3MWDA

Truncated human atp-citrate lyase with citrate bound
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
424
structure length
424
Chain Sequence
SAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNELANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRAIRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALGHRPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-citrate synthase
publication title Identification of the citrate-binding site of human ATP-citrate lyase using X-ray crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 124
structure length 424
sequence length 424
ec nomenclature ec 2.3.3.8: ATP citrate synthase.
pdb deposition date 2010-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16114 Citrate_bind ATP citrate lyase citrate-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3mwdA01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3mwdA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 3mwdA03
2QK4A 2I80A 4O2BF 1UC8A 1VBHA 1UC9A 4HNUA 2FP4A 2YW2A 2I8CA 3GIDA 2V58A 3R5FA 2YYAA 3NUAA 1M0TA 1OI7A 4TV9F 4YBZA 4XYMA 5HBRB 2I87A 2ZDGA 4ZOLF 2W6MA 2YV1A 4XZ3B 2YZNA 4DIMA 2W6PA 3VMMA 4O7ZA 3MWDA 3N6RA 4MV1A 3RV4A 4YB8A 3SE7A 4IHJF 2NUAB 4QSHA 1W96A 4O7VA 3G8CA 4Y8VA 2DLNA 3WO1A 1KJJA 4XX0A 1AUXA 2W6OA 1PX2A 1JKJA 4HNTA 3V4SA 2GPSA 5GONF 3E5NA 1Z2NX 2W6ZA 3HBLA 2OLSA 4O7TA 2W6QA 4O86A 4FGRA 4MV9A 3TQTA 3TIGA 2YS6A 3DF7A 3JZFA 4TV8F 3QFFA 3U54A 1BXRA 3MWEB 3R5XA 2NU7A 2YL2A 2NU9B 4WD3A 5KX5F 3VPDA 2W6NA 2FB9A 3K5HA 1W93A 2Z02A 1E4EB 5I47A 1CS0A 1KJQA 2J9GA 4EGJA 4RZQA 2GLTA 5KKNB 4YJ2F 4YAKA 1T36A 1C30A 1EZ1A 4O81A 3R23A 5J2UF 2YZGA 5JQGF 1EUCA 1GLVA 2R7NA 4O7RA 4O2AF 4I50F 1OBGA 5LP6F 1EUDB 1DV2A 1CQIB 4MV4A 1JDBB 2FPIB 3OUZA 2SCUA 3OUUA 2PBZA 5H80A 3U55A 4O4JF 4I4TF 3VA7A 5LOVF 1WR2A 3KALA 4O7LA 3VOTA 2IP4A 4FFLA 4ZI7F 5CAEB 1KJIA 5JH7F 4EGQA 3GLKA 4FFRA 1M0WA 4O7NA 1DV1A 2C00A 4FFMA 4O7SA 1OBDA 1DIKA 1EYZA 5BPHA 3G8DA 2PVPA 4YAJA 4XZ3A 5BMVF 4XYLA 1PK8A 1VKZA 2FP4B 2FPPA 1KC7A 4NYEA 1CQJA 2NUAA 4C5AA 1A9XA 4M9UA 4MV6A 2YV2A 2V5AA 2R7MA 3VPBA 1EHIA 5K2MA 3HO8A 4IWXA 3U9SA 2DWCA 3WNZA 5J2TF 1A48A 4TUYF 2W71A 5EZYF 1C3OA 3MWDB 4O7WA 1I7NA 4O82A 1SCUA 1KUTA 5LXTF 2NU8A 2DIKA 4O84A 5C1PA 2R87A 2R7LA 4Y8VB 3UFXA 5CA1F 3TINA 5JQWA 2FPGB 2CZGA 4XX0B 2QF7A 3KREA 3VPCA 3U9TA 1JKJB 4EG0A 2Z04A 1JDEA 2VQDA 1I7LA 2NU6A 4DLKA 3BG5A 2NU7B 1JLLA 4FU0A 1IOWA 4MV7A 2X0SA 4FFPA 3R5HA 5CA0F 1GGOA 5DMXA 4YAKB 4E4TA 2ZDHA 3MJFA 5JVLA 3V4ZA 4IWYA 3DMYA 2HJWA 1EUCB 2R84A 2CNQA 4HNVA 3LP8A 2CQYA 3JZIA 3TIIA 5JVDF 4HQ6A 4IIJF 2VPQA 3K3PA 2XCLA 2SCUB 4MA5A 3Q1KA 3I12A 5HBRA 4O4LF 1KJ9A 4L1KA 5LA6F 2YRXA 4ZHQF 2GPWA 3AW8A 4FFNA 2R82A 1AUVA 4HR7A 3RV3A 2YS7A 1VBGA 3N8DA 4YBZB 5BPFA 4XYMB 2XD4A 3LWBA 3ORQA 1IOVA 4C5BA 4YAJB 5C8YF 4XYLB 1KJ8A 2FPPB 1Z2OX 4MAMA 2WYOA 3K5IA 1M6VA 1KBLA 1CQJB 2YRWA 2R86A 5CB4F 2CNUA 4YB8B 5D8DA 2P0AA 2FPGA 4IZOA 1GSHA 2R7KA 3MWEA 3RFCA 4O4HF 4O83A 3JRWA 2NU9A 2GQRA 3TW6A 4ZQIA 1E4EA 1Z2PX 2GQSA 2R85A 4MV3A 4MV8A 1SCUB 4I55F 4YJ3F 1BNCA 3KAJA 3HB9A 2YZLA 2NU8B 3ETJA 2CSUA 2W70A 3UFXB 4WBNF 3Q2OA 3RUPA 2DZDA 3WO0A 4C5CA 3ETHA 5IYZF 5FNVF 2V59A 5C1OA 4FFOA 1EUDA 1CQIA 2VR1A 2FPIA 4O7YA 1CE8A 1B6RA 2NU6B 3R9RA 4ME6A 4O4IF 1GSAA 5HV6A 2PN1A 3KAKA 1GSOA 1JLLB 5CAEA 2YZMA 3JRXA 3ORRA 4FE2A 2ZDQA 2R6FA 2CNVA 5LYJF 1B6SA 3AX6A 4MA0A 2HGSA 1KEEA 1ULZA 2YWVA 3PFFA
chains in the Genus database with same CATH superfamily
5HNKA 4PX2A 3HJRA 3LQFA 5IS2A 1AB5A 3C43A 1ZH4A 5IC4A 1NR5A 1N5DA 3TY8A 1SK9A 2WRZA 4XEHA 2H2FA 2O2YA 1E0KA 4CG0A 4Q66C 1W87A 1BOFA 1CY2A 2C22A 1RNLA 2W6MA 4OXIA 1K6IA 5FLMG 4LHSA 1SXJC 4IGEA 2PXAA 1ONBA 5IZCA 821PA 1HDIA 3H3VH 3EVDA 4MMXB 2J0QA 3VR6H 3DBRB 3G8CA 5J2TA 1IB6A 2QG6A 3WO1A 2VG8A 2GEUA 4TOIA 2ACWA 3PQ4A 1RLMA 2C95A 2XUHA 3DZKA 1XMOB 5K8IA 2A9KA 4FHDA 3WFJA 2OENG 1CP3A 3I23A 4HNTA 1M6VB 1BDHA 5IH7A 1CR2A 5IP9G 4AKHA 2XA9A 1H8HA 1KQPA 3AKDA 3IMKA 4HAUA 3RU3A 4JV2A 1NVAA 4WY2A 2BDEA 2C2MA 3LT2A 2X9NA 1FYFA 3SP1A 1G21A 1YJ5A 4K2HA 1JSCA 4HRVA 2ZBQA 1VYHA 1IWOA 2B30A 4CIVA 1N5JA 4LX0A 4MR7B 2HK8A 5BNFA 2AIRA 3HNPA 3SEAA 3CG4A 2X8JA 3OUUA 1B76A 3CPHA 2XGJA 3PNVA 1N6NA 1TVKA 3QVUA 1G3QA 2QX7A 4AJHA 2UU9H 2C59A 4JOSA 4BLVA 2GJ9A 2HQRA 5EG5A 1JVSA 3ANXA 3W2HA 2C2GA 3CSWA 1NBWB 3A9CA 3HP7A 1X2EA 2O0HA 1F7UA 1E1MA 4MPJA 1UBSB 5EKDA 3FCOA 1KSJA 4UBJA 4ZOQI 4TLCA 4XR4A 4V1CI 5ERYA 4KI0A 1BD3A 3KXIA 1X77A 4ZODA 1G7SA 4TLDA 4DE5A 1DARA 5LXTF 1QIGA 3DMRA 3FUUA 3MQ2A 4J94A 4L28A 4QFCA 3TFOA 2CJXA 3GVPA 2CFOA 4PO3X 2Q7XA 1W76A 5K3FB 2WF6A 5EQFA 1M1ZA 5L1LA 2FHPA 4L0MA 621PA 4F2DA 4Y2UA 1P0IA 4G3IA 1WEKA 5DLEA 2QSJA 2A57A 3ZDXB 2Q6VA 5EHGA 3LRPA 3KOZA 5I48A 1N3YA 4A3CG 3SQNA 2ZT5A 3TMYA 3M4NA 1TEVA 4CM8B 5C7IO 2ZM6H 1SBQA 2VP3A 3ZU3A 4EUFA 3FDZA 3GZ4A 1BQ3A 5C53B 5KEIA 1T1EA 5ENDA 5JVDF 3L6RA 2X3FA 1ZVVA 5TMBA 3STYA 2ZUDA 1SU8A 1Q0TA 3C74A 5I9MA 4MW1A 4L4UA 1C4KA 2IZOA 5AJVB 2C4KA 4XDGA 2BMVA 3THXB 2XDQB 1SHTX 4JHLA 3TKAA 4BB9A 4F4YA 4UZFA 3AUSA 2XEDA 5HRCA 3O47A 4F6RB 1ICEA 3DW3X 2VTEA 4CUZA 3RVQA 3L8EA 5IYCG 2ZB3A 3CX8A 4CMKA 1HE5A 4HAOA 4Y6PA 1N2ZA 4QLAA 5L3SA 4MR8B 2BD0A 1EWQA 1J1IA 4IHAA 3KYDB 2RGYA 1ZIPA 1CUAA 2CFTA 1XAGA 2BC9A 2VSFA 5KBYA 3HM9A 3G8AA 2VWPA 1WDLA 3RTXA 1P2GA 4BVAA 3MOGA 2VR1A 4V0OA 4JKYA 1MA0A 5EZ5A 3JZ6A 3RB6A 2X2PA 1TA4A 3IHKA 1TECE 4HWOA 1XRSB 3ADKA 1ULZA 4KX3A 2BGRA 2G5TA 4J9RA 4KK4A 2HMTA 4QC2A 3CS3A 1C4OA 2CUZA 5CVJA 1XD2B 3JAKB 1P4AA 2A4MA 3L6EA 2LKDA 3B7GA 1RKUA 1ZCFA 3RWOA 5BN1A 1UFKA 1E64A 3T5MA 4GQAA 4JUIA 3OJFA 1MFPA 1PZMA 1QG2A 4OHMA 3V3KA 4PXAA 5AW0A 4H7FA 4OJKA 3I72A 3CVOA 1FS6A 4UM8B 2PS3A 5HVNA 1HZZC 2KB0A 2IXGA 2R93A 3F97A 3NYIA 3E58A 1V9LA 3RSGA 1K1QA 2AXEA 4KH1A 1G9SA 3V4OA 3V8BA 1JRLA 3Q9LA 4RZQA 4OHRA 2WLTA 3V4FA 3SZUA 5MGNA 1W5AA 1C1XA 1UXIA 1L5MA 1NNUA 5EIWA 1RJRA 1V5IA 3FY4A 5CP8A 4ZAXA 4D9EA 1EUDB 4XWTA 3HKBB 1ZM4A 4KPUB 4EEZA 4HLUA 3UM9A 1U90A 5LOVA 2RSLA 2YIMA 3QXCA 3A58B 4GE0A 4FGSA 4YDHB 4J9MA 1Y34E 5IKEA 3FYDA 1L7DA 2WMOB 1A2KC 3HPRA 3T8YA 3KBBA 3GVIA 1QO0D 3WHPA 4QGAA 5JOQA 4F0JA 1WABA 4DV4B 4MVCA 3GTKA 2WJVA 3PGMA 1B33N 1DQZA 3RSQA 4BN5A 3DTTA 1UBCA 5DLGA 1R27A 4IYJA 1Q0UA 3E5MA 5IT9A 4LXUA 2ZIAA 4ENWA 4WIAA 1BO6A 2UYQA 1PV2A 5AK5A 2Y1KA 1OZ0A 3TXAA 4NCXA 4YP7A 1RAFA 2RK4A 1V5FA 1FYVA 4UCOA 4GPZA 2H7VA 3D43A 1L9XA 3H17A 4XIJA 4O3QA 1ZD3A 3ZHTA 1WBDA 4GUAA 4V0KA 1OB5A 4Q01A 2NO1A 2QAGB 2XHZA 1U6KA 5F9NA 5K0EA 3P26A 2WWTA 3RSCA 3V6JA 3QNMA 5IWAH 1ZD5A 4R81A 2ZULA 3UQZA 3L06A 4JZYA 1RE1A 3PQCA 3U7FB 4KPEC 3K6KA 3OQNA 2WHXA 3B6ZA 1RK6A 3IPLA 4R2IA 3KKLA 3BXFA 1JNXX 2OO3A 3MCZA 4H0NA 2IUEA 1XTTA 4R2LA 5M5BA 2KSQA 3TGWA 4JUZA 3DWGA 1WR8A 4XWWA 1GTZA 1H66A 2ZT6A 1C1HA 1PJLA 2WPNA 3C39A 4IJMA 4LMYA 4UFNA 2PSDA 3HXPA 5T8KC 3HN7A 3ZHQA 1ZONA 2Q2WA 3WK4A 4K2AA 4DRZA 5KNDA 2QP3A 5H4GA 1RQGA 4IZOA 4A82A 4B3RH 2CXOA 4AJ4A 2GYWA 4N40A 1N75A 4L85A 2DGDA 1NL3A 3FTCA 3NHYA 1CBUA 3VSCA 3PFCA 5G0UA 1YRAA 2DWUA 3MR3A 3T4PA 3MWJA 3X1KA 3CBQA 2ZQYA 5KC9A 1L5YA 2YNMA 2B2CA 4C5CA 1MC8A 3K70C 5F9MA 4RU1A 1SD1A 4X93A 1SH7A 2V7PA 4G0PA 1GVHA 4QOHA 3A6FA 3GB8B 3IAUA 2PKQO 1N8NA 2RHGB 1I94H 3DT8A 5K8JB 4P3YA 2QK4A 2OM6A 4HF7A 4D6PA 2V0CA 4H6PA 2PJUA 3KRTA 3KC2A 1COWD 2R6R1 5ALFA 1RYMA 5C0OE 1ZVJA 4LH7A 3RROA 2RAFA 1OF1A 3ZE0B 2O2XA 4AZ0A 4IFTA 2OUIA 4N47A 2Y2UA 1M7GA 2PX8A 2QV7A 3CBGA 1TK2A 3QTBA 1U2GC 3PFHA 1NC3A 4JAVC 3HJNA 3ZWWA 3JZDA 2GZ1A 4O3MA 5TQ2B 3BFVA 4CEHB 2W6ZA 1YD7A 4ES6A 5JCZA 1XYGA 3SICE 2JKVA 3VI3B 2IPLA 2R6CA 1DLIA 3P0IA 3QEMB 1KOLA 2OEPA 1M1XB 5I4KA 3ZWQA 3GMSA 2PGOA 1SXJA 3EAQA 1M6EX 5KYXB 1GPAA 1EFCA 1PEDA 121PA 4QQKA 1JJIA 2D2XA 4HQFA 5FPKA 3LQYA 5FWAA 2BHTA 3UUGA 1RYRA 1G59A 2COJA 1XRRA 1CY8A 5JYCA 1QH1A 3GOHA 5REQB 2G06A 4EQ5A 2C88A 2FEOA 3PHLA 1JILA 1MENA 5CDSA 1TQDA 1LZLA 3VC1A 4O2AB 3CCCA 3P0FA 3UMSA 1MV5A 1OHHD 2CLLB 2WR8A 1WMFA 1E7SA 4AG3A 1RBZA 4NENA 3QXJA 4PPNA 3H42B 4S12A 1P1IA 2VUMA 2B82A 4A26A 4FQ5A 4DM7A 5JO9A 4M1OA 3L9XA 5LQNA 1NC1A 4J1NA 3MBIA 5LKRA 4AWAA 1XQ9A 3GN2A 3TZLA 4IVRA 1EDDA 4L5YA 5BW6B 3B89A 1YHYA 3OWOA 1L4EA 1OIWA 2IEDA 5IRCD 5DHUA 4MPTA 2O03A 5EQTA 4YCAA 1UZNA 5U1PA 4MCAA 2QN9A 2WQ6A 2XYRA 1R8SA 4H7EA 2FEWB 5L3VA 2H1CA 4EBCA 2HQ1A 4X6UA 3BF7A 2AI3A 4EP1A 4JLMA 3SBXA 2YZ2A 5J9FA 2IHZA 4PFSA 3I9V1 1N2JA 3E48A 4JYMA 2P4EA 3KE9A 4V0RA 1TJNA 3I61A 4DSUA 2HBZA 3H2YA 3BH7A 1HR0B 5FOUA 4AW9A 4Y30A 4KI7A 4K28A 1GVNB 3I9FA 1VPDA 1A3GA 1PL6A 3R44A 2CNDA 4RSHA 3L79A 1JEAA 3ZD9A 2C4VA 1EJ0A 2Q3HA 4NBUA 3IQWA 1OXVA 1P0FA 5LDGA 2AX3A 1U81A 1QR2A 3PQ8A 3F3YA 1KWKA 5FTKA 1X8JA 1VC2A 1NWCA 1B0ZA 5JSYA 1TJPB 4YRKA 3GG2A 1K97A 2X1HA 3TM4A 2AVDA 5ELXA 4JI0H 4UMEA 3KTFA 1TM5E 3ZEIA 5A4FS 4DOMA 4QYIB 3TY9A 4QTTB 3T34A 4WN9A 3LI2A 3IVGA 1FUKA 1UF9A 3PFIA 3EXHB 2ODTX 3OX2A 3OPNA 5DHFA 3A4TA 1ZK4A 2AJDA 4E13A 2UXCB 2FH5B 4H1UA 4KIJA 4HDSA 3ET4A 1JU9A 2NSYA 2UVUA 1T26A 3LUJA 1R8YA 2HSGA 2WUDA 2XMQA 3VV2A 1OWNA 5HQ3B 1FFCA 4B3MB 3H7AA 1ZN9A 2ORYA 4ILKA 4JK3A 2BE9A 5IT9W 3GQBB 4S2UA 4FGZA 2VZ8A 4AN0A 4C0LA 4JC4A 1WXXA 2WJ3A 4ZANA 1X1DA 4XB1A 5F3WB 3CLKA 2CBXA 1LPBB 3DKKA 2NTVA 1AXGA 1ZJ6A 2CLHB 5LIPA 3TN7A 1YHNA 4YALA 1V11A 3DMDA 3R8FA 2P9TA 1JJFA 3K0AA 4Y9SA 3LP6A 4M9RA 4HK4A 3ED1A 4KWHA 1U2SA 2FSVC 2AI2A 1Z16A 2J08A 4IMJB 3UKDA 5DSZA 2BEUA 2RGRA 1AHHA 5HP4A 1R1DA 3OE7A 2WZQA 2RHOA 3IDOA 4P4UA 1P1CA 1WD5A 3GJXC 5CT8A 2Y0PA 6REQB 4MV1A 2LDBA 2XTMA 2R1TA 2ECPA 1WMDA 3W1WA 1XROA 5EYPA 2MIIA 1FFGA 1Z25A 3B51X 2BMJA 3ZCTA 4LF9B 5JS8A 5FL3A 4GQBA 2I1VB 3HJHA 5E4JA 3JQ6A 4AF7A 2PVCA 2D74A 4X65H 5DHPA 3K6SA 4KFCA 1XCPA 4AC9A 3FDSA 4RQAA 2FQXA 1EEHA 4CMCA 3L2OB 1KGSA 3TOZA 2UVDA 1BXRA 1M8JA 3PN1A 1ZESA 2ID4A 1G8MA 4PQEA 1QH8A 4C22A 1YUNA 5KTSA 1QCDA 5ICEA 4ZV7A 1YS7A 3RS2A 4BEBA 5ALQA 3HFJA 5CFPA 1KAGA 5F77A 3GJTA 4QJ3A 3O4VA 1C3VA 1NONA 1NLUA 2XZTA 3QKIA 4CU2A 4ECQA 4X64B 1HZZA 3G88A 1FK8A 1LLCA 5FPRA 2FFRA 1UT8A 1X86B 4LOHA 3U55A 2J9FB 3PR3A 1VFPA 5G02A 1A4IA 4PYKA 3VOTA 1WCMA 2B4AA 3G1UA 2IITA 1QQ6A 1PZGA 2NQTA 3PFKA 4G41A 3ZDCA 2OCIA 3EVGA 1JPUA 3MLAA 1JKFA 1ACLA 2JFBA 1BW9B 4LGMA 3QF7A 4XYLA 1QYWA 3IDQA 3V7FA 2HUNA 4AMUA 4CR6A 2CLIB 1JHXA 3SSAA 2OHHA 5CT5A 3ZIDA 2AF4C 4H31A 1N9GA 3A4VA 1X13A 4BS9A 5DM2A 2X3UA 4EGSA 3N1UA 5H4HA 1GDDA 4FI3F 5LLSA 4AD8A 4DAOA 1AXEA 4KRXA 2YFQA 3OIWA 2R7LA 4U9UA 1ORRA 1K27A 4MUEA 5IN4A 2AU0A 4PLFA 3EBLA 3CEBA 1MIHA 3WKBA 1RWQA 4Y1RB 5L4SA 3Q6IA 1UMDA 1MO3A 3DOFA 7MDHA 4BY7G 4LRQA 4P6VF 3N0XA 2WZBA 1YRQA 2R0QC 2DERA 1SD5A 1H5NA 3O93A 3QIAA 1VIMA 2Z8ZA 3KLMX 4I3HA 1JQ5A 2QVBA 2C99A 2MSLA 4DHEA 5DTRA 4WZAA 1K83A 2HJWA 1ZCZA 4LQDA 1A5BB 2HVRA 1CKEA 2RHRA 4J6FA 2G0AA 4RNMA 4MMYB 2XZLA 4L1KA 1ZGHA 1EU1A 1FEZA 2WU4A 1B14A 4EJFA 3CONA 5KFWA 3M9MB 4ZVKA 2VATA 2J9YB 1N0UA 4M1SA 2GBLC 3ZE9A 2IWHA 2Q2OA 1G63A 1Y89A 2P35A 5KYKA 1RI1A 4RESA 2GAAA 2RHTA 4KR0A 5DG9A 1KBLA 5JWRA 1D9XA 5EWJB 5AVZA 4DMKA 2R1VA 3K53A 2ZIEA 3VH2A 1LW7A 2P9GA 4RD6A 1Z8NA 2R7KA 1JE1A 3DWIA 4DMRA 4NYJQ 4UHCA 3RF2A 4KXFB 1A50B 4TGLA 1SCUB 4MPPA 3H9QA 3MRVA 1N5IA 3VISA 2R65A 2HU7A 1TRHA 1YNSA 4B79A 1VL6A 1NP7A 3CVWA 1JH8A 1A96A 2JGDB 3BL6A 3PDIB 3DVAB 4LMBA 4RZHA 5T8KA 3WC4A 1YZQA 1I7QB 5GAJA 3QVSA 5I7HA 5AHOA 3SE0A 2G1UA 3NGDA 3GJQA 3I04A 3UAVA 1RIFA 4YMVA 5F3DA 5U9CA 3N44B 1XQVA 4PIMA 4OGLA 2ZB2A 3DLAA 2ZXFA 5KJFA 3SHWA 1MXHA 2I71A 4EB6B 1ZPDA 4RGBA 3IQGX 3DEAA 3VFDA 3LRTA 1UPCA 2OBNA 4B3SH 2BEWA 2JIZA 2PDAA 4DBVO 1I36A 4XUCA 1X19A 2LV8A 1I1QB 3W6UA 3AQ4A 3K1TA 3OE5A 1HY3A 1PSDA 5EPUA 3MWKA 5JHGB 3KEQA 1W0JA 3GIWA 2YN2A 5EHIA 2D2VA 1I5RA 3LUDA 1MZVA 3BRQA 3FHCB 1BHSA 4WA7A 2GHIA 2OZPA 1NI5A 5KFGA 1SG6A 3GL9A 3AKZA 2V3CC 1O54A 3I6BA 1RHKA 5FTLA 2ID9A 1BX3A 1CERA 1R12A 4JP1A 3BMNB 4JXKA 2W22A 5FX2A 2CVZA 2BWJA 1AO0A 3AFIA 1Z74A 3RT7A 1F0NA 2FB9A 4CLDA 1QVVA 2QUJA 1NMSA 4TQAA 1U2GA 2X58A 1OFUA 3NUQA 1O6FA 4Q1FA 1UKEA 2JLZA 4FDTA 2IV2X 4WCFB 2XQIA 2REQB 4OB8A 5F35A 1TT5B 4L16A 1TM4E 4R7TA 4JJ7A 1Y8ZA 1R0LA 1QIIA 5MFPA 3FWKA 4NFYA 3ZZUA 4MTDA 5IWCA 4O7NA 5A4DA 2BFPA 1DV1A 5DPMA 5BRNA 3BB4A 1GQYA 4F5EA 3UEOA 4AMGA 3CG0A 5DNYB 5BOSB 2PKWA 4BAZA 2NUAA 3K9GA 1DUSA 4A3MG 3GFRA 2NMVA 5FHRA 3WNZA 3ZV5A 1H3FA 4TLLB 2YN4A 4F91B 4F5DA 1U3DA 4D0GA 3R9XA 4X0EA 2WYUA 1TCCA 2QT0A 5F64A 2FUNB 1NVGA 4XD7A 4NXNB 3U3KA 4KLCA 4CV3A 1WO8A 3HR7A 3RU7A 1F9EA 5ER6A 2HADA 5CCEA 2OD2A 4JJGA 4JV1A 4QOFA 4BUCA 3ABIA 2ZYHA 4WKPA 2B5WA 1Z36A 3GLHB 3QY9A 2P3LA 4ECSA 3T06B 2JFWA 3CF4G 4B3GA 4CFSA 1S8NA 5LCXA 2O8FA 5CTAA 3SBDA 4C0SA 5DGXA 4D3FA 5KFKA 3PHGA 4B3JA 3P96A 4FEGA 2ZR8A 5JYBA 5D7BA 2IPOA 3BFPA 2H4WA 4FBLA 3GFPA 4EHAA 2DR0A 4BQIA 1EX1A 1XCBA 4ZV9A 2CD7A 3T52A 4YJGB 2RF4A 5IVPA 4DV6B 5LN1A 1D4ZA 4MEBA 3PR4A 3W7BA 5KFAA 1JR4A 5LJIA 1DAPA 1UK8A 2NTYC 4DREA 1ZK2A 4IO0A 3TSCA 2YH2A 3CKKA 1IOVA 5JYDA 3V4LA 1MX9A 4G86A 3M6IA 4D92A 1ULTA 3AESB 1MF7A 1JMKC 3DDZX 3KEOA 1Q7GA 3CURA 5AFSA 5JU6A 2CXSA 3TNFA 1QLHA 2VZ9A 2RI1A 2DTDA 3JRWA 1WDWB 3V6KA 3OOEA 1Z3IX 5H68A 3E84A 2I1QA 1N5RA 1QHHB 4EZIA 3VR2A 4JUFA 3HABA 5FOXA 4MJ3A 3PHBE 5H16A 1AC5A 1R6BX 3IUBA 3O21A 4IIEA 5KTKA 4OATA 2YJ4A 4AP6A 3ENWA 1TW2A 1JVNA 2JD0A 4QOEA 2A1TS 3GRYA 3KCQA 3GEEA 4N76A 1C14A 1YH3A 1AV6A 2PAAA 3DZCA 5HGJA 2FN3A 5KSOA 2BH9A 2PH7A 4B5LA 3AR9A 4RLFA 1J9GA 3PFFA 3B6KA 2X0DA 4CQLB 1S2IA 4MLZA 2VJKA 2GJSA 3JZAA 1IXKA 4RH1A 2V45A 3B8HA 4ZFNA 2WV7A 3AF2A 4OREX 4NPHA 3EVFA 3DZGA 2GVDC 3JY6A 2EBFX 2ZSFA 2B63A 3CISA 2YKGA 2FMUA 1N1GA 4K6GA 2ZYUX 1PJTA 2FEKA 1GLNA 3H5TA 1U0JA 4KJZA 2CHFA 3V4RA 2O19A 1RMTA 1QKKA 2YMMA 2JI8A 1GPMA 3AUJB 2ROQA 1Q15A 2FSVA 4HSGA 2Q27A 2WB1E 1JG7A 3HKDB 3W2FA 3IILA 1V5GA 1HNNA 1TUGA 1YCDA 2G1AA 1CS0A 4S1PA 3LL7A 4RNOA 3WA7A 3JYOA 4P4LA 4LWPA 5HEKA 3ORSA 1TZKA 2OCKA 2O8VA 5J4LA 2WMNB 3AR4A 4XPZA 2PFSA 2RI0A 1E2FA 2IZ5A 4PZPA 1D2CA 3TDKA 2Q4BA 5GP1A 1JAIA 2BV3A 5B4TA 4G56A 3VR3A 3Q7RA 3E9NA 5CGZA 1X0XA 1CZLA 1ZCBA 4CKBB 3M9XA 3R8CA 3EDOA 2XXAB 8MHTA 1QO9A 4BO0A 3BFXA 1P7PA 4Y7DA 1MB3A 4DBLE 3LF2A 2HJ9A 5JD4A 3Q2IA 1W1IA 1FDVA 1N8KA 2TMDA 4WK4B 1QJCA 2A58A 1GDHA 3OJWA 3RJMA 3GRPA 2OGSA 1X94A 2PA0A 1NU8A 3ZBQA 4YRQA 1R64A 2GDZA 4ASUD 2I7TA 1G6OA 5TMEA 4BAGA 2PM8A 2C0QA 4C7XA 3QTTA 4D79A 4DADA 4LF4B 3TD6A 3KTDA 3VO1A 2FMHA 5DLPA 3GLIE 1UAYA 3S27A 3BHIA 4W8OA 3TINA 3K9FC 3BD8A 1RJ9A 1GV1A 3ZE7A 3OBBA 2R4TA 1DC7A 2C2KA 3EPGA 2Y67A 1D8AA 5B37A 5H9WA 1S03G 3OZAA 3R76A 5GZ1A 3IS3A 1PS9A 1ZITA 3FPHA 1KY3A 1UP4A 1J33A 5ILOA 1DZIA 4ER0A 2QL5A 2ZBPA 1DAEA 4UAJA 3GMTA 3K0HA 3T3GA 4HNAB 2CXXA 3KT6A 1L8XA 1OH8A 4OMFG 5DX0A 2R00C 5DHSA 1RYHA 1IBRA 1E2QA 4LFCB 4IYRA 3F6CA 3BORA 4UPVA 1UC5B 4OHWA 4W9RA 1PUXA 1PSZA 1BRTA 4E5DA 1KTAA 1M2JA 1L5HB 5FOSA 3I9LA 2X0EA 4YJFA 3THRA 1W9MA 4P80A 4KHZA 5HR5A 3S29A 3NOOA 5E1BA 4DJAA 5AJHA 1J22A 5L1JA 1TZ2A 1V2GA 1W4LA 5JAZA 1T1IA 2GZSA 2QE6A 4X1YA 4DR4B 1GEGA 4HJRA 1G20E 3WGHA 2OILA 4KBGA 2EFGA 3LNCA 3CSDA 2HK9A 5C81A 4HDRB 4EWLA 2GBLA 1E98A 1HNZH 3GIIA 4C6RA 1H0SA 2HQOA 4MARA 1PV1A 4LIPD 1GLGA 5FBVB 3NRBA 3L8GA 1GPH1 3K2IA 1BA2A 4RM3A 3K0BA 5K3AA 2HCTA 2DM6A 1C1DA 3EGXA 2UYGA 4X66B 4MXDA 4G9EA 2I1WA 2HWWA 2PSEA 1HK7A 4RMNA 4FJ0A 4BNJA 3SF0A 4E7PA 3QHQA 5FAKA 1F2VA 3TCNA 4X95A 1W47A 4YUAA 4INOA 3UCFA 4QDTA 1H1DA 2HC9A 4PANA 2JLUA 1RJDA 4GVXA 4B3CA 4FOPA 3ZDYB 3ZGXA 2F1KA 5JY6A 2BFCB 3DE1X 1GU7A 1K7YA 1EDZA 1VGQA 5IU6A 3NKFA 1IK6A 3OY7A 2P9YA 3ITNA 4MDHA 3QG5A 2G04A 3ET5A 4YMGA 1MDBA 1RZRA 2WJIA 3OZ7A 4LK3A 1BS9A 5FOTA 3B1JA 1KK1A 4F9TA 4X85A 3A6EA 3MWEB 2P1ZA 5JHHB 5BR1A 3KP1A 4R8RA 2VNHA 4MMZB 3IKLA 2GSDA 1XIVA 1AMUA 5E25A 1DAOA 5B55A 1DWOA 3ZDZB 2PMCA 1YOBA 4D3YA 3G7NA 1VIAA 4CGZA 2AKYA 1EWVA 1UK6A 1KBZA 1RWKA 1EE1A 3EEFA 2A35A 5AUNB 3O83A 3BIFA 3CLUC 4GOMD 4CM4A 5B1DA 4F5YA 4G84A 4X1KA 2EHDA 4N0EA 3IPRA 4FFRA 1JTEA 3DSRA 2G4CA 5CDFA 1B6GA 3PFBA 2VNIA 1RRFA 5JNVA 2WUFA 1ENOA 4G37A 4L0DA 1THGA 3NBFA 3L0SA 2UZ0A 4MYHA 5FBHA 4WXEA 3EK2A 2ID7A 1M6HA 4PLGA 4EDFA 4MWBA 3E7DA 3ZV3A 3Q9SA 3U1VA 2IYTA 1YDMA 1IYZA 2VSNA 3H5LA 1KYWA 2A94A 4UAUA 1KYZA 3C5WP 4M60A 1DJQA 3UT5B 5FR1A 4UTPA 3ANSA 3NVKI 4CHTA 5HUJA 4OQFA 4PAGA 3D6NB 4HFRA 3PRYA 3R1IA 2LUOA 4J0GA 4YONB 4FE4A 4P84A 2H92A 4DIFA 4QT0A 3EBOA 1NBEA 4DNFA 2BFBB 1KI9A 2W7PA 2FQWA 2ISSD 1MRSA 3MF4A 1CR4A 5JV5A 2Y6VA 3IAEA 4DJ5X 2J9ZB 1A7UA 3LMKA 3OZXA 3NIBA 1YR7A 2JPDA 1AKNA 5COBA 4Q1VA 5FQNA 2PQMA 2VZ0A 2Q2NA 4HRYA 5A6VA 4XFKA 1T2AA 1R0RE 2CYCA 4D6XA 1TM7E 3REOA 4L95C 1D1PA 4GXQA 3TIXB 1V45E 2CDCA 4ZU3A 4JLJA 5DGDA 5LIRA 1AQYA 4LV8B 3AR8A 1EVKA 3DWFA 2GYUA 1OXBB 4DMLA 4ER6A 5LA6F 3OLYA 3RU2A 3HV0A 3ZKWA 3M6MD 4MB6A 4W82A 1X80B 2HDOA 1VG8A 4MROA 3ZI7A 4D9NA 1CDDA 4GZ3A 4D0LB 4MYSA 4ZALA 2VHWA 2MINA 2GR9A 4G9BA 3V1KA 5HQTA 2DHRA 4J0HA 2BGNA 1HEIA 3H20A 3X43A 4YY3B 3V9AA 1AVTA 4PINA 5D8DA 3CO0S 3WLSA 2PWYA 1IHYA 5B64A 1QTNA 4ND6A 2YJTD 3NT4A 4YP3A 2R5NA 4RPIA 3OU2A 2ZUTA 5BWUA 1YVPA 4EFKA 3H5AA 2VHJA 4FEAA 2NGRA 3ZV4A 3RUPA 3TIFA 2Z1MA 5KVQA 4LMAA 3RAJA 5HA5A 3W5AA 2SNIE 1CQIA 1AE1A 3CRZA 4LECA 1H2ZA 1RJQA 2TMGA 4C88A 3GV0A 3CJQA 4NXMB 4BZQA 1JS1X 3W9SA 3HA2A 3GJSA 5DT2A 4OHFA 2EKDA 3I92A 1ONOA 5EJIA 3G59A 3D8TA 3TF5A 4BGUA 5BT9A 1P5ZB 3ED5A 3AFHA 2DUNA 2JHGA 4UPEA 1EFPA 1UM9B 5I7FA 2O1EA 2X40A 5EOYA 5C4MA 4U7JA 5IDQA 1ULHA 1R18A 1ML4A 2QMEA 4RYLA 4Z4IA 2EJ2A 4Z9XA 1XPOA 3ACCA 3OOWA 2FUG6 3R7LA 1Z45A 4PG4A 2WSYB 3EA5A 3GPDG 3QPWA 4PVDA 5E4TA 3B1KA 2GO7A 4MI3A 5AUOB 2M05A 3HKZE 4D0RA 3CW8X 2YHUA 5KG5A 4M2LA 2FRXA 4L5CA 3NGLA 1JEEA 1JHQA 2ZM5A 3D6VA 2Q4RA 4CKWB 5BY2A 4ND1A 4Z9AA 3HGTA 1BROA 3T4XA 1YVUA 1P80A 1W4RA 3ZWMA 2BEJA 2ZXUA 3WWIA 3C3EA 3OETA 4X92A 2FK3A 4NKRA 3SM3A 1NR7A 3WNVA 1OWOA 4BQOA 3V5NA 4MKXA 1VJDA 4MWGA 1YVRA 1L1RA 4JEMA 3D6MA 4HNGA 2O8DB 4MO2A 3FSJX 3K94A 1I3KA 1R15A 4J16C 1MC5A 4F1KA 2O2CA 4CODB 1GQOA 3HCWA 2PBZA 3Q8LA 2H8KA 2QRPA 4HXEB 1WW2A 5BSKA 3THSA 1GXSA 4I4TF 3OTWA 5HILA 1NI4A 1BVYF 3L46A 1SVWA 4JBHA 1IY1A 3DOUA 4EVSA 4FFLA 1Y4UA 1Z7GA 5PNTA 3VJLA 3H9JA 1T43A 2OZVA 3AWDA 4LXYA 5T4BA 1AZWA 4II2A 2HRQA 2CK3A 3GA5A 1ZQ9A 3IVAA 3BGWA 2R7AA 3OZUA 1VYUA 2JJ8A 4YXWD 2WNIA 4D4LA 2FPPA 1KSHA 5MDHA 1OLUB 4RJ2A 3KR1A 1W8IA 1A9XA 1BJTA 3K1AA 2F48A 1T2DA 4RKQA 4Z2YA 1U2DC 3NRJA 1IC6A 4ZOLB 4P81A 4O25A 4WHXA 2C9CA 4L27A 2VF2A 3GJ8A 5JJIA 2EKPA 4JP2A 4O82A 1QSGA 4RB1A 1LLFA 2NZ2A 2CC2A 1E5LA 3AKCA 1P19A 4BAUA 1U3VA 4CMGA 1UMBB 1WMAA 4EG0A 1MQ9A 2HJHA 4PR3A 5JI2E 1LZKA 2FKLA 3E9ZA 2AUTA 4C3OB 1R7RA 2AZXA 2AHRA 1Y9DA 2HWYA 5DOVA 1T3NA 3TZHA 1SEVA 1JDVA 4YO7A 4EMBA 2AJCA 2VCYA 4RV4A 5A4JA 4CTMA 3NCHA 1FLAA 2E5LH 1QPBA 4COOA 3FTEA 1GTSA 1Z5VA 4QTUB 2B6HA 3F9IA 5KKAA 3H2IA 2WIAA 1KVTA 3QZUA 5JS7A 2SCUB 2VDUE 4BRWA 3EPIA 1ABFA 4MUFA 4TVKA 2G8NA 3DMPA 5CURA 2FW6A 3AJDA 2HB6A 2IEIA 3ENVA 5K03A 3AG6A 1FC0A 1WOMA 5JALA 3OU7A 4IUYA 2WA1A 1A9RA 3D0OA 2VP6A 2L42A 1YZLA 3DGFC 4G25A 3STVA 2OHGA 2WTMA 5LMUB 1TMGE 4MAMA 2VF4X 3E3NA 4RFVA 4DA9A 5FA8A 4EBEA 4LAFA 4DRXB 2QT1A 5E38A 1O77A 2OHIA 1N33H 2GTPA 1RQ7A 1Z6ZA 1LF0A 1E4EA 4JEUA 5LMNH 4UCUA 3IXLA 4XIFA 3IEIA 2W2KA 1C9YA 3CLRC 4LZLA 2VPTA 1UQTA 2W70A 2GCNA 5TLSA 1KZYC 4KAXA 3AHHA 3P4XA 3MINB 4EFLA 3A10A 3GX1A 1HOTA 5HFNA 3LT0A 2G1PA 2AJLI 3NTRA 2GNAA 4Y2YA 5I9BA 4FJ1A 2WQZA 4L2IB 2W2OA 5DFAA 2H2HA 5JT1A 2WP0A 1SU4A 1HFKA 1E2UA 4REQB 3EOBI 4O4IF 1XKXA 3RVSA 2XTZA 1DFHA 2CXUA 3ORRA 1KORA 3LVFO 5L40A 3M4JA 3AX6A 1JU3A 2PUJA 3AV0B 2YWVA 1U8CB 4BB6A 4XSHA 3A6LA 4HVLA 5T41A 1AG9A 3O2NA 3IALA 2IYVA 1KYXA 4F5WA 3L9WA 4N65A 1ID8A 2QD3A 7YASA 5TX7A 3NP9A 2FN9A 5ALHA 2RHHA 3FB1A 1VHWA 3UW3A 3UXEA 3HN2A 2R8BA 5L7YA 2QE7A 1GFWA 3JD4A 1PW5A 2D7JA 2A33A 3SSMA 2DXIA 3DQPA 2PZMA 3VI4B 3U5TA 1TFUA 1E3SA 4Q3CA 2EYQA 2CDNA 2IYEA 3E3OA 1WPQA 1Z0SA 2G4VA 4KXNA 1N2CE 4BU1A 3T7TA 4YFVA 4Z1MD 5BUSA 5FIUA 4G2TA 4GBGA 1FXWF 1TF7A 3FNFA 2OCXA 2C4UA 1PLKA 5EUMA 4LJSA 4GKVA 4P2BA 4BNHA 3GYBA 3LY7A 4R98A 3A27A 3CEMA 3GGCA 1QJ4A 4N5HX 2DP4E 4J49A 4IX1A 1CY6A 3V6LA 4YRAA 1EK6A 1HSOA 3HEBA 2A67A 3HVKA 1CE8B 5H80A 3OMWA 4ZGGA 2MYNA 4AN1A 1ZKMA 4PLZA 2H1FA 2C29D 2CL6X 2IP4A 1PNOA 1QC5B 3BB1A 1PZHA 4JBXA 4JI4B 2D0IA 1MEEA 2RHCA 2XYVA 4QGGA 4H6WA 1Z47A 5K0GA 4ETNA 1OBVA 3WTBA 5KYYB 3M4ZA 3RBVA 2W8BA 2B6NA 2R60A 1YKFA 4DQ0A 1CRQA 2YWRA 2VHUA 4YRCA 4MVJH 3MEQA 4U02A 1NBOA 4LSAA 2XC9A 3DOJA 3OA0A 2JA8G 3DYVA 4DQVA 2X6TA 2DTXA 5AUPB 1ZJZA 1JQKA 5DTMA 4EYOA 1CLEA 4JJIA 4YQFA 1UBNA 2QP4A 3U3XA 4BUJA 2R47A 3IOCA 4A9AA 2Y66A 5ALUA 1D0SA 3IDSA 3A1CA 2WTUA 3COVA 4M8SA 4J07A 1RQNA 1KFJB 1ORDA 5D5HA 5I3ZA 3PNYA 1WCXA 3I5MA 2W57A 4MS4A 4M7OA 2YU9A 1JHDA 4DL6A 4FFWA 3R7FA 4FU0A 2IDMA 4GLJA 2GCGA 1P44A 3Q98A 4C1NA 4LFAB 4KXQA 2KLBA 1F1BA 2DTEA 4LJYA 3DV9A 3Q10A 3SJZA 3I53A 1JHVA 1YFKA 3RIZA 4POOA 2PFKA 2XWQA 3JQ8B 4KXXA 3IQIX 4KUHA 2V65A 4LVCA 2KBFA 1BMQA 3D6HA 2H3HA 3QW2A 4ZEVA 5AJYA 4KR2A 1L3BA 3DCIA 4Z1OA 4Z54A 4NQRA 1TKRA 1JLSA 1K7CA 2QA5A 2ZSAA 5EJ4A 1GNPA 3IVRA 1S0NA 2CBZA 4G4GA 1ADYA 1O6BA 1W85B 5KTTA 5TVKA 3EVTA 5L7TA 1KJ8A 4DJTA 3PPWA 1O9GA 1VTKA 4RIIA 3KB1A 4JGBA 1OLSB 3ZY6A 4P5DA 2J4CA 1L4FA 4EFNA 5I5XA 5IJ0A 5C1IA 4FX2A 4L3VA 3P45A 3UOGA 1L7XA 5E2AA 2OA0A 2ENWA 1XMOH 3DA8A 1Z6PA 3V2UA 4CIXA 3HJCA 1ESCA 2WZDA 5C2JB 3GGPA 5DISC 1EK5A 5EXXA 4R9UC 3I45A 3T9DA 1S8OA 3V8EA 4U9HS 2OCYC 3ACDA 2X7HA 2HLDD 3F74A 2R7ZG 4WZBA 4R54A 1SU7A 1WXIA 1E8DA 4XCVA 4XD2A 1WPRA 3ICEA 2UAGA 2FMAA 3KAQA 2DKNA 1Q0SA 2Y27A 4WOJA 1U0EA 2XRFA 2H9AA 3AFOA 1USVA 3NHRA 3V6MA 1FS5A 4TKMA 3ILSA 1BDMA 3ZBTA 4UCXA 1G41A 1JJBA 1VBHA 1TEZA 2IOHA 2JARA 3INRA 4DCUA 4F86A 1IEWA 1PLJA 4XDZA 3IP9A 4OQLA 4EG1A 1UBLS 2AWOA 1WZIA 4HP8A 1IL0A 3RUAA 3UPTA 5TVGA 3REGA 4M0FA 1RSZA 1JIIA 1ZRMA 4HLQB 4X20A 1LDYA 1R2QA 3HCCA 4FCWA 5ALIA 5C80A 1NATA 4ZRDA 4ABTA 1FMCA 3EIWA 1DAKA 1MPTA 1USKA 1CRZA 2BGKA 1ULBA 4B3TH 1DUIA 5K6TA 1KL7A 1E63A 1WW3A 3LY9A 4DLVA 3BERA 3DR5A 2D1QA 5BR7A 2JBAB 3RRBA 5T4FA 1ZEJA 3KJZA 4NHEA 1FFHA 5BV0A 3TCXB 4KSBA 2J6UA 1DAMA 2CFIA 3MFIA 4E3WA 4QGBA 1XPRA 5AW1A 1V16A 1YV9A 4PBRA 4U8GA 4LE1A 2PYZA 4ZMRA 4R1MA 4J0JA 4OUDB 1VBKA 4HDNA 4ZJYA 4DIOA 2AXPA 2RIRA 3A1EA 1QRAA 5EE5B 2EWWA 1T9ZA 4M0DA 2P6PA 5ERXA 2G9NA 2R8EA 4JKOA 2AG1A 3GRRA 5KFPA 2ZI6A 4O4JB 2B4TO 1A5AB 3GLTA 4ZOBA 1NPTO 4AF8A 1E2IA 2QM3A 3ETEA 5EJ8A 4UHEA 3VQTA 4J16A 3NWOA 5K2MA 2VTVA 4ALKA 4N49A 1E1QA 4BV2A 3GLQA 4IOMA 4QFDA 2DY1A 1KKUA 3RYHB 4KGVA 1IJFA 1OKKD 5D01A 3DM9B 3D7RA 5EFZA 4KQ1A 1HKHA 4GMDA 4MW5A 1SKYB 3RIMA 1FX1A 1CRPA 3EJ6A 3SAJA 5EHZA 1AQIA 2D7CA 5DM0A 2MHCA 1XHEA 4DUYB 2QW8A 5JSZA 2X15A 3UJAA 1U2DA 5I5VA 3AEXA 4JGGA 3BFJA 1G7TA 1BFDA 4UFPA 3R5HA 1SFOA 4EARA 4BMYA 1J06A 4GMGA 3BACA 4JA0A 2H5JA 3K8ZA 1HQDA 2AK3A 4NU5A 4LI3X 4IIJF 3ZHRA 4LC9A 2F3RA 3NIGB 1CVIA 1EQAA 2H51A 1XFAA 3LWNA 2EEPA 4HC4A 4ZHQF 3AW8A 1XEAA 4P93A 2CW5A 3G17A 2V9CA 4ND8A 3N5KA 3TPFA 2JI6A 3PO3G 1DIAA 1REQA 1NVDA 1MMFB 1QYCA 4EHFA 1ZHHA 1UDXA 9GPBA 3TRJA 4L4YA 2WBLC 1VHLA 3IOEA 3Q41A 3EGOA 4FLMA 5EL0A 1RPZA 3C8ZA 5T4EA 2W9XA 1T0JB 4M53A 1FDIA 4TTTS 4CDMA 2B0CA 1H5QA 3OEED 3PQEA 1NX6A 1PZFA 2EC5A 1US8A 3OQJA 3SHQA 3E61A 3TNYA 1FRZA 5EI5A 1KA9H 4HDKB 1Y7HA 1H2EA 1CR1A 3CN7A 5IP5A 4EF4A 4MWCA 4DN6A 4HWRA 4QIWE 3UJ6A 3GG9A 1PWXA 2EXXA 1JKMA 4LJAA 1D5CA 4PTLA 1ZJWA 2Q5IA 3EAFA 3UYYA 4BO1A 4WBNB 1AS0A 3EYAA 3EIOA 5EZSA 2M9MA 4NAVA 4C3UA 3II6X 4GWKA 3SFTA 2GTIA 3GV8B 2XVMA 2W9BB 1XEXB 4IOJA 2WF5A 1RLIA 3QQ5A 4NK4A 2H9IA 1ISHA 2IZ7A 3N40P 3OFVA 1P1JA 2EWVA 1YFZA 1VKJA 3U7EB 4M0JA 3TQ1A 5EXEA 2H52A 5ESRA 4URWR 4BWGA 3K20A 3WLNA 2VXBA 3BMCA 3RAPR 2Z6QA 2BW0A 4HH0A 4OD0A 3WWCA 2FW7A 3ZVLA 4QPCA 1IPEA 5AVXA 5ESDA 2XIQA 2W98A 3MS2A 4DV4H 3C3AA 4B31A 2VDRB 1XDNA 1JWAB 3LUKA 1M6WA 2QW0X 1Z5OA 2NO7A 2ZRBA 2O6HA 4DR1B 3TW7A 3BPSA 1TEXA 5CB4B 3WMXA 1A8PA 2GD6A 4BMCA 3HZRA 1HDRA 3PFWO 5IULC 4A93G 3CRVA 4F1WA 3U4QB 4ZXPA 2OYCA 4BATA 1CEYA 2GB4A 3KQVA 3NP7A 4U7PB 3LPAA 4C6TB 1YT5A 1CUHA 2LP4Y 1V4BA 5JG7A 3SN6A 2JK0A 3LKDA 3E7PA 4I5IA 2QG4A 5EJMA 3G3EA 3P4YA 4GYWA 2OVFA 1NQTA 1O1YA 1Y6QA 1AQNA 3GNQA 3I3SR 4L22A 3U80A 1F8YA 2Q6IA 4S2EA 2Z8YA 3HCOA 2QZSA 5HRUA 5ICFA 4BKUA 4UMVA 1QFXA 3X1MA 3CJRA 3L1JA 4GBED 5M29A 1GAQA 1FA9A 1LNSA 3UYLA 2MSNA 2I4TA 1GNLA 1XXHE 2PRZA 2VOJA 7ADHA 1VCIA 5I7AA 4R3NA 3TVTA 4MVXA 4UNRA 2GCOB 3WLOA 5IHPA 1J1UA 3AVYA 3T5BA 3EVNA 2XKJE 1FYWA 2VHXA 1YZVA 5KPDA 2XYQA 4IRCA 3RRMA 1W75A 2FLPA 4GSLA 4V0LA 2GD2A 5AOVA 4J75A 1FW6A 1RYZA 2WJYA 4Q8EA 2FFJA 5JZBA 2Y99A 5KQLA 2NZWA 4TS1A 2HRDA 3OQIB 1WXHA 1L5RA 3T15A 2SECE 4ROTA 2EIHA 2AJBA 2O8BA 4UFOA 2PYIA 1NOJA 1YB1A 4PZ0A 3U6BA 2QQGA 4CKEB 4BEJA 5CDGA 2D6FA 4QASA 3UJ9A 2ZWAA 3SOZA 1W1UA 1DJOA 3LUFA 2XUPA 3EDYA 3GNLA 2QBYB 4R1NA 1DZ3A 3SI7A 4U7TB 4II7A 3DMYA 5K9ZA 1MAHA 1CD5A 4B4UA 2Y6UA 3B85A 1KI1A 5ITWA 3RF7A 3H65A 4FMDB 3LBHA 4AKSA 3CO5A 2WD7A 1JPJA 4ZK6A 4BFLA 4YGYA 5LA6A 1ILWA 4WBXC 1Z0FA 1G2PA 5JNRA 2O3QA 1QORA 3PXAA 4U7CA 1F48A 3U09A 3ONVA 2RK3A 2GO1A 3IBTA 4DAAA 4TYYA 4CHIA 1PE0A 3CWCA 4ND3A 3T35A 3HL0A 3LXUX 1NUSA 3AVWA 1N0VC 4YRFA 5KFJA 2AJ8A 2PX0A 5CLHA 1KNQA 1R00A 1KS9A 1S3GA 2QYOA 2VTBA 5ETJA 2L0XA 3E4CA 5CVUA 1JU4A 3D3QA 2G08A 2X14A 2Q3JA 4N39A 3EFEA 4LYYA 3GU3A 3WB0A 4M8IA 3QWBA 3R7AA 2E21A 4BO7A 2BFNA 3CEAA 4D26A 3UOAB 4KBYA 2APJA 4WACA 2R93G 1HF3A 4JI1H 5B7PA 4GR9A 3NEAA 2GA8A 4MK4A 5K3EA 3QWFA 2VQEB 1AKVA 3B9QA 4HQOA 1DRWA 1ATIA 3EE6A 4C6SA 2IPMA 2IP1A 4CMDA 4QDUA 1P61B 3P97A 2XCQA 2EFJA 5KWJA 3UJ7A 2Z2IA 3ECAA 1U1FA 4X3PA 4MWDA 4FONA 4L9WA 4DG5A 4DV7B 1HFWA 3V46A 4WASA 2D13A 2IOYA 4O8ZA 3MT8A 3WNDA 3HSYA 1MR3F 2CB9A 2FMFA 2EL7A 1L3CA 1E1DA 2HA3A 3FE2A 3TLJA 1VLVA 1B73A 1LI4A 1UBHS 4I9GA 2ASEA 1Z7YA 5KNCA 2Z08A 1E5VA 3DVQX 2Q0SA 5F2NA 1L4UA 2NUTA 3ROFA 2GEVA 1DWQA 5G3ZA 4XJSA 3O1LA 2BR5A 4UTNA 1UZAA 4G8CA 1QAMA 4QJFA 2LCQA 2FPRA 4HDMA 2V7QD 2HMAA 3VMMA 3JWEA 1M83A 4IY1A 5DBEX 3S8EA 1S02A 3WMGA 1HNWH 1XT6A 1RR6A 3FBTA 1KS2A 1U80A 4QFMA 3HHEA 4C03A 3HLKA 3AV3A 1KO7A 4KQGA 4C87A 1B8NA 5EHQA 1ZXLA 3KIPA 3L1IA 4BLWA 4O7TA 5LXTA 3ONWA 2GILA 2G80A 2P6NA 2EG5A 4JVLA 4IEEA 2Z02A 3VDXA 5FEMA 1E20A 2AQHA 5KKNB 4MTCA 3EVZA 5B1SA 2XE8A 4IEFB 2Z5FA 2CMKA 2J3LA 2YZGA 2Y1XA 2YMPA 1PI3A 1E1NA 2A0XA 1E4FT 5CLFA 4PN3A 1SCAA 1S2MA 4ECRA 1HR0H 3FGZA 3I8OA 1K8ZB 4ZO8A 5BSUA 5I5UA 4I4TA 1LLQA 4WV3A 2YY7A 4O7LA 4JB2A 3H9GA 5JVDA 2IX9A 2ZJZA 4OA8A 2C00A 1HORA 4V39A 4D6YA 3DEZA 2OHFA 4R84A 4ZK2A 1A0OA 3ZHYA 4F5ZA 2PVPA 5H1YA 1Q7RA 3ZLJA 1MC1A 4MGYR 5JC1A 4GFDA 1KIMA 4AUEA 4MA4A 1CT9A 2QSZA 3OQMA 4EHDA 1Z5WA 1JHZA 4W6ZA 4GI7A 3FYCA 4KLRA 2BF4A 3I4CA 3TE6A 1D2RA 3R7NA 2ODEA 1X8LA 4U3JB 3RVPA 2QVGA 3OZSA 1WRVA 4XWAA 5CX1B 4TT8A 1NSFA 5CJ2A 3UA4A 4GYKA 3A9TA 5L9AA 4Q9IA 3UMVA 1B8UA 1V95A 2Z8YM 2R87A 2CD9A 4PTZA 5EJEA 2BQUA 2DPGA 3DV0A 3VDMA 3PEUA 3RABA 1G6HA 4DLNA 4EIWA 4F04A 5KFFA 3B36A 1OW3B 2GEDA 5BO5A 3EGVA 3A8TA 4FN5A 4AJKA 3SXUB 4B3MH 3ND5A 4TMWA 3H8WA 2SKEA 1P6QA 1O4VA 2WJ6A 3MFYA 2Y3IA 4KN8A 5IJZA 4DJEC 3D3EA 4LCJA 1QMPA 4MULA 4F9EA 4O3RA 3BQMB 5TQ0A 2JK1A 5JFTA 1ESZA 5LM3A 4XQCA 2PIDA 4ILEA 4D3ZA 4DMUB 2XCUA 3IBYA 3IULA 3LXRA 5HF6A 3FFAA 2FQQA 3L6UA 3G9ZA 3ORQA 2EBUA 5A9SA 3I04M 4M98A 2G5CA 3PW7A 1UBTS 3KJEA 1PYGA 1G18A 1XYVA 1QHYA 4BY1G 2EZUA 3BXXA 3AC0A 1Q1EA 2RGDA 1Y8AA 1MZBA 3N3BC 3HA7A 5I5EA 4DDHA 1W88B 3FVRA 4LF9H 2IU4A 2FUKA 4HTAA 1Z2PX 4I8IA 3PF8A 3DL7A 3FPEA 2WJZB 1I6MA 4CJXA 2PQ6A 4GM0A 2OK7A 1HDGO 1VRVA 1SBIA 5T6MA 1AKTA 1JNYA 5A5FA 1KDOA 3QNWA 3OCUA 2OGWA 4U9IS 4TX1A 2FAXA 1OFTA 1WZEA 4PYIA 2NU6B 4QU0A 3GTMA 1EZ4A 3KUUA 3UAZA 2V6IA 3R3YA 1NYTA 1UBFA 4AJ1A 1DAFA 4ID9A 3CCBA 2P4QA 4X64H 1KMCA 1AGXA 2I80A 2IS4A 3TTWA 4DXAA 3F6BX 1RYDA 1MX1A 3BZBA 4FI3C 3SYRA 3UF0A 5GJCA 1L8AA 4ECEA 1NXQA 1CDZA 3RTEA 3WGGA 3EC7A 9LDTA 1C5KA 3C85A 2VUTA 3BGVA 2VUMG 4DV1B 4PSUA 1H93A 3GB9A 3K8OE 4OYHA 5EKTA 4QFBA 1HT0A 3GBVA 5JY1A 5SZHB 2Z95A 5JAUA 1PX2A 1C7QA 4LXGA 4RANA 1IBLH 1L4YA 4CL2A 2CJWB 3NOQA 1UZUA 4LOKA 3CINA 3QLVC 5D2CA 3NIFB 1FFAA 4IQ8A 5GINE 3TS1A 1S3SA 4YJ3B 5EMLA 2IPAB 3WLTA 4V38A 1GL7A 1CNFA 2FEXA 4L75A 4LHEA 5CT6A 3NLLA 3WRXC 4X45A 4I50F 4NECA 4DQXA 4KXLA 3LK7A 2H63A 2BHLA 5LP6F 1GCOA 1X9GA 1IDOA 1UK9A 4R6WA 1KKMA 1SBNE 3A1TA 1ID1A 2WSLA 4FC6A 4Y9UA 3WIVA 4CDGA 5KOHB 5BWLA 5U4QA 3OJXA 2J6TA 4MVWA 4ZDWA 2OLKA 3PSHA 4PHCA 1SOWA 2UVVA 1KEEB 1K1EA 13PKA 1PL8A 4EW6A 4M4SA 1ADGA 2W83A 5JCJA 3DZDA 4FCTA 3CRNA 1VB3A 5C44G 5BSFA 5JH7B 1WCV1 2YIVX 4G1EB 3WLKX 3B9PA 4XXHA 2P4UA 2ONZA 1X7ZA 3PTZA 1L4GA 3P0HA 2QMHA 4KN9S 1FDUA 2QR2A 4ZAYA 2AMVA 4IIYA 4EHNA 3BE6A 2BR0A 4GZLA 3RVNA 3M6FA 4N1AA 1BVUA 3OQ1A 3HU5A 2FI1A 5LU9A 3V8PA 4ZPXA 5KTPA 2J7KA 3BXOA 3AB7A 1M2GA 1OI3A 4URXR 3HYSA 1FVFA 2WDTA 5ITVA 1F4VA 3DUFB 1NMEA 4QD3A 1DXQA 1KMHB 2PA3A 4RPHA 2ZETA 2C5EA 1HT3A 3G9TA 1PHRA 5BSMA 4EDHA 2V98A 1BYUA 4NZOA 2GI4A 1FLVA 3HVHA 3SS7X 3WGJA 2ZIXA 1FTGA 1YB4A 2JHAA 1JEDA 5CK4A 4LGVA 1J0EA 5F51A 3D8RA 2HA0A 3GGGA 4JX9A 5JQGB 2HCRA 3FI0A 2EP8A 3HZOA 3O2QB 2AQ4A 3QU9A 4XIYA 2XVXA 3I73A 2EQAA 3Q7SA 2HEGA 1CCWA 3JCZA 4YCNA 4OLFA 4QPPA 1XNRB 2BM0A 3SG0A 5L1IA 2PZGA 4X97A 2OB1A 2AMYA 3PWSA 1T9GR 1PDOA 4TQRA 3F2IA 2Y4NA 1W48A 2X5XA 2J3JA 3JR3A 4E32A 2B5VA 3BWBA 3RHFA 1DVRA 3EDRA 1ZDMA 3VUEA 1U7TA 3EB9A 4JYZA 3FVTA 2NSJA 4FIZA 5FI1B 5IUJC 3IQHX 3VO9A 3OTGA 4LPSA 4TWRA 3CR3C 1PJ3A 2NU9A 1QO7A 4KIUA 4RL6A 3AIMA 2O52A 3FWNA 1UXOA 1L5NA 1E2BA 5FO1A 3FTFA 5LQRA 2JATA 1WDKA 2FSIA 4ZZ3A 3LO5A 2IUSA 2P91A 3WIDA 2FVXA 4FYMA 1N57A 1YK1A 1QYIA 5DCLA 4NYIQ 3K09C 4M6WB 3DKIA 2YWBA 4KPYA 2F17A 4X62B 1SXGA 4FFSA 3KWJA 2G76A 2O5RA 2IVFA 5AHWA 2ZTUA 4J0FA 3SX4A 2DJIA 3L4BC 1B6SA 1BZYA 5LZ8A 3ZCSA 2VA3A 3B3QA 4EYKA 1CHNA 5CUQA 4RVGA 3GTOA 5BURA 1F8UA 1WCMG 4M54A 3WSTA 3ZWVA 3TFWA 3U4HA 3SDZA 4FE7A 4MPDA 1U99A 5AJUA 4XPIB 2AFIB 2I7VA 4TTRA 1VHJA 2GCEA 2VDJA 1LUAA 3GJ7A 1VZ3A 4YQEA 3PUJA 3H5IA 2A8YA 1ZM9A 1DFIA 3S70A 4L02A 4FMCB 3CUEF 2H29A 3UMRA 3K72B 3ZDDA 2AOVA 5KVAA 4W1SA 3KQTA 1M0SA 1F2TA 4EEQA 3K32A 1X7YA 3ZWNA 1QIMA 3KPYA 1E1YA 2YS6A 3I5AA 4RCNA 4DZRA 1TPZA 1LV7A 5LUBA 1XCLA 2YY6A 4KWIA 1GDTA 4YAOA 1OPXA 3I9JA 2EJCA 1IXRC 1WV0A 2Z5GA 2V7BA 3G82C 3GJ0A 1XD9A 1T2FA 4I4IA 1X1AA 5BSWA 3JR7A 2C8LA 5KQGA 2Y1GA 2AZMA 4E21A 5KDDA 2VNJA 3JQRA 1CQPA 3WAJA 5EFOA 3AONB 5ILGA 2IXBA 3TSWA 3ZHSA 4HFJA 2OXIA 1YB7A 1JZSA 4GBMA 4Q3DA 2ASLA 4L08A 2P78A 1YMQA 3W1BA 4IOLA 5DB4A 3PKIA 3I4LA 2AFHB 4CYMA 1TKAA 2P2YA 2NVYA 4OQ4A 4DV6H 4URUR 1ZOSA 3ANLA 4CN9A 1KRXA 3IKTA 1YCGA 1P9WA 1LLDA 4FYVA 1T6YA 4OJYA 1OX5A 3U60B 3HKCA 4DYHA 1DEKA 1Y33E 4PQRA 4M1KA 3ADPA 5J63A 2P6RA 2ZT7A 3VHXA 2HFKA 1R10A 4FOLA 1DQYA 3DP9A 2G28A 1OBCA 4DUPA 2QPTA 4FFDA 3WRWA 4Y8VB 1R4ZA 3IVMA 5LYYA 2QF7A 1ZJ5A 2MCTA 4XA8A 1FPMA 4UUGA 5I9IA 1XJ5A 4GZ6A 5L3ZA 1D03A 3DO5A 4QEKA 5L8VA 1JDEA 4LKRA 1HLGA 1U5AA 1M2VB 4XM1A 2VJQA 2MWMA 5EHNA 4C05A 4H6XA 3UW1A 5A9TA 2Z83A 4KZKA 1ZD9A 1J70A 3LOPA 4Y9RA 4U7WA 5IAOA 1RMQA 3SLGA 4YK7A 2REBA 1QANA 5FD6A 2A86A 3EPLA 4HD8A 2CEKA 5AVVA 4KN5A 5BWWA 1LA2A 1E0AA 1YO6A 4ZRNA 2EEZA 2I4LA 1C3JA 1CULC 3W34A 2YC4C 4G09A 4OQQA 3PNLA 2QDKA 2JEJA 2ZTLA 1NVVQ 2ZRQA 3T61A 2ZUWA 2G7MC 3C3WA 1IOZA 1QUFA 2H3EA 4UCVA 1Z5PA 4G26A 3EC2A 4OOEA 3IG0A 6CHYA 5D6NA 3T5PA 2I4NA 4RCZA 2PMKA 1G5FA 2FEPA 3IAS1 4MUIA 4L50A 3K2QA 2GF0A 4XAQA 5IEBA 4MCIA 1KI6B 1Z4JA 2OCBA 3T7CA 2OAEA 1K7XB 3WQRA 4WXPA 4OXKA 3MSCA 4MRMA 3SS9X 2Y9PB 4K6CA 3NONA 3A4YA 4AX8A 1XG5A 4RSMA 2JRLA 1QFZA 1CHDA 2F8MA 4Q4HB 1WSAA 2PUTA 3H4VA 2CE2X 4MUJA 1ZVKA 1YGYA 4GOOD 1MX3A 3U44A 5C5DA 4ZOCA 1VXRA 5K4HA 2V74B 4MQLA 2AQ8A 2O05A 4GI2A 2H1LA 2O20A 4B3DA 1IONA 1NOKA 3BJIC 1YKGA 2H7CA 4R4JA 4DLWA 3HDHA 2W2PA 2WJPA 4WFIA 1A71A 2YX1A 3M1IA 5J5AA 3VM6A 3JRNA 4INAA 2X0FA 4HUTA 1OTXA 4EI9A 2AOWA 2OV8A 5BWVA 3OPQA 3LYUA 1XDUA 1KOJA 1OXXK 2QD5A 4XR9A 4PGAA 2O5VA 2ZJ1A 4YAUA 2YVUA 1XMQB 5T3UA 1LPOA 1GFZA 1RWWA 2G82A 3SIXA 5HIJA 1GZHB 3UHJA 3S55A 1GGFA 5KT7A 5E4FA 4E4RA 3CH4B 2IW1A 2OAGA 1MOSA 4V1CB 4QPZA 3WYFA 1T9CA 1W52X 1NA5A 4YREA 5IYBG 4GX2A 3J7AC 2O14A 3HLTA 3NBYB 4X44A 4LF4H 1PFQA 3ZVNA 2W6QA 3ERCA 2D5BA 3WLHA 3KKQA 3OF3A 2VRBA 3KXDA 4YMLA 4JOCA 5DNCA 3F7MA 3N0WA 2ILTA 5TGDA 4L73A 5LJLA 4KYVA 4K9PA 3NR2A 4TV8B 4EECA 5B1IA 1UMCA 1HMPA 4ETMA 1KGDA 5KX5B 3JPYA 5JDCC 5C8ZA 1E2LA 5CLJA 2QOEA 2V6FA 4M3NA 1I30A 3D31A 3I76A 4QYXA 2YWDA 3RJ9A 4Z86A 1M76A 3Q11A 3E5HA 4AX4A 2C4MA 4YRSA 2OMKA 3QLVA 4C4OA 3HXTA 4QLBA 1DO2A 3OSNA 3SX0A 1OGJA 3HKEA 4GP7A 3BE4A 3W4KA 4AS2A 2EFDB 4YAJA 3OHAA 1UBRS 4HAZA 2CXQA 1VMAA 3NYRA 3WRXA 1Z6XA 2M6RA 2JH9A 4Q7LA 1HMYA 5HS6A 3Q8XB 4C5AA 5FPSA 4FNOA 1BVRA 1NZDA 3G5UA 5F2OA 4DG9A 4O08A 4G0ZA 1I2KA 1PQYA 3UTCA 3C3CA 1A9YA 2GSWA 3FPJA 3AOEC 5CVVA 1VLQA 4WMLA 4FFBB 1AF4A 2BISA 2MMGA 1JFTA 2R00A 4CTNA 3FYHA 3DXZA 2R66A 2B8NA 4YWHA 3WBJA 1GR1A 1Y4DE 3OCYA 1Z2DA 3MR5A 4DR4H 4IIBA 2AR7A 1VG1A 1XF1A 2CLCX 3GGOA 3OFSA 4ECYA 2C0PA 3CGWA 3GWGA 4CLRB 2P3QA 2MSDB 3MXTA 3V1NA 4TS4A 5CJPA 1RLOA 5B57C 3FXAA 3H0CA 4JLKA 5K8UA 1LB1B 2IYLD 3CNBA 4HMPA 2AZTA 3RT1A 1R3DA 3NASA 2ZYWX 3KPWA 1NMYA 1EP9A 4WLFA 5FB3A 9LDBA 4MRAA 1D0IA 3A70A 1AKEA 3HR8A 1ZJJA 3EWIA 3CF6R 3L4JA 4HNVA 4PZ6A 4X66H 1KAEA 4XEUA 5GMOA 4F93B 1R8XA 2OORC 4OFBA 1HSZA 2YDXA 1RI5A 5B5SA 2P62A 1ZK3A 1E3TA 3DVRX 2CMDA 4FX5A 3PZPA 4LSMA 1AQUA 1T6NA 4P3XA 4QYTA 4M86A 2GDJA 4OM7A 4Q4JA 1QIEA 2X76A 4ESEA 3U7QA 3NNNA 4B7AA 2ORED 1PR0A 2XJ4A 1FFXA 5COAA 3E05A 4CV0A 4K0RA 4B4KA 4GGPA 3KOXA 4ZVPA 5KYWA 4PPQA 1GSHA 5MF6A 1WP4A 3M81A 3ICWA 5AM1A 3EUAA 2C2YA 2A3NA 1KC1A 4RTOA 4FYJA 3C5VA 2OGUA 2RDJA 5L51A 1BXZA 1K2VN 4NAHA 1XJWA 1TU4A 1D1SA 3LYAA 1LX7A 3K96A 1E32A 5C8XA 1EVYA 1HE3A 3QX3A 3Q8QB 1M1YB 3DE3X 2PRKA 3N8KA 3FKIA 4D9MA 3VU3A 3GH3A 2Q4EA 3L2PA 2CF6A 4IBOA 4UBLA 3VGPA 1CX9B 3VC3A 2I2FA 5B2ZA 4MUNA 4C7JA 3LTNC 1TLFA 1BX0A 3EXG1 4CUKA 1V4VA 3OWHA 2JVJA 4EEXA 3IEPA 2DUWA 1XZEA 1JR6A 5TNXA 4QW9A 2R6DA 5TJHA 5IZ4A 2XRZA 3HG7A 2HWXA 4UQOA 1XN4A 4MI1A 4PX5A 3BIXA 4V0NA 3VZDA 2W0MA 3V8QA 4IXNA 2QJTA 3K09A 2EP5A 2PK3A 4CKCA 1K7SN 4BQRA 4L6IA 2C5AA 3QKWA 5JXGA 4QSMA 3AVUA 3UWKA 5I7SA 3L4BA 4LJLA 5DBIA 4XRGA 3IPCA 4Y98A 2AS0A 4YR7A 2OZLB 3KKPA 4XSGA 4X94A 4CMEC 4B7UA 1QB8A 2GS9A 4DSZA 4PDBA 1A4XA 4Q0YA 4DV3H 2D3WA 1G2IA 2MYUA 1FLNA 3W04A 3MJHA 4BPRA 2RE8A 4HADA 4YP1A 1G9XA 4Y9DA 5ALWA 4F1JA 3VZCA 1HQYE 1SUPA 3W1GA 3TJMA 5BOVA 5FI0B 3KHKA 2H2WA 3RHZA 3B12A 4JP8A 3LAWA 1KPIA 3KUXA 2XNSA 4BQPA 4EUEA 4BQFA 1EUCA 1EXVA 5J58A 1LPNA 4Z49A 1OLXA 2NZUG 2WHPA 1W49A 3CLVA 3RC7A 1QYRA 2WUEA 4JLBA 4OBXA 3IHWA 2HSZA 5IBCA 2GEFA 3SQLA 3OTHA 2VP0A 3GRAA 4D74A 3K0FA 5C34B 1H0HA 3M34A 4KAFA 1L5LA 2XA1A 4H3KB 4XM2A 4QL3A 1VL5A 3DTVB 3L0OA 3AOGA 5BPHA 2P5TB 5KT3A 5BMVF 4ZIRA 2AE2A 2WB2A 1QZ3A 5KAMA 4OTZA 5JJ5A 2HIVA 4I1VA 3ZBPA 1H5UA 1WXQA 1M34A 2PUHA 1Y5NA 4RTJA 3M2TA 4IZ6A 4U7FA 3H6KA 3IJPA 3NBZC 2X77A 4BNDB 3L84A 1EMDA 4YY3H 1N2IA 3E1GA 4LXQA 3Q1LA 2P11A 1SOUA 2REXB 4QO7A 4PHFA 1DKUA 3BCUA 4PAQA 3QVMA 3BBPA 3H0GG 2VDWB 3QE2A 3GRZA 2C35B 4PLPA 4F4UA 1D04A 3ORFA 4KQFA 2FK1A 4MW6A 2GAJA 3KJQA 1HLDA 3IMEA 5JMOA 4E2XA 1Y80A 1E94E 2ZS7A 4CC5A 2QDXA 3OHBA 1RQPA 5BVGA 4EHBA 1D2EA 5TS2A 1PL7A 1VPLA 1P0PA 4RVCA 1X1TA 3OCJA 1WIWA 4A2CA 4JS0A 3S3TA 1CRLA 3TW8B 1BAPA 4DL5A 2B8JA 4MTLA 3JASA 3KT0A 1UEJA 1IY2A 3RPEA 3OIUA 3WFIA 3RVMA 4Y2SA 2JF0A 4LWQA 2JFFA 3V97A 2Z98A 4B4DA 2AHOA 4MQ6A 3GVCA 3DBLB 2PE5A 2QMYA 4M7PA 2KI5A 1TYCA 1ZN8A 3UAWA 5FL7D 5KFIA 4XCXA 1RP1A 2OK8A 2WWWA 5CDUA 2I2CA 3LGSA 5EESA 4ZQEA 3DP7A 2OBYA 2FLNA 5FPHA 2FVYA 1R6DA 2HJSA 4PEVA 3CR8A 1KYVA 4NJMA 5AHRA 4U2DA 1UKAA 3V6HA 3JQBC 1DBIA 3UJ3X 3HK2A 3UQYS 4UBMA 1XTUA 1V3TA 1UFRA 2IZ6A 3PBKA 1S01A 1PR2A 2GAIA 5KWIA 2WMYA 4BVJA 3SQWA 3ASUA 1OJ7A 2R8XA 4TXHA 5KFYA 4PNHA 4N5NA 1RI2A 2IHUA 2VKTA 4A6PA 5AJZA 4MIOA 3SEQA 3QLTA 3FKQA 4KP7A 1YBVA 2AEEA 4E6NA 4ID3A 3FWZA 4UUMA 1WWKA 4G0MA 1X1EA 3MGBA 3SNHA 3C1TA 4PYQA 1COWA 2XOXA 4IRXA 4JHXA 3O75A 2X86A 1X3LA 3O9ZA 3R0JA 3LXXA 3PZBA 1Q22A 3OLCX 4IZHA 2F9MA 1JIVA 1YWGO 2O0KA 4H35A 3I6ZA 1J21A 4X61A 2ZBGA 3MB5A 1AN9A 2J6CA 5HSGA 3FOZA 3RC2A 3CVVA 1V8DA 3EA4A 1AQ6A 4OAQA 4ECVA 2WVAA 1EDBA 2VWGA 1Z5ZA 1G42A 4DLLA 3VR4H 2Q2TA 4XX0A 2ZYTX 2XPCA 3NKLA 3N75A 3MAJA 3V4SA 1O57A 5K8TA 4WQMA 3BCRA 5HK9A 1AA9A 3PXUA 3QQMA 1FRQA 2H5IA 5B4VA 4LXHA 4IQFA 1T4GA 1N5OX 2IXAA 5TSDA 1DT5A 4QBGB 2JA5A 3SHOA 1AUPA 3U3DA 3I6MA 4BBJA 4GGOA 5DLFA 3KCNA 3PDUA 4I50A 4QRIA 4R9SA 2YVQA 3JYLA 3UHOA 2XUGA 1S68A 1OHHA 1CQXA 4UXJA 3MNFA 5CNKA 1YQWA 3L7CA 3E23A 5I4IA 4TM8A 2BAGA 4MWEA 4PLCA 3UT6A 4D45A 1QVWA 4PZLA 5IX8A 4GDFA 3LOUA 1TC1A 3GRKA 4O2BB 2J5RA 1F14A 3G8DA 1GZUA 3RHSA 5JNTA 1DMSA 2C31A 1O5OA 3ESQA 2PZEA 5JDCA 2W4QA 1VHQA 2FDCA 3UQ8A 2VKQA 2EW2A 5L3RA 1YJQA 3RCBA 3D3WB 1UZMA 1S5PA 4RTKA 3O3MB 4J0CA 4ZGWA 2E89A 4F2PA 1Q74A 2UUCB 1QE3A 4C7OA 1MPXA 5LMUH 2PKCA 2WOJA 3SYKA 1YRYE 2PS9A 4UTRA 4AO7A 4PO8A 3TR6A 3S1AA 1NP6A 4EK9A 2CCKA 3LQRA 2GM9A 2JLAA 4PRKA 2QIOA 3OICA 2JGIA 3PUIA 3R4CA 3DE6X 3C6KA 5LMCA 4IJWA 2IEAA 3AOEA 3DE7X 2IVZA 1DBQA 3H2HA 2H1SA 2R8JA 3O3OB 3U31A 3T99A 3EPPA 3PHHA 4JT9A 4IF6A 3PA8A 5J2UB 1JFLA 2VH1A 2XQVA 1WZNA 1DB3A 3RB8A 4HDQB 4IXTA 1NXWA 1XVLA 3G0CA 3JWGA 3QYPA 3PNSA 3NU1A 2FN4A 3QVXA 2R92A 4GG1A 4DIEA 1W36B 4W5HA 3DPIA 4A27A 5KAPA 2L19A 1BS1A 4A2WA 1O96A 5A5VA 4RPCA 1T10A 1L4HA 2C07A 2G8LA 2ODQA 1J25A 1GWNA 2ZE7A 4FPXA 3H11B 4JEHA 2RH9B 4CKXA 3E03A 2G17A 2OORA 4IJ6A 3HPQA 1DJNA 4LRXA 5IAEA 2O8CA 3AY6A 4PZ9A 1P72A 2O4UX 1J2EA 3CT6A 2ZSEA 4UD6A 2OCDA 1I5OA 3JARB 4F72A 4U2CA 3GFSA 2HN9A 4ZI5A 1V47A 4ND5A 1ZM7A 3H2BA 1GNVA 4DLBA 5JLAA 2XODA 3BWDD 2NU8B 1QQAA 4R8KA 2F6RA 4EKYA 4UTOA 4BDTA 3BYZA 3O1IC 3GLGE 2XZPA 5JD3A 2IS6A 4FZJA 2YIDA 4LBWA 8GPBA 4UUAA 3OU6A 2RK6A 1XKTA 1CFJA 3FSEA 3L41A 2R9VA 4QDJA 3VZBA 2PNFA 3HJFA 1XZFA 4HNUA 1K88A 3MR6A 4CXMA 1AS2A 1TUBA 1E1RA 4TTIA 4PYMA 3O8RA 3R5FA 1R4MB 1NKSA 1B43A 1YBFA 1QHSA 3V1MA 4JI4H 2XEXA 1P6UA 1UANA 3KHGA 3B6IA 4BVGA 2DLCX 1G8PA 5DU2A 4R05A 5HFJA 4LHZA 4YHBA 4IFBA 2WIJA 4QM7A 1Z18A 4YB8A 2IA5A 1IZ8A 3OX1A 2IZ1A 3SQOA 2ZZMA 1X15A 1YACA 2IQ5A 2DRIA 5L7WA 1S8FA 3L7DA 3WISA 2R8KA 2CUTA 4PG7A 4MVJE 4YP0A 1F9AA 3BABA 3DBHB 2E55A 2YXLA 3KTAA 1DCKA 3R0ZA 4BOYA 5CIYA 2PBLA 3L1KA 3OY2A 4UE3S 1F2DA 1NVBA 3DWEX 3EQ2A 2QEQA 4FWTA 1I8TA 1Y3IA 5BMOA 2IYZA 4AQ7A 2COKA 4YUZA 1JE0A 4CMEA 3H8JA 2WKWA 1ESNA 2JEGA 1XQXA 4BJ3A 2VYNA 2J32A 3AFMA 1ZNWA 2QPOA 5DHTA 2HYDA 2J6IA 3TECE 4LFAH 3A14A 3SSOA 2X2FA 1DU4A 4HHEA 3OIGA 3NCTA 2PO7A 4OK6A 4RB0A 5F5LA 5BORA 3VPFA 1FL9A 1A4RA 4HSEA 4R2MA 2HHFB 4B6RA 5LYJB 1T9KA 3RK4A 3BJYA 3H86A 5EQJB 5ALSA 4TL8A 4D02A 1SCQA 4EKGA 3WBFA 1NPDA 5FO0A 4DDMA 5L53A 1ORHA 1GL3A 1MVLA 5IJXA 4BWSC 3IP5A 3TG8A 2Q3BA 1CUBA 1HDYA 3LDUA 1RHJA 2C7RA 4G07A 4ROSA 1JBQA 2QD2A 3QPAA 1K8QA 1I3OA 3ML1A 4DCCA 4KYUA 3P9NA 3Q0EA 1RKVA 2GF9A 4RD3A 1GPNA 3FG9A 3NWPA 4DT1A 2JCYA 1C4WA 3N86A 1GV0A 1YU9A 2XUQA 2WFMA 3RBDA 2DR2A 1T91A 1KJNA 3FROA 3GT3A 2B61A 2VA9A 1PD0A 3ZWPA 2EX0A 4M1TA 3G89A 3HN6A 4OQXA 2WE8A 3AEQB 4AK9A 1WMBA 3V8RA 4EKEA 2HK7A 4Q45A 1OD6A 221PA 1MEOA 3ZZTA 2J41A 3OZGA 3MUOA 3HCFA 3WDMA 3M83A 2HZ7A 2QJWA 1BKDR 3WRVA 3UJPA 4IQGA 1P60A 5K3CA 3N39C 3TMAA 3TJRA 4BV3A 4AZ3A 3ZZNA 5LFAA 1RU3A 4YRJA 1ZA2A 1XAJA 4BQSA 5FLKA 3TQOA 2GUWA 3O7WA 3EFOA 1WB6A 4IDBA 2EJ0A 3RC9A 5LB4A 1EFRD 2JKYA 2CVHA 1B6TA 3L7LA 2B7CA 1YR1A 1B0PA 2J3EA 3SMQA 3E6AA 2X5RA 1HA3A 1YC5A 2E1PA 1ZSYA 1N48A 2DFDA 3VDNB 2XMBA 3A0UA 4W5NA 3FYSA 3T9CA 3BIOA 5CM0A 1EGMB 1LTKA 4K8OA 1BC5A 3HQ4O 3LC7O 4O4HB 4LHVA 2J4FA 2HL6A 2NVOA 2QQ5A 1I4TD 2O2IA 3G2MA 1QOQB 4FYKA 2R1ZA 1Z73A 5SZJA 3RGGA 3HTXA 4U39A 2DHQA 2Q99A 4AO8A 4BX8A 4FWIB 3N2GA 4BNKA 3VAYA 4HN2A 2OFPA 3JQBA 4CGYA 3IA2A 4H4EA 1T3TA 1TYDE 1YE3A 1RS0A 4K9QA 4LBYA 2QR3A 4YTEA 2Z4RA 1MABB 1QGUB 4PTYA 2I4IA 1DG9A 3W5VA 1EUQA 1CUJA 3P2KA 4HV4A 3QVWA 5IG2A 1D4AA 3NUAA 3QBVA 4RKEA 3Q3IA 2ZLBA 3RD5A 3E7WA 2ZRFA 5EINA 2RGCA 1IN1A 1Y3DE 4XE5A 4ALIA 3T3PB 4O5OA 4EMTA 5JBNA 2ABWA 5P8WA 1RVDA 2BCJQ 3F5MA 1RRVA 3G5LA 4TYMA 3KX2A 3V00A 4B4OA 1FBNA 1PVDA 3NB0A 2FWAA 3O82A 3GRVA 4LYGA 3QKSA 2HDHA 4EPVA 1GKIA 3ZXUB 5FH9A 2A9OA 1ST2A 4JSRA 3FMAA 4AUNA 3HOVG 2ZAYA 1TO2E 3KS9A 1Y4ZA 3OH8A 3VPGA 4YUWA 4ZZIA 1GQQA 1OC2A 5FLEX 1Z8FA 3OJOA 5K0JA 1NOIA 2R68A 2VBIA 5KS2A 4WOBA 4B6FA 4CI0B 4EGJA 1GNRA 1J23A 1VI2A 3IN5A 3KU4A 3R0VA 3IRVA 4HQ0A 2L82A 3I1IA 2UXCH 2OD7A 4TSRA 4DUYH 1TCVA 3LA8A 4CM3A 1T6XA 2J3IA 3IERA 1RJFA 1T9GS 1L7OA 1KO8A 2FOXA 2FE1A 5ISMA 3NVAA 5HWSA 5FR9A 2NTEA 3PSAA 2VZLA 1WDMA 3LECA 5JNLA 3QMWA 2YTZA 3M9NB 4F46A 3NGMA 3EIXA 2XCTB 3KNZA 2IYQA 2ONKA 2WDZA 2F8LA 1GP2A 3Q8KA 4OQNA 4NH0A 4YDRA 4BWFB 3HBFA 1P7WA 4DIBA 4JB3A 4KO3S 3QSYA 1H94A 5BVHA 4M21A 3GI1A 4GC9A 2RBEA 4ZEXA 2M6SA 2J8ZA 2GBPA 3PLNA 4AZWA 4PF1A 1W5BA 2XE4A 5EAIA 3RTBA 2AXQA 1T8PA 3UV3A 3U4IA 4DIUA 1JPNA 3DAOA 3IAAA 4B3BA 3CRMA 3FLMA 3BJEA 3PYXA 1WX1A 2IK8A 2O6LA 4WFKA 2AFRA 2G9QA 3EXFA 4GECA 3FTPA 1JSRA 1AKQA 4C0QC 2PMDA 4C2BA 3S2YA 1NFRA 3RS0A 1HOXA 1R6AA 4PG8A 4IDAA 3STXA 4JVMA 4EZBA 3RYCA 4II3A 1BVHA 2XNDD 4IDEA 4KFUA 2GPJA 3RWMB 2ZTMA 4H1VA 3V2HA 2VBCA 4BVLA 4YRIA 4EW2A 4O4IA 1NTRA 3J7TA 1P2DA 3EY4A 3GLUA 2QIPA 7REQA 3M4IA 4YMIA 3ZVRA 3S2UA 5JUWA 5JWHA 3HOZG 5H83A 2F59A 2QMZA 2RFLA 3MJ4A 3FVVA 4G0OA 5KS8A 3NM4A 4EUSA 2J5XA 1SNYA 3ROPA 1WHSA 4QOGA 4EI7A 1V8FA 1W59A 1CJUC 3LBNA 2YCBA 3AUAA 2DWOA 2J9XB 1RKXA 2I4OA 3UH1A 4V0QA 3CUUA 1Z2OX 1J07A 3JWPA 2R1TB 1DFGA 4BMVA 3MVEA 2OSBA 4P33A 1U02A 5EYPB 2VLBA 1P0QA 3AXTA 1U2EA 2XYHA 3T7RA 3ZWYA 5KZMB 2PZLA 2H65A 3ST7A 4Q37A 2XRYA 2L17A 4DR1H 4INZA 3HA5A 4XJVA </