DA 2OB3A 1TQXA 4M81A 1HGYA 2OX1A 1GONA 1CT5A 3WDJA 1TPUA 1W1VA 3W6LA 3M0YA 1GRHA 3G1VA 3UYCA 3M0VA 3KOZA 2FTPA 4FX7A 1ADDA 4FEZA 2B7OA 3S1XA 4H4TA 5KVIA 3VM7A 1V02A 4JTIA 2I9UA 3SRFA 3G8EA 4CNOA 3VILA 5HBFA 3K1DA 2WNZA 4ZSTA 3PPCA 4JY9A 3KEHA 1US3A 3QV8A 1BTCA 4L5ZA 1P5BA 4M8UA 3SW6A 4JTQA 4ROQA 3LGDA 4GG9A 2Y7FA 5G4WA 2HWGA 1GZJA 1M7OA 5D04C 3XIMA 5IFPA 4O54A 2ZA2A 1WZAA 3BOLA 3WIJA 3LCGA 4J35A 1EQCA 3AICA 2QT3A 4JL2A 3U7VA 3AYRA 5I24A 1AG1O 1L6SA 4DPQA 1F8MA 2EKGA 2PDIA 2H8ZA 1NDWA 4R3UA 4XD3A 4Q32A 1JJKA 4HOZA 2BY1A 1FCQA 1E9IA 4N0RA 5FF4A 1BKSA 2XDFA 4GIRA 1W3IA 3HO8A 1G1YA 1W1ZA 1ZFJA 2FH8A 1XLFA 2AMXA 3TYEA 4S23A 2Q3OA 1BYBA 1ZP4A 4C7GA 3PWIA 1TWSA 5J04A 3EWXA 4IP4A 5CKSA 4EK7A 3N11A 2VFDA 3GS6A 1V6WA 3KOFA 1FTXA 3G0XA 4DZ5A 2JGQA 1SYTA 3S1GA 4B90A 2JIWA 4HNCA 5T9BG 3R94A 1E4IA 4UOZA 4UQAA 2G97A 4JXCA 2NWSA 2YOCA 3R58A 3MCMA 2D1ZA 4H6KA 4UQEA 2Y88A 3G6LA 4R53A 4JFUA 3HGRA 1VF8A 4JEQA 4GC3A 5LKYA 2I16A 1TUFA 2ZX8A 4HQVA 1XLDA 3BAIA 4S3DA 4IUOA 1JPKA 4NAEA 3A13A 5IXEA 5ABHA 1Q6EA 2QF7A 5XIMA 1OGSA 2CZEA 4C6PA 4CQDA 5FJTA 1EUAA 1T6MA 3LNMA 5DXYA 1SUXA 2GK1A 3EOSA 3SIZA 3FIGA 1B4KA 2CBUA 1N5WC 3EA1A 1MFVA 4OVXA 1HKKA 2EHHA 1N2VA 2F7FA 3UR5A 1C90A 1YQZA 1YE6A 4BWLA 1TPWA 3LBCA 2CZVA 1KQYA 1R85A 4WSJA 4NZ3A 2J4GA 3PFMA 2OZ8A 3R0DA 3SCTA 3CIVA 1VAHA 4ICCX 3I3EA 5FEWA 1A5UA 3SCUA 2ZUVA 5I6SA 3W7RA 3MZNA 5A2BA 3P5YA 1GVOA 4O10A 4JL1A 4AU0A 5BU6A