3MWDA

Truncated human atp-citrate lyase with citrate bound
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
424
structure length
424
Chain Sequence
b'SAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNELANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRAIRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALGHRPIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-citrate synthase
publication title Identification of the citrate-binding site of human ATP-citrate lyase using X-ray crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 124
structure length 424
sequence length 424
ec nomenclature ec 2.3.3.8: ATP citrate synthase.
pdb deposition date 2010-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16114 Citrate_bind ATP citrate lyase citrate-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3mwdA01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3mwdA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 3mwdA03
1DIKA 4I4TF 5BMVF 2FPPA 4YAJA 2FPGB 5C8YF 4XYMB 4TV8F 4L1KA 5D8DA 1ULZA 1C3OA 3GLKA 5JH7F 2YRXA 4MV3A 1JLLA 4FGRA 2NU7A 1VBHA 2FPIA 3U9SA 2R86A 1CE8A 1EYZA 3VPCA 5JQGF 2P0AA 3SE7A 5BPFA 2FPPB 5C1PA 3QFFA 2NUAA 2I87A 3UFXA 3LP8A 3KREA 2R87A 2ZDQA 4MV6A 5JQWA 2IP4A 3Q1KA 4E4TA 4C5AA 2W6PA 1C30A 1DV1A 4MV1A 3TW6A 2YS7A 1A48A 4FFNA 2YWVA 4IWXA 1GGOA 2YYAA 2NUAB 3DMYA 2W71A 1EUDA 1KJQA 1B6SA 2QF7A 1E4EA 2R82A 3TQTA 1BNCA 3RV4A 4IHJF 4FU0A 3VOTA 1WR2A 1JKJA 5IYZF 2J9GA 1KJJA 4O7LA 4ZI7F 1KJ9A 4O83A 4C5CA 1EUCA 3KALA 1M6VA 4I50F 5J2UF 1CQJA 1E4EB 2NU9A 2YRWA 2VR1A 2FP4A 5LYJF 1BXRA 3R9RA 3G8CA 4MV7A 3R5XA 2W6MA 2R6FA 1JKJB 1M0WA 4O4IF 2YZMA 2GPSA 4O7YA 1JDBB 4WD3A 2PN1A 3V4SA 1EUCB 3K5HA 3OUUA 4FFRA 1I7NA 4O7NA 1W96A 1PK8A 4O7TA 4HQ6A 5CB4F 1CQJB 2NU9B 4O4LF 4FFOA 2XCLA 2FP4B 1Z2NX 2ZDGA 4O2BF 2W6NA 3DF7A 3TINA 5FNVF 4YJ2F 4MA5A 2GPWA 3U54A 4XYLA 4ZHQF 2R7LA 2WYOA 4XZ3B 4HNUA 4WBNF 2NU8A 2DIKA 1KJ8A 2CNUA 4YAJB 4HNTA 2C00A 1UC9A 3RUPA 3ETHA 4ZQIA 2NU6A 3KAKA 1VKZA 2YZLA 5GONF 1CQIA 1IOVA 1JLLB 1EZ1A 2NU7B 4M9UA 2FPIB 2R85A 4RZQA 3K5IA 4XYLB 2I8CA 2I80A 3MWEA 3R5FA 2NU8B 5EZYF 5I47A 1AUVA 2R7MA 3TIGA 3BG5A 4ZOLF 4O4HF 4XZ3A 1GSHA 4FE2A 2R7KA 3UFXB 3AX6A 2NU6B 4EG0A 5LXTF 3ORQA 1CQIB 3G8DA 3HBLA 1KEEA 3MWEB 1PX2A 1CS0A 1T36A 1OBDA 2V5AA 4FFLA 2FB9A 3U9TA 4EGQA 1IOWA 1W93A 1EUDB 3K3PA 4QSHA 4O7ZA 4I55F 4TUYF 2QK4A 2DLNA 5KX5F 3VPDA 5C1OA 5HV6A 3VPBA 5LOVF 4YJ3F 2GLTA 2FPGA 1EHIA 5CAEA 3N8DA 3HB9A 2GQSA 4O4JF 1KBLA 2Z02A 2PVPA 4ME6A 4MV9A 3E5NA 1B6RA 2V59A 3JRWA 4XX0A 4NYEA 2W6QA 2ZDHA 4MA0A 3RFCA 4YAKA 3I12A 4MAMA 3R5HA 2YV2A 3ORRA 4O7WA 4IZOA 2V58A 5CAEB 5HBRA 3VA7A 1UC8A 2CNVA 2YZNA 2OLSA 3VMMA 2DZDA 3U55A 4MV8A 5CA0F 1AUXA 3WO0A 3JZIA 3TIIA 4O7RA 3ETJA 4IIJF 4YBZA 4XX0B 4DLKA 1KUTA 5KKNB 2YV1A 1SCUA 4O7VA 1OBGA 4YAKB 3GIDA 2W6OA 4O2AF 4IWYA 2CQYA 5LP6F 4O82A 1KJIA 5HBRB 3V4ZA 2VQDA 3JZFA 3MWDA 1GSOA 3AW8A 1OI7A 2YZGA 5LA6F 5J2TF 2CZGA 2R7NA 1A9XA 4HNVA 4YBZB 4YB8A 2XD4A 2R84A 4FFMA 4Y8VA 1SCUB 2YL2A 3WNZA 3JRXA 4O7SA 1M0TA 3PFFA 2W6ZA 5DMXA 4O86A 1KC7A 5JVLA 2PBZA 5CA1F 4TV9F 3MWDB 3N6RA 1Z2PX 3RV3A 2CSUA 3Q2OA 4MV4A 4DIMA 1JDEA 4O81A 2Z04A 3NUAA 4YB8B 2SCUA 4Y8VB 3HO8A 2DWCA 2YW2A 5K2MA 1VBGA 2HJWA 1Z2OX 3MJFA 2CNQA 5H80A 5JVDF 2VPQA 4HR7A 3R23A 4XYMA 1GLVA 3LWBA 1I7LA 4O84A 1GSAA 2W70A 3WO1A 4EGJA 2HGSA 3OUZA 1DV2A 2YS6A 2SCUB 4FFPA 4C5BA 5BPHA 2GQRA 2X0SA 3KAJA
chains in the Genus database with same CATH superfamily
2G3YA 1UPCA 1GCGA 2TMDA 1XB2A 4EHAA 5K0JA 1C1HA 2CVFA 4J7UA 1E6MA 1XDWA 1X7HA 4URZR 5C1DA 2NVYA 3RSFA 4DL5A 1HDXA 3Q0EA 4RTRA 2JA6A 1MW8X 3R7NA 1BIFA 2C3UA 1CK4A 1JG3A 3FB4A 4XB2A 3HJNA 3QG5A 4MKHA 2HU8A 2IY9A 3C85A 2J9ZB 2VSQA 5I5SA 3EEIA 1TJPB 1E0AA 2QW0X 3RVRA 3ET4A 2GFIA 4A8JA 1SB9A 3OA2A 3LPCA 4LBYA 1RTKA 1DV1A 5KWSA 4EFNA 5CW2A 4D0RA 2G9VA 1FFSA 1K3FA 4B85A 2D8AA 2GZHA 1CF4A 4I2VA 3TCNA 2Z5LA 2RBEA 3VDRA 1R4ZA 1I5OA 4H3SA 1N48A 2P78A 1Y8QB 5KT6A 4DW8A 3KHTA 4EF6A 1YHZA 5KQMA 2NWQA 2DY0A 4R9UC 3JVVA 2W5UA 1MXHA 1WSWA 4YR0A 4LGYA 1V25A 4HLCA 3V1UA 3T54A 1E5TA 4RHXA 4QARA 3EIQA 5AHRA 2IYEA 2XYRA 3D7KA 1G291 2BFOA 1WXGA 4ZCMA 4JT4A 4AWAA 1LW6E 2PD6A 5ED4A 5AOVA 3RU9A 1X19A 1U8EA 2MSNA 2Q6OA 2HA2A 3V8NA 1MO5A 5B3KA 4DAOA 4LY6A 4AJPA 2B4YA 3ETHA 2JJ1D 1Z0SA 4IDQA 4MUXA 2FRDC 3SR0A 1T0JB 1AV7A 2R1VB 3AEXA 1NLYA 3WNQA 1THGA 1T1RA 2FSSA 1POWA 4QBIA 3OQNA 3N3BC 1QS0B 2TMYA 2SECE 1PHPA 1QANA 4WZBE 5IFLA 2YHIB 4XARA 4B5KA 3S28A 3QUAA 2A1UA 3CH5A 4M8KA 3OIVA 2OG2A 3HBLA 2A88A 4CF3A 3AHCA 2WV9A 3PGLA 1QC5A 3HU1A 4B6GA 3FF1A 2CMHA 1J6UA 3U9TA 2M98A 5K0LA 1Q14A 1E9EA 3ENNA 1YHYA 1GLNA 1S7CA 1CVRA 2AXQA 4LJ5A 1GRVA 1DPGA 2WJ4A 1USGA 2JFBA 2O0KA 2DWUA 3DFKA 4NDAA 3OEHD 4J9NA 1FS4A 1Q0PA 1QNFA 4ZZ2A 1BGXT 2QAGA 3T5DA 3J7AK 2GDZA 2C1EA 1MFZA 3PC6A 2GZSA 1IM2A 4B3CA 3P19A 5BQXA 4J8PA 1RZRA 2CZCA 3PEYA 5E1BA 3TKAA 4NTZA 1RJEA 2A57A 2OLSA 1UMDB 3ST7A 2DZDA 5K0SA 3H4TA 2NTNA 5IJWA 2YXPX 1OCEA 3A3YA 1VL6A 1B16A 2Q2TA 1RYNA 3GY0A 4ZGWA 3T1OA 4IWYA 4O82A 2ZAIA 3C87A 3PIDA 3QZUA 2X0IA 2V7XA 2FU5C 2FG6C 3Q12A 1G98A 2Q3DA 2CNBA 5A2GA 1Z83A 2W6ZA 3PFHA 1PQPA 3TUIC 3PXEA 3IMCA 5CVJA 1VMKA 3CC8A 1Y48E 2YJ6A 3PHLA 4OHWA 4M8NE 1TA0A 3WADA 3A1DA 1NX9A 3DDHA 3FFTA 1XTKA 1UDBA 2Z04A 5SZIA 2IK8A 4UMDA 4U9IS 5EJ2A 2DFPA 4LKRA 4TM8A 1Z75A 1Z2OX 2QT9A 1Y82A 1KSGA 4WVFA 4DANA 1OE0A 1KDVA 5IS2A 2B1GA 2IELA 1WCV1 1IG0A 2GZ1A 3L92A 4KGVA 3IURA 3HSYA 1MR3F 5BR4A 4FFPA 4BRSA 3MD9A 1H22A 3BA9A 1KY2A 1LV7A 3SMQA 1EUQA 3OT1B 4UPDA 1U6IA 1E98A 1FFXB 2EARA 4XWTA 1XKXA 2PBFA 4XLZA 4PLPA 4HZIA 4ZVKA 1ZHFA 4NSNA 2I2BA 3CZ4A 5FBKA 3DQZA 1F2TB 2VUSA 2BGJA 2YKGA 4O5OA 1ZA1A 5I8PA 2X9VA 3HUFA 1HQDA 2Q2NA 3UF0A 1CT9A 5BN5B 3MTBA 3KQTA 1O5OA 2D5AA 4RVCA 5L3SB 1GCIA 2ZB2A 5AKGA 1OB5A 1IM5A 2MR5A 1SNYA 1QH8A 3RV4A 1BCRB 1D2NA 4Q9NA 4WERA 1NTOA 2PKCA 3F7MA 4HEHA 1FFWA 5ITSA 1UQUA 4HGQA 4MQLA 4DV0B 5LL6P 2VF8A 4OYLA 1W94A 2I6FA 4HQOA 1CJCA 3GT0A 3OETA 2GKGA 3Q7TA 2I2CA 5CLIA 2IE0A 3M1IA 2QX6A 2QRQA 3V00A 5DNUA 3MBKA 3WGYA 5DNWA 1X77A 4WD3A 3W5UA 2CE7A 4Q03A 3LA6A 1PJSA 1JHZA 1GKKA 1J25A 4BKOA 3H5OA 1IHYA 4IG9A 5CB4B 3A25A 1ZUHA 3BMNB 4B2IA 1E9SA 3QV2A 2DWOA 3A1TA 4LZZA 1ZCAA 3HNOA 4PC3A 2V6FA 4INAA 4B7ZA 2OSVA 3VZQA 4TMFA 3HA7A 1FRQA 2YXBA 1JDPA 4C2BA 5LKAA 1HT3A 1LWNA 5C3EG 2G4LA 1RTTA 3EZLA 2OAGA 4UAUA 4UHKA 1R9NA 1EGHA 3GUVA 1TGYA 1SRRA 3LCMA 3ZDYB 4NZYA 3IOYA 4BQPA 4L4RA 1DX4A 3CLRD 2YY7A 2RJ3A 4IRCA 3R40A 4R5HA 4PM4A 5ICGA 4EG0A 3S70A 1KMIY 1YMVA 1ZD8A 2WY2D 4M0MA 3PEEA 4RIFA 2HA4A 5AM2A 4M1EA 4WA8A 4YROA 4FFLA 1GGJA 3QVTA 3LG2A 4EUEA 2AE2A 3OQIB 1W9HA 1SULA 3EX7C 3LA8A 3H7AA 5F5LA 1N1DA 2Y1DA 4OHFA 4OK3A 2IYZA 4D3SA 3B70A 4GX1A 1SU6A 1YQEA 4B9AA 3EYWA 1VPLA 1NQUA 4R8UA 4JI8H 5EJ7A 4EJMA 1J07A 1MJNA 3ND9A 2LV8A 3DL7A 3N2KB 2H9IA 5EE5B 5HQ3A 1K1QA 2UUAB 3VDQA 1GDTA 1TDJA 3CSDA 1NQTA 1VPTA 3TNJA 2H1IA 3EW9A 3ZE0B 4FBLA 5E4YA 3M8KA 1TWGA 3LVFO 4ZODA 2RKWA 4F71A 1ISMA 3AI7A 3V6HA 2O2IA 3DXXA 2AI3A 1QYCA 3BGWA 3MHPA 4GRDA 1E2PA 1KKMA 1PEDA 1H0HA 5KVVA 1LLFA 4MTCA 5K51A 5AKJA 4RKFA 3AF3A 2HIMA 1TTQB 4L15A 4QICA 4LRSB 5EZSA 2A92A 3NH6A 3NHUA 3DYVA 1K5GA 4BN0A 3OJCA 4PDBA 1HGXA 5K6TA 2ASDA 3NCTA 2BJHA 4ZIRA 2CMGA 3D4LA 3GO4A 1C14A 3FHTA 3JRXA 3T9FA 4KAJA 4V3BA 4BKPA 4XRRA 5LLDA 3UYKA 3KXLA 1RLOA 2QRZA 1PJ4A 2OM2A 1F9AA 4BEVA 1E3WA 4LDJA 3T1HH 4X3PA 2JGNA 4G3XA 1CQZA 4YDSA 4HWGA 3GRYA 2PAAA 1FNMA 4XGQA 4CF7A 3NIBA 5HZKA 3FLBA 3JWHA 1D2CA 2AFIB 4ANFA 4G25A 3HCPA 2E85A 2OXIA 5CFNA 6YASA 4NZMA 3ACDA 2QE6A 2ONYA 4U5QA 1NXTA 2H17A 5KJFA 4QWEA 3ZIUA 4B4WA 1KAHA 3RK0A 4EITA 1LTKA 3JWPA 1F20A 1B23P 2PSFA 5HOQA 3OEWA 1TTHA 2XSZA 5JR3A 3JWJA 4LK3A 3B89A 3GLKA 3EEQA 1EZZA 3ZU3A 3WAKA 2RONA 2HNAA 3GTPA 2NZJA 3GRFA 1E64A 2PMBA 2Q2QA 4TKVA 4L8WB 4A3SA 4Z2YA 3RJZA 2OR3A 4GKVA 4TYPA 2HT1A 1DBVO 3DPSA 3L7LA 3GRCA 5FPPA 4JWKA 2VJPA 4RH3A 5A71A 4OMDA 4FB4A 1RXWA 5ECWA 3SIXA 5AVWA 3RM3A 1QYXA 2H52A 1KMHA 2RD2A 2V7PA 3G2PA 3MR2A 4HJRA 1YQWA 3BXOA 4R8LA 4RXUA 4N5IX 4IEEA 5CM8B 3DXFA 4BBSG 1EB9A 3TE7A 4IKOA 2DCMA 4EHDA 2X9GA 5ECGC 4MVJF 1KZYC 4FU0A 3HABA 5IDVA 1E59A 1KJJA 3GLHE 3DZDA 4G5QA 2O2EA 3PDHA 2EKBA 4RTKA 2IYWA 2QSJA 2SKCA 2R25B 4QWDA 4Z49A 4LBWA 2UKDA 1X1BA 4AAYA 1GVNB 3PWKA 2D2EA 4LHVA 1TI7A 2R2AA 3F8SA 4C1NA 2R6FA 3BB1A 1AE1A 1LPPA 4DR7H 1UBNA 2LWIA 4CMIA 2QJTA 2GZRA 2J6IA 1NJ2A 3K0KA 3EAQA 3NHBA 3K96A 4TKLA 1W96A 2I4NA 2VNKA 3HN7A 2ORVA 2HF2A 1HYBA 3ZS8A 2YWEA 2HCRA 4A6XA 3R20A 4B3JA 3O0TA 3PYXA 2COIA 4E5SA 3U60B 3EGDB 1BMTA 4YAJB 1XU7A 4EEYA 3LQKA 4TXNA 1UM8A 3DR3A 1ST2A 3KKMA 4XI9A 4EKDA 2WA1A 1X8KA 3IQHX 4OJNA 5THXA 1QKKA 1P75A 2C2MA 4TQUS 3H5NA 4HAXA 3WNCA 5C1IA 1F7UA 3S81A 2IZ6A 1RFGE 3JAMA 4ZOLB 1XZAA 2Y67A 2BFNA 4HGYA 2ZM5A 2W48A 5IULC 1RK6A 1QP8A 2QUHA 4BXOB 1ML4A 1U0LA 5AHKA 4IS3A 3X1MA 3LYUA 4C21A 4MQFB 1KRHA 4R1TA 4OXQA 1JHVA 1P6QA 2IXEA 5FOTA 2DPMA 5KNDA 1IVNA 4Z0PA 1QV6A 3ZJTA 2GZ3A 2JI4A 4HSGA 1ZH0A 5JWHA 3KTOA 3MTIA 3IUNA 3U4AA 4KJXA 3TXYA 1K88A 3SBDA 2J07A 1QMPA 2IS4A 3U61B 5BT9A 4XM0A 2JFOA 4GLJA 1W29A 2L69A 1ZRMA 1JHAA 2GM3A 3PFGA 3RT9A 4YRAA 5J1TB 2GUGA 3VR2D 3ND8A 3V7WA 2JRCA 1NBAA 5DK6A 5T4HA 5JWRA 3ZIAD 1G8GA 4PICA 4RB3C 1NPDA 4TTSA 1JDBC 5K5EA 5IJAA 4AK9A 1SCKA 4EYOA 3EAGA 3VC2A 4J0QA 4QJIA 1V4YA 1F7VA 4C3VA 1GSIA 1GARA 1ANKA 4FC7A 4EQ5A 3RBEA 5AJXA 2EX4A 3WA7A 5I5YA 1A9RA 2QN8A 3I6MA 4O86A 4CN9A 2BGNA 4O0MA 1U3WA 1I8TA 3OCCA 4P4NA 4XKJA 2PTHA 4CIVA 1RWPA 2ASVA 2BE7A 1P44A 2AZXA 5K2MA 2O3UA 3VR1A 2GH1A 4AKHA 5DWQA 4NEGA 3OIFA 2YVAA 1KK2A 4M37A 1KPIA 3U4HA 1GLVA 1K6JA 2ZRQA 5K8LA 3H5LA 4J9KA 3L4KA 4B3HA 2WWRA 2P35A 3SJCA 1S2DA 3PJGA 5EUCA 2FF7A 3VUFA 3RAJA 3DKVA 4GXTA 1L7VC 1N0UA 2AXNA 1Y7HA 4EYIB 2OAEA 5BR7A 4ZT3A 4BNFA 3BFJA 1C3OA 1U7XA 1X1EA 4RL4A 4ZEOA 4NBRA 4ALLA 4JB0A 3R7SA 2I3DA 4WHMA 1QIJA 3R9XB 1G9XA 4PAWA 8ABPA 3T8YA 4AZWA 2NUAA 1I3LA 2X0KA 1RWNA 1L7PA 1XDBA 3GT7A 5DN6A 3D8NA 4Q9KA 3DTVD 1MW9X 3IQIX 2WWIA 1JPVA 4DR1B 4E1BA 2P9YA 1K68A 3RRBA 2EZ4A 1OTHA 4TMXA 2Y71A 2DPLA 4Y1RB 4MVJA 1GG5A 4P80A 5JS8A 1RCUA 1WV1A 3L1HA 1E4VA 4G86A 3DKIA 4QO8A 3F7OA 1Y80A 4DIOA 4CI0B 3H0GA 5K8TA 3QYFA 3E81A 3OPQA 1Q0TA 1FDIA 4OHVA 4WLNA 2EKZA 4DNFA 5CURA 2Z8YA 1ULUA 4HNRA 1BEUB 4DV4B 1WULS 4WASA 4IHJB 1UXGA 2C94A 1V26A 5IG2A 4FBUA 5AMXA 3I5AA 3GJ8A 3E03A 1YK1A 3LY8A 1NRWA 2E4ZA 4PLYA 4E5DA 1MKYA 3I4FA 2WTFA 1TW3A 3GVCA 2XE8A 3ZNNA 2VHYA 1RI3A 2ZBQA 3V4SA 2WPDD 1II8B 1UZAA 5FUQA 2XCQA 1IJEA 2X9NA 4M9XA 1XPOA 5JPDA 3PFWO 2K87A 4OYYA 5AI5A 2AHRA 1A8PA 2R7LA 2IV7A 3FI0A 1J8VA 1XTQA 2CDBA 3DA8A 2BUCA 1CUWA 3DNFA 3KKQA 5AKXA 5LKRA 1Z6YA 1XJWA 5LP6B 5I47A 1EEXB 1A7JA 3JTEA 4ON9A 2WHEA 4NH0A 3U4QA 5E7JA 1JZTA 3D31A 4Y18A 1H0KA 2IOHA 4MDFA 2NUPB 3LO5A 1KEEA 1RRPA 1CSEE 1CUEA 1FP6A 2PSSA 1QLWA 5DH9A 3JQBC 5AUPB 3JWGA 2EBUA 4HH1A 1CNMA 1Q11A 1C1DB 5KSOA 2QMEA 1UZUA 7MHTA 1WKCA 2FWMX 2CCGA 2RFLA 2ZSJA 3NQ41 2OCBA 1I3QA 2BISA 4YO7A 4DA9A 2ZQ5A 1EXNA 2HXYA 1U2DA 2V0NA 3OKPA 2HK6A 2F1KA 3RVNA 1RXIA 3BEDA 1XQ6A 3IA7A 4QOFA 1DAFA 1QQ5A 1QQTA 3OZFA 2O6HA 3TNLA 2DTXA 3VSCA 4JVLA 3S99A 5FOVA 1VKJA 2ANCA 4X1OA 1NGSA 5DSXA 2QVGA 4AO8A 1PQ4A 4LXHA 4I81A 1WD5A 1N75A 4R0VA 3BMCB 5FB3A 4NDZA 1S03G 3F9CA 4OSEA 4R8RA 3UB4A 2ZCVA 2CMKA 3L0OA 2XIGA 1W0KA 4HAOA 4QPZA 1B26A 5DEOA 2ZUFA 1ISPA 1ECPA 1ZYUA 1Z2PX 4URFA 2C84A 4CMAA 2R7ZA 3WLIA 2CUKA 3UCFA 2NVOA 2CF5A 2J3JA 3Q10A 4K0KH 1S9HA 1PFQA 1MORA 3GWGA 3CM0A 1CFZA 1R4NB 3K09C 3FN4A 1HC7A 3QXGA 4X7MA 5BO5A 3ZW7A 3U3XA 5CYOA 1MV5A 2FLKA 4WDRA 2V3VA 1F4LA 3C14C 2EJUA 3D1JA 4ZI3A 3GLHB 2ACVA 4WK2B 4DQKA 3GN1A 1NKVA 3HJUA 3E2PA 1Z2DA 1AK1A 1Z0KA 4QJ4A 5JRJA 5DLQC 2F43B 3W6UA 1K6XA 5EJIA 5BNWA 2JAQA 1J49A 4W1QA 3IULA 5DT2A 2ZZMA 1ORWA 2NNLD 4MHSA 4DSNA 2O59A 2HR1A 2A9QA 4V0KA 1IZ9A 4MWGA 4TZ6A 1R8JA 3LYAA 1JHYA 4E32A 2BYTA 5CJ2A 1EJBA 4XVRA 5BQFA 3KT3A 1ENPA 2WTXA 3T1VA 1QCCA 3RYFA 4C14A 3QVMA 3OF5A 1N5RA 3R77A 3HU3A 4WNIA 3UOGA 2HO4A 3KLPX 2X0DA 2W4QA 4FFWA 1G1AA 3K9QO 3LL7A 5KFLA 1RABA 3BTOA 3IEKA 3K0AA 4ER3A 1ZKDA 2XIQA 5TQVA 3K0FB 1JMYA 1RXUA 1JXOA 2HNBA 4BO0A 4ZVUA 3K6SA 4YGYA 2O2DA 2HSZA 5B2FA 4RD6A 3IPRA 1XYYA 4B17A 2ZXFA 3EPLA 5JDCA 4NK5A 1L1EA 2WUEA 3Q98A 1P3JA 5IM5A 3KEGA 3ILVA 4EEZA 1J39A 5DYIA 1PR3A 3GUYA 2ATLA 5HCUA 2Q7OE 3KB2A 4M1QA 3H11A 5FNVF 1FKAH 3D6HA 4Y67A 1QM5A 4FILA 1U5BA 4BWSC 5AKLA 2GPAA 1N57A 2O1SA 4HH3C 3JZAA 3DWGA 4MCAA 1T5HX 2PZEA 1X3LA 1VKZA 3ZJVA 2ES4A 3G2QA 1SKAA 1OD6A 2R6HA 3TLJA 1XHLA 4W1PA 4PLGA 3V6KA 1KF0A 4HWRA 4RQAA 4JXJA 3LZ6A 4QBGB 2ZRNA 3AM5A 1T8TA 4RNDB 3HXLA 2WAMA 3FPSA 5DAAA 2R7KA 5THQA 3FDIA 1C80A 1GTG1 4HB2A 2IP1A 5IU6A 1U0OC 5EN4A 2NO0A 5F3RA 2R6CA 2R00C 2YDYA 3QUBA 5EIOA 3U3JA 2RGDA 4MUGA 4NJEA 2HJGA 1V1MA 3ITDA 5BWWA 4D9JA 4HOYA 2WZBA 1VSBA 3T5BA 5CLJA 3CJRA 4PZLA 3RJMA 1TD9A 2OBNA 1EHIA 5C4MA 4RFSA 4YK7A 2BKVA 5DX8A 4D4HA 3HNPA 3U4GA 3PFKA 3SKVA 4X6YA 3N58A 3KVYA 2XPCA 4PYMA 2BH2A 2Q62A 1OAAA 1OWOA 2IU0A 4NCKA 4Y98A 5D6NA 4AS3A 1Z7YA 3QLVC 3VTZA 2OPHA 5CAEB 3OPYB 2JH9A 1Y8CA 5GM2A 1PWHA 5BR1A 1TVEA 2CLKB 3ACBA 1NJ6A 2XNCA 3E7DA 3OQ1A 1S2LA 4MGHA 2VVTA 3FUUA 3K3VA 2J4CA 3USCS 2ACEA 4Q7KA 4QOGA 2FN4A 2MINA 1Q0UA 4D9BA 2X3UA 2O8NA 4WECA 3ETGA 4ITUA 5LA6B 4A6EA 1IVSA 1N2HA 4QGFA 3B78A 5CLQA 3QQMA 1X1RA 3H2GA 3FLMA 1QYWA 3H5RA 4RUAA 4OQLA 5L8VA 2E87A 3ROKA 2Z6AA 1PWYE 3LOPA 1WB6A 3HEAA 4G0NA 5KYTA 1H1LA 1BE6A 1P9LA 1YU6A 4GQIA 1MZVA 1VBNA 3DFIA 2JZNA 4LOKA 1C0PA 2A1HA 2BGMA 3KIPA 3LBIA 3ORFA 2WIBA 3OCWA 4ED1A 4I1UA 4LAFA 2AUMA 4J6FA 2HSEA 3EA4A 2PKQO 2ZTUA 3FMAA 2BFAA 3C3CA 1JLMA 1WVMA 1JPNA 2SCUB 3KSMA 2QRHA 4CRWB 3GBSA 2Y3IA 3HP4A 4ARAA 2AZ4A 4JEUA 2IY8A 1XT6A 3WWJA 4EY5A 4IIHA 1G5QA 1HQYE 1AHHA 4GP7A 3T4UA 3CO0S 4II7A 1XAGA 2FPKA 4BVHA 5EP2A 1TCCA 1MB0A 4AYXA 4DLRA 4MH0R 2Q49A 2VDWA 4BMNA 3G6YA 4MR8B 1A76A 2IHJA 4CLOA 4DCTA 3DBHB 4FYJA 1N6LA 4MPRA 3ABQB 1WUKS 1NAHA 3BQ2A 2ATXA 3W7AA 3CX4A 2BMVA 2CKDA 1A2KC 2D4HA 1FFAA 4KPFC 1ESZA 4RK0A 5E4JA 1L5KA 4JQOA 1P33A 5AW9A 5KS8A 4OUDB 1Z0JA 2X8JB 5HJ7A 2YDXA 5B3AA 3BWVA 4ALKA 2DVMA 4Y0VA 3WWYA 1S2MA 3KAPA 4OQFA 1NUAA 4G97A 1P7PA 1FF9A 2IQIA 2QBYA 2PH5A 4P82A 2WJYA 4AP5A 5KG3A 4HB0A 3RBZA 3C5EA 5ITVA 1W4CA 3K30A 3ZZMA 1DTWA 5CM0A 5G0SA 3AOEA 4EKIA 4A0QA 4ZQEA 1ZGJA 3VR5D 4A2WA 4AMUA 4ZO6A 3F8TA 1YH3A 4P0QB 3ZD6A 1TCAA 1JTEA 1PYOA 5FNVA 4UMEA 5HGXA 4PU0A 1VBMA 4AROA 2VNJA 3GJ7A 3ENZA 1ADYA 3MCZA 5JHGB 2I8LA 4I3GA 3SN6A 3EA0A 1BXRB 4MW7A 4UCRA 2IU4A 3GRUA 2ZM6H 3OOJA 4QIWE 4FN5A 4V1CI 3P0JA 3ZW9A 2GARA 1LBTA 3BQ0A 4DDWA 1G0OA 3IUBA 2V96A 4ZAXA 3PQFA 4K5QA 1QDLB 1TM7E 5KWIA 1ZW1A 1JJBA 5JBIA 2B8EA 2ZI4A 1U6KA 4E09A 1WPGA 1V51A 1R2QA 2FFHA 1S2NA 3BG5A 4DBVO 2BF7A 4LF7H 1I6WA 4NV3A 2H48A 3A6FA 4QUIA 4DBLC 1L4UA 2HO5A 4ECEA 2PGNA 1IY2A 4QEKA 4ZJPA 2C04A 1FTSA 3MS7A 4IDEA 5ER9A 1FFEA 3LOQA 4O8CA 1PT6A 2ZYWX 3A9RA 2YN2A 4BO6A 4GGPA 1NT2A 1FYVA 3MJHA 4TV9B 1T94A 1B04A 4Q3NA 1SCNE 3RTEA 2QK4A 1FU7A 5KKCA 3B60A 1TJ4A 5LM3A 1LD3A 1HFEL 4Z3DA 5EWMB 1CC1S 3L0YA 4CFSA 1AKTA 2PH7A 1E1KA 1RMTA 4WJKB 4DA6A 3KOOA 1AGYA 3UAGA 4B84A 1Y5RA 1W4ZA 4Z7JA 2V6IA 1MEOA 1V5FA 1TAQA 2GPJA 4N41A 4CUJA 2YXDA 3OTIA 5F9LA 1SQ6A 4OXNA 4L5JA 3H2SA 2NAFA 2XA2A 421PA 2GEDA 2AN3A 1TKRA 4JI6H 3RARA 1TZKA 2JAXA 4PC7A 4WGFA 4O25A 4ILKA 1HT1E 5LP6F 1XNRB 4A4DA 4ZTUB 1VYTA 4DR2H 1QGDA 3QF4B 1NVFA 4HNAB 4QDOA 3C5CA 3AVWA 2F2TA 2TRSB 4YBZB 1JSRA 5JMPA 4WMLA 4MULA 3H05A 2BM1A 4DV3B 4P33A 4MV5A 3X1WA 2R8EA 1GNTA 2IOFA 3G1UA 1YVDA 1G64A 2NVUB 1UKAA 1VIDA 4CBVA 1FMFA 2GK3A 4H7DA 2W8KA 4XGRA 1FSFA 3NUAA 1P81A 3BHMA 3BAZA 3TPFA 4GWLA 2J3DA 5ALIA 4CHGA 5J4VA 1UANA 4ID3A 1KR5A 3F3YA 4F86A 5JALA 3BERA 2MSCB 1TUBB 4EY3A 1I7LA 3B1VA 3F7NA 4HWPA 2H07A 1SQSA 5LSAA 2DHRA 1J7JA 5LWHA 4DV6B 1KBQA 2AYXA 2GCOB 4P34A 4QELA 1WRVA 3DLHA 4DLVA 5FOQA 1EG2A 4FPXA 4XASA 4U6NA 4ZQGA 5AM3A 3M9OB 1UPAA 1ULZA 2CLLB 3KYDA 2HPZA 4OHBA 3NM4A 1P3DA 2I55A 3R7WA 3UT5B 4G0MA 3CKMA 3CQ9A 3N86A 2HGXA 5KPDA 3EMBA 1AMUA 3GLIA 4YPFA 2KJQA 1KZ7B 2R87A 4ZV9A 3M3DA 5DBIA 1XJ0A 4QHSA 2Q50A 1BX0A 5LXTA 1AMOA 4PPQA 2ZRMA 5DOVA 1NVWQ 2F3UA 5K0GA 4HC4A 3PA8A 2G9ZA 1XR3A 3IPAA 5FFFA 4B44A 4TKMA 1TUEA 3KSBC 2QF7A 4KPYA 4XSVA 3CX7A 2CFCA 4JBHA 4U8HA 5HMMA 1AH2A 3NC1C 2I2WA 2RGXA 3FVRA 1HMPA 1KHHA 1LQTA 4Q4AB 2I1LA 4IVNA 3COVA 5ANRB 2C2YA 4IZIA 2HREA 1KJWA 2JVKA 1PTJC 4NC9A 1RWWA 1ZNQO 1WTAA 4GPAA 3TN7A 1JKJB 3OQJA 2OXTA 3VNNA 3KUKA 2ZI7A 5JJKA 4O4IB 1HO3A 5PNTA 5AP9A 2ONCA 1EWRA 3NC4A 4MXDA 1SUAA 2V7BA 3DF7A 2QQGA 4FLMA 1K0FA 1SOAA 4H0FA 5DYWA 2GLUA 1A9PA 3WGIA 1GHTA 1SG6A 1VIVA 1VLMA 2MSKA 5EHQA 5TVKA 1EKXA 4ROSA 5HF8A 4IGIA 5CBKA 4ZO8A 1ZXXA 2EX0A 1SELA 2PEYA 5EUQB 2ZYIA 1M67A 3CJQA 1HNXB 2OM6A 4FZVA 1F51E 4ENSA 5JBNA 4X94A 2HL6A 3A36A 1WLYA 3KJXA 4ID9A 3RAPR 2FMIA 2B5VA 3ORQA 2YWBA 4MLPA 4RVOA 4LBVA 4DEXA 3JD1A 2QQ0A 3BFXA 1V95A 1HE3A 4PHTA 3ULKA 2F7SA 3SQLA 2H9YA 2REQB 1O8BA 1BQ4A 1KO5A 2DLNA 1B73A 5JJ5A 4EHIA 1SUIA 5AVOA 4JP3A 4A0RA 2FPGA 2C4NA 3PLAE 1FQOA 2AOTA 3NBMA 3ZGXA 4F4IA 4M7WA 2O03A 3E5NA 3ZCVA 4MO2A 2Z2IA 1KHTA 5L3RA 4R3WA 2KPOA 4ECQA 1VP3A 3EC1A 2ID4A 4UJ5A 2B25A 4OP2A 1B0UA 1IY8A 1Q84A 1AHNA 4KQKA 5EZQA 4JGBA 3C39A 2UUCB 4FZRA 4P0TA 4D98A 3NORA 4CQMD 1Q0SA 2OHVA 3UZUA 2SICE 4RD1A 5F33A 3NH9A 5G02A 5DBHX 5ITZB 4MS3B 1TVCA 5A9SA 2QN1A 1NTRA 3PFIA 2IEBA 1EK5A 2C5FA 2BQUA 4RYDA 2AFIE 4CGZA 4M86A 2B6NA 3BL8A 3JD2A 2HF7A 1C7QA 3SLKA 3O91A 4TLBA 2ZR9A 1H65A 5DE3A 2HJWA 3MFQA 3MLBA 3GZ4A 2OGUA 3LMLA 3OJFA 2OKCA 3BDIA 2RHJA 3WYEA 4LFAB 2E2IA 5KQRA 3H9JA 4D0SA 2JFPA 3L8EA 4YXWD 1M0EA 3A6DA 2G1PA 2YU9A 2QTRA 4O3NA 2UXDB 4DMCA 1YI1A 2K7FA 1MBZA 4XYMB 4TSFD 3QVGB 1Q16A 4WY5A 1ZHQA 1BKSB 1C3LA 5KFXA 5JH7F 1D04A 2GYYA 1SUCA 4TTRA 3LQQA 1M2EA 3ZE2B 4C7KA 2JGAA 1KI2A 2O8CA 5DHQA 4DLLA 2YX1A 3LK7A 1L9XA 1LA2A 4AN1A 3WRXA 1DEXA 3BSYA 1ZJJA 5EE0A 4TXHA 1XCJA 3TY8A 3ND6A 4GKKH 1LEHA 3GPCA 3VSDA 3PO2G 1MG0A 4MYTA 3AM3A 1HT2E 3RIZA 1JA1A 2BMJA 3HRKA 4PSAA 5KFKA 3QE9Y 5D85A 4Q3KA 3ZWMA 5FRDA 1V8BA 3E9YA 2A9OA 1XTVA 3I4MG 2P90A 2ERXA 2AG1A 3HKDA 5DRTA 3ZVNA 1XA0A 2H51A 4X90A 1YE8A 4QAJA 3EIOA 2GSDA 4TL8A 3KD3A 2Y9MB 5FPHA 3SEAA 4QYIB 2Z6QA 1HZJA 4UEKA 1AT1A 3DO8A 2ZE7A 4IWNA 1STOA 3DOJA 1WCYA 1M0WA 3FOCA 1MJFA 1ZD5A 2UVDA 3PW4A 3HCOA 4EY8A 4FMDB 4BAGA 1KFKB 2PPVA 1UK7A 2AFVA 4WCFB 2WIJA 1RW4A 1Q1NA 2Y6VA 1FVXA 2N42A 2VXOA 5ENZA 1BS9A 1T5SA 1L6IA 4OCZA 3KSRA 3CLRC 5I7RA 3OQHA 2GCIA 3PNVA 3OPNA 2R93A 3HDHA 4DF3A 2W6CX 1O95A 1R6AA 2WSBA 4Z9XA 2PCJA 1L2ZA 1OLUB 2FQXA 3K0HA 2HQRA 4JVMA 1U81A 4Q3BA 2UYYA 4FE3A 1GNVA 2LGJA 2Q6TA 1OYVA 4K6OA 3QXJA 9GPBA 5H59A 4BQIA 2MHCA 3TSWA 2W6ID 3W1EA 1G17A 1BCSB 3RC3A 4F4FA 4UTOA 4RB0A 3JSLA 4WOCA 3GUUA 2B5OA 1XROA 3DQPA 4JJGA 4IM7A 3W1BA 4KX5A 2IEZA 4A23A 3H18A 3FTEA 1KVSA 3C2QA 3KPJA 5KX5B 4Q7MB 3E9ZA 4CM4A 2OHFA 2ZGVA 3JYNA 2P77A 4C05A 1OKKA 2F17A 4YP6A 3R3HA 3GG9A 4COOA 3FCUB 3F0TA 1XTZA 1FDSA 3BXGA 4JI2H 2XMDA 3O9ZA 2ZRKA 3A70A 1FPMA 4LOAA 4IOLA 1TIPA 1OZGA 5LMNB 1JWBB 4TTTS 1N77A 4X54A 3PEWA 2YVLA 1EFRA 4LYDA 4YUVA 1X0VA 3H9GA 1ZH6A 2I66A 1H1DA 4AMVA 1NVGA 1YZLA 1ZCZA 2YVUA 3S2UA 4ES6A 4W9NC 1RLIA 4LF5H 1AUOA 5EERA 3MILA 1RXCA 3ZWVA 4H16A 4C0HA 3GZTB 4GYJA 4HPJB 1GSOA 1UFKA 3HYRA 1DC3A 4NQZA 1IY1A 2PUAA 1O9HA 4LYHA 5J4HA 3ASYA 3ODGA 1U3CA 1W0CA 1HT0A 2B37A 3IDQA 4FLFA 2AR0A 2AMJA 3G8YA 4PS0A 4TV9F 3DTTA 3N6RA 3BPSA 4US0R 3GJ4A 3SQDA 2ERYA 5DI3A 4O81A 4G8BA 2JAUA 2D06A 5HIMA 2YIJA 1QH1A 3JZ6A 2AZMA 3F8WA 3THOA 4B6FA 5C7IO 4PW0A 1GTL1 2MYPA 1AKRA 1AG9A 3U1BA 4N8EA 3UATA 1UPTA 4Y2PA 4JLJA 2HK7A 1J5XA 1JDTA 1IWOA 4FQ8A 5JH7A 1PJRA 2C7RA 3W05A 4OK5A 3IPCA 2BR5A 4FGWA 1Y3CE 4U2FA 5C8YF 3CKLA 1KR2A 2GDJA 1WBBA 3FOEC 1NJ8A 1DIAA 2R6ZA 1BVUA 2EJTA 1VBHA 2F6RA 3EUAA 3V4FA 5EEGA 1JFSA 1Y1VA 3I9FA 2EX1A 3N2LA 3R4VA 2Z5FA 3AWDA 3RDPA 4JA2A 3X1YA 4QDUA 3WKBA 4NATA 2VDLB 3ESAA 3GEDA 3QY9A 5H68A 2I4OA 2CLMB 1EA5A 5AVSA 4TWIA 4J0EA 1IUNA 1ORTA 3VHLB 1E7WA 3TZCA 1VCOA 3U81A 4HWTA 2C99A 1U98A 3LUGA 1TRHA 3C3BA 1N1MA 1Y8ZA 4OLHA 2I6XA 3QELB 2PSHA 3BJMA 3TL3A 5IABA 3LTNC 1O96B 1GT6A 4CMFA 3TW8A 1SUPA 1J1UA 1G2IA 4JDUA 3ZD7A 4KXNA 4BYGA 1NQXA 1TADA 1ORVA 5K0EA 4FFBA 4ISCA 4N5LA 5F73A 2PH3A 1XI2A 3M6AA 2QWXA 4G23A 4ECRA 1A8SA 2VHCA 4QX6A 1KI4A 3CR7A 1Z88A 2BIFA 3NV9A 3QXSA 1GD1O 2VPZA 4F2PA 2V5VA 4ZALA 3HLTA 4NENB 4LV8B 4LHEA 5L3QA 2RSLA 5A5EA 1RQRA 4IRXA 3LKVA 4WBNB 3OJWA 3EUEA 4W8GA 1D8TA 4B40A 2FPLA 4JS0A 4CF5A 2RH4A 4M89A 4ARBA 4BV2A 1SZDA 3L2OB 3MWEA 4DC9A 1Y3HA 4HDKB 4UU0A 4EG7A 3TOVA 2C92A 3S7ZA 4YUWA 4B43A 1BZYA 3O3NB 4G0VA 2NV2B 4Z9FA 5HKLA 2UUBB 1D5CA 1VCHA 4Q15A 5ICSA 4DLZA 5JYDA 1S2IA 4ECSA 4LCBA 3OZRA 2EEPA 3L6EA 3H3VH 3PO3G 4WVLA 1RD4A 2CJFA 2XD9A 4PLHA 3R3ZA 1EK0A 5BW5A 3AB7A 2VJCA 4AL4A 4UHDA 4M99A 2XCIA 2WE6A 1P1IA 3H13A 1PYGA 1S3GA 1TTPB 5IWAH 3HPRA 2YYZA 1NLFA 3U7QB 4QWWA 3ZXSA 2BEUA 2ZT8A 2G36A 4HN2A 2HLPA 5A7GA 1HORA 5JS7A 1XD8A 4P36A 1GQYA 2GHQA 3K9LA 1G8KA 5B2ZA 3AQ4A 5A4IS 3TG2A 1UMKA 3IUSA 3EJWA 4ETIA 3VYWA 1A77A 1B15A 4N39A 1KYXA 3GHHA 2IHKA 4W9MC 4A5SA 2C59A 4NYJQ 5CA0F 3KQWA 4Q9LA 1ZISA 3HXKA 4UD2A 4QXPA 4HVAA 3ZI7A 1MIHA 2DECA 1QQBA 1OC4A 4TS4A 5KMGB 1RYHA 2AEEA 3D8BA 4MR7A 3KE8A 1LQ2A 4LSXA 1HRDA 3BK2A 1IN5A 1OILA 4L9WA 2QT1A 4A3KG 5FUXA 4DQNA 2J67A 1F2DA 2D0IA 3VM6A 3FKSA 4FSDA 1U8CB 4RFVA 3BCHA 3KQPA 4JYMA 3ZLBA 3J7AC 4MTDA 1AO3A 2PUBA 5F1YA 2VDPB 1KC7A 5GV7A 3LF2A 4ZO4A 4RS3A 1P2BA 2Q21A 2I6UA 2XW6A 1H6CA 2BHNA 4DJAA 4BNMA 4AY6A 5KG0A 4LZNA 4B6OA 1BXZA 2FW6A 3RG8A 3RUCA 1FUYB 2NSDA 4EUNA 2LUOA 1E96A 5FUMA 4FP9A 4LY0A 1JSLA 4FYKA 3IV9A 1A71A 3ZNOA 5C8YA 1SVLA 2PS1A 5IMSA 1GCOA 1GCUA 2XYGA 1XZFA 1I6UA 5I60A 4U5XA 4G4GA 3A6EA 5CIYA 2ZRHA 2IQ5A 2VWPA 2ESRA 5L6LB 1SEIA 1XHFA 1X80B 3ZEAA 1ORIA 4YP0A 4GP9A 5HZHA 2UZ0A 2WU4A 3PUZA 3UHPA 3UICA 3EF0A 3B7WA 4O2LA 2H4XA 2PBRA 4REOA 4MMZB 4F06A 3WJ2A 1YNOA 3V7NA 2KBFA 3AP1A 1N3BA 3V32A 2QLLA 4FMBB 4R5MA 4PCAA 1W36D 3J80W 2XCAA 1HDRA 4BVAA 1I33A 1JPUA 1UFOA 4D41A 2BEVA 2WOOA 3WK9A 2BSQA 2IPNA 2J6CA 4JBWA 1OU0A 1X7XA 1ISHA 3TWOA 4D9HA 1D7AA 4MPPA 3PSHA 2H2HA 3BGIA 3SFVA 3FDXA 3P97A 4KQXA 4RVHA 3DHNA 4PBTA 2HJRA 2IF0A 3K9GA 2C9CA 4BB5A 4J90A 2LIPA 1NSYA 3VRHA 3QZ7A 3CEJA 1VECA 4C5CA 2ZP1A 2VQEB 3BN3A 1Q6YA 5BR8H 3CRVA 1R4AA 3G2MA 4AUEA 4L0MA 3GP3A 5KHAA 4X92A 4LZJA 3GFGA 3VQTA 2AYYA 4LXIA 3A1SA 3BZBA 5E0KB 3QBDA 3V7FA 3WLMA 3WYDA 3N43B 1A1VA 1A95A 1N33H 1A3CA 1A72A 3GV5B 4RV9A 5FD5A 3WR5A 3RTGA 5C8ZA 2HD4A 2W6NA 4WESA 5L45A 3TINA 3JQEA 1XAIA 1YQ9A 2GPWA 2D8MA 4PSUA 4AUKA 3AKDA 2VP4A 4PPFA 4H1TA 4DLNA 4C2AA 1OWTA 4CQLA 1SOVA 1R9GA 1FQJA 5AW2A 5E6SB 2P5UA 1A4IA 2E3JA 3MIZA 3BD8A 4DWVA 4BTVA 4RZQA 3W4IA 3ZVLA 1H5NA 4LJYA 1A69A 1GPYA 4JITA 1LQUA 1EJ6A 1UWKA 3L0DA 3A7DA 1PNTA 4F4CA 2IRWA 4BRWA 3LBNA 2NU6B 3COPA 4ECTA 1B1CA 3FTQA 2Q1YA 3NANA 3L7IA 1NUQA 3T3EA 1V41E 4I1IA 4JQZA 2V5AA 5LQMA 2FB9A 2FVXA 5DLYA 1WXEA 3B6KA 3LDUA 2CMFA 2FNAA 3DMRA 2FFQA 3G6KA 4PIMA 5AW6A 3LQYA 2X8LA 2GT1A 3HWWA 1VGVA 3CEHA 3PC8A 3TEKA 2XKJE 5BSVA 2QRVB 3H1EA 2Y0CA 1TU4A 4ND4A 1QYRA 3SF8B 3VFDA 6PFKA 2UXBB 3E58A 1Y1SA 4D81A 1Y1LA 4NBWA 5K4AA 2I7XA 2C8VA 4MV8A 1MB4A 4MEBA 4ZAGA 1QP4A 3UJPA 2KBEA 1SCUA 2G77B 1E0DA 2DH6A 1OJLA 2D54A 3OVMA 2VBIA 2HU2A 1JLHA 3IG0A 3ZEIA 4YCJA 3N0XA 4L2IA 3RK1A 2A35A 4IGAA 5B58C 4ETNA 1CHNA 1DAIA 5KFMA 1D4ZA 4LE2A 1JDEA 1FNBA 1J0DA 4EPXA 3NGDA 3QYJA 2J9FA 3C6BA 4X1YA 3LX6A 2BHLA 3BA1A 5HA5A 2C8LA 2BDUA 3NRBA 5B1DA 4ZI7B 2TYSB 3W2FA 1GRCA 3OEYA 1BDHA 2CCKA 2ISCA 2ZWIA 1RJQA 1EFLA 2YUIA 1P0FA 3EXHC 3BJIC 5IKMA 2Q9BA 2C4UA 2AQ8A 1XMOB 4JI7H 1XU4A 1B41A 4N0QA 4M1SA 1DTSA 2IYAA 3OJ0A 4NBLA 1CUHA 5EMKA 3N6XA 5FPYA 2FPIA 1SKQA 1Z8HA 3EWNA 1GUBA 4L4UA 3SSOA 2JEZA 3LW8A 4F92B 5KFPA 5KT2A 1Z17A 5IYCG 2IH5A 3MWLA 3DMTC 5KT3A 4TN1A 4HY3A 3WRVA 4M1YA 4Q8FA 1RQNA 2DT8A 1ORRA 2NG1A 2C2HA 2JGRA 4YDRA 4ZVVA 2QL7A 4HP8A 4F93B 1W0JD 3CYFA 4FUQA 4QUEA 1E60A 5EKSA 1Y8QA 721PA 2QOEA 1GTRA 2O1XA 4EELA 5ER6A 2VUTA 3OLZA 2FRXA 3B9QA 4D9MA 1LZLA 4UHFA 1A8IA 4HRXA 5KYWB 1II9A 2OBYA 4KH1A 4OKSA 5KG2A 2ZRCA 3IEUA 4PXYA 4NMHA 1DWQA 1H5QA 4Z0TA 4B7XA 3D8HA 1FTNA 3UMCA 2AQ4A 3GIMA 2CJPA 1Z4IA 2P4EA 1T34A 3GLGA 1E2FA 4BNTA 5AM5A 1N2GA 2VT2A 1WKBA 3FVTA 4QFCA 1ZL0A 2V5UA 1GYRA 2NO6A 5DI9A 5BSEA 1LLQA 4KPEC 1Y9DA 4N6OA 4O7YA 5EIAA 4HVLA 2IOQA 4LV5B 1NOIA 1B74A 2EFGA 4CG3A 5CB4F 3A58B 1DO8A 5F7ZA 2EZ8A 1E7YA 3ZCTA 5HE8A 5LWQA 4NZNA 2EDAA 5TQ2B 1G4HA 1WMEA 3EDQA 2BONA 1QS0A 1YD7A 2VG8A 3JASB 5JUMA 5AKZA 2YHIA 4K9LA 4B73A 2I2FA 3LM8A 2FWAA 1Z06A 4RLFA 3PC4A 2OO3A 2Y2UA 5F3WB 4YQWA 4U63A 1GAQA 3P52A 1DXQA 1EVQA 4D9EA 1VCNA 1WZUA 1P80A 5FBHA 1ZAYA 4KXUA 3HYSA 2E18A 1OWLA 4F5DA 4LNAA 2OXRA 1RE1A 4X60A 4D0GA 2RHRA 5EWJB 4KAAA 3MTGA 5CDUA 2DFNA 3RASA 2AGPA 5EJGA 1NA5A 3IP5A 1P1KA 4U1RA 4C3ZA 4KAFA 3WSTA 1XG5A 5GJCA 5HM8A 3PRYA 4UQOA 2XRYA 3KHSA 3PKIA 3THWB 1UMDA 3TQIA 3OOSA 1G5RA 2CE2X 4ZZ3A 3GU3A 1SXPA 4B3DA 2HSGA 2B94A 1KU0A 2PPLA 2XGOA 2JZOA 2NO5A 3Q9LA 1M10A 2Z6VA 3WJAA 2C2EA 1L1FA 1YQTA 1P1JA 3PSAA 4C0KA 4UUMA 4CUZA 4TROA 2FPXA 2XOKA 1T8WA 2FSPA 4NQRA 2VCEA 2IBMA 4IF6A 4YLYA 3G0IA 4B3SH 5HFAA 1AKQA 3KOXA 3ENWA 4DSOA 4K9DA 2C5HA 3O92A 3JX9A 2CL7X 2XDYA 2JHPA 2NSYA 3BQMB 2AG8A 5EWEA 4Q1VA 2X1LA 3BWCA 5CXSA 1GQQA 2JCGA 4C4YA 4JEHA 1I6LA 3MRVA 3ZZ1A 4O3PA 3FTCA 2OT3B 4LQCA 3K92A 3VZCA 1ESMA 4E21A 4DR4B 5G41A 5IANA 5MF6A 3IGFA 4JLSA 1BD3A 3QOXA 3VR5H 4REQB 2DPIA 3U0GA 5K01A 4I3HA 1XGKA 1C1XB 2YMMA 2IXGA 3EVTA 3OT1A 2RDMA 4ZP1A 4RK7A 2V1UA 2BC9A 3NJ4A 4TXLA 4GZ6A 5KJCA 2YMQA 4YVFA 1I36A 4WSOA 1VFPA 3GFBA 1FFXA 3C3WA 4R1NA 4GVLA 4JCCA 4OBXA 1S2OA 4WLVA 3A6KA 1KERA 1DWPA 1XLTA 1PV1A 2DG2A 4RE6A 4JVSB 4NPCA 1YRLA 1XMSA 2DYKA 5BMVB 2YICA 4QDJA 1F48A 1G7TA 2PE5A 4RJKA 2HMWA 3R6WA 3AR7A 2EWWA 5AESA 4PVCA 2IOYA 1AMNA 5BN5A 5F9FA 3NKVA 1T4DA 5L3SA 2I87A 3PK0A 4OYHA 5J47A 5ICEA 5IT4A 3FI9A 2WFAA 1XNQH 4TS1A 1G9TA 3BJYA 5GV8A 2BUBA 5I51A 2NXCA 2XRZA 4P3YA 3UUGA 3WSWA 1RBMA 6CHYA 2WKQA 4QDZA 2J4DA 3TSYA 4ZEWA 3ZXUB 4KQ2A 4J1TA 5KFOA 1WHTB 5JZ9A 2VYVA 2W0MA 4J9UE 2VDQB 2XYPA 2XT6A 4MHOA 5DYNA 5CXXA 4IRUB 2DB3A 3LWNA 2J31A 3N0VA 1OT5A 3PU6A 2WSSA 1B33N 4ZRDA 5G1NA 3LTEA 2H06A 5FD6A 3KV3O 5G40A 3RGGA 1QRAA 5CB4A 2POQX 4D3YA 3BMNA 2A1TR 2LKCA 1OH5A 5FUBA 2H4WA 1QHIA 5I45A 1HFJA 3FROA 4MQMA 1JR4A 3OQOA 3DJFA 5DXFA 2EGHA 2WF8A 1NM5C 1CNFA 3MFIA 2Q3MA 4IHAA 5JANA 2YJ5A 3ANNA 2P9ZA 4L3VA 4ZVMA 3TLKA 1XCPA 2RJOA 4X7RA 4YRLA 2F55A 3DO6A 1UBOS 3DLCA 3ED1A 2B2XA 3ZD8A 1XTUA 1I7PA 3F9RA 3O1IC 1E9CA 4M7PA 4X8HA 1C29B 1G21B 1XRPA 3NVMB 2J45A 4OXKA 2Y1LA 4D4MA 3LF1A 4XYGA 3OE1A 4BQOA 2VOJA 2R7MA 4ZOLF 2VO1A 3OQIA 3FYUC 3UFXB 4RJTA 1Y7LA 3KOUA 1NPTO 3V8MA 2GEJA 1AZLA 3IQFA 1DBQA 3IVMA 2A5FA 4X62B 3L18A 1GN9A 1NW4A 4FKBA 3M7IA 2CD9A 1J0EA 4KLZA 4V1CB 3GD7A 4QYMA 3KKEA 1VKNA 3N2KA 4RVUA 5E1OA 2VA3A 1CR6A 3PHIA 4F60A 1ID8A 3PF9A 4WZ6A 2E4WA 1J0AA 5K09A 3UXEA 2O0LA 1RRVA 2IYOA 4I9GA 1I2BA 1KU6A 4FIZA 4R68A 4PF1A 4Z4QA 2CLOB 4IIEA 4M4SA 2CN1A 4DR3H 4NYEA 4BFLA 1ZUD1 4L28A 5I4BA 1WXIA 5GINE 2WWXA 1ZC3A 3VMMA 1Y1KE 2W4MA 2RI0A 4PG7A 3VR6H 3D8TA 1A5SB 3LU1A 5FWNA 5BXYA 4XX0B 1SMKA 2ZITA 2SNIE 4Q9DA 4MUYA 2NNWB 3FUCA 1LBQA 4Q3EA 3V8VA 5DP1A 2DRIA 2RGUA 2R8JA 3RUAA 1XZQA 4P0PB 2XB2A 3HCEA 3BSWA 1DAAA 1NP3A 1ZG3A 5MN5A 3THXB 4TQ9A 5IH7A 3OX3A 4F1JA 1I1NA 1VLZA 2QYHA 3AEYA 1S1MA 2H1VA 3NYRA 2GXUA 2O8FB 1VG9B 1DB3A 1X7WB 2AFIA 1H8HD 1Q74A 1GAEO 1L3BA 1D1PA 1OI4A 3OMXA 1UJ4A 5E8RA 1Z4MA 1XMQH 2VZEA 3ET5A 3F47A 2FDXA 1JYFA 4CDRA 4ADSG 2QHXA 3OZWA 3L9XA 4CLDA 4MW5A 1IJFA 3WGTA 1LC3A 4OV6B 1NN5A 3OCUA 4B7CA 1QGZA 1B6GA 2JEIA 3AUYA 1SBZA 3AV0B 3PNSA 3GPIA 2B4QA 1ESNA 3O47A 4NMMA 3NGXA 5C80A 5IBCA 3WYBA 3URMA 4BNGA 1FJXA 1QIDA 4KFSA 3PE6A 3D3KA 1EXWA 1X7YB 4HAYA 3CVUA 1ACLA 2Z3VA 3D3JA 4CC6A 2BTQB 1M2FA 3IE2A 4N5NA 5CM9C 4E08A 2CKZB 1R1DA 5GMOA 2PWAA 3OF3A 1AA6A 1VIMA 4AJ4A 3GTKA 4ZGBA 1LK5A 1ZAKA 4FFNA 3U7RA 4KHPH 4F3TA 1YZVA 4JR2A 1O9BA 2VHXA 2VUMG 2D5IA 2IVZA 5FPQA 3LCUA 5HIJA 4WZBA 3BM5A 3TGLA 3OO1A 2EW1A 3RRYA 1KI9A 4F85A 2Y0DA 4NF2A 1BFKA 2IP2A 5T7BA 2GBGA 1N2IA 4RZIA 4IHJF 1COWD 4YMUA 2D7CA 2I2AA 3VNBA 1D2RA 1ZSNA 4MW4A 4RNMA 3KHHA 4ZI7F 2G28A 2V9PA 1N5OX 1H4QA 5E6UB 2WFLB 1T3NA 2O7QA 2XAAA 3NAMA 5IW8A 3ZGNA 2RH9B 3GFQA 4JYBA 2CV1A 4ATNA 4OA5A 4DKXA 1L2TA 4M6WB 5INTA 4DE5A 1FDOA 5JFTA 3OX2A 2VYFA 4R9NA 4BE9A 3EGDA 3DMGA 3HY4A 4AKGA 1NF8A 3MUEA 1GEEA 3KM0A 3MSXA 1RXVA 3ETLA 1T2NA 4TGLA 2HWWA 1G3IA 1TK3A 2JANA 3HVIA 3UJ8A 3CRZA 1RXEA 3K72B 1Z07A 3MGKA 4XR4A 2ATCA 4FHFA 2IGTA 4JV5B 3ROEA 3O93A 1C9YA 3FMOB 4ALMA 1E61A 3LMKA 3MJTA 2DPGA 2X77A 4BXOA 1M34B 2IHZA 3QJ5A 1NOKA 2Q07A 4HATA 4RCVA 3COWA 4MQFA 4N76A 3F7TA 1NULA 1UUFA 5DX1A 1IZ7A 5AW5A 1WZEA 4BVEA 1X1DA 2Q27A 4QG7A 2HRBA 4URUR 2AQHA 5DLPA 3AUFA 3OZ7A 5LQNA 3M9LA 4P58A 1QG4A 4IV0A 3FWZA 4AN4A 1ZD2P 1O94A 1VG8A 2J3KA 4K26A 1DRUA 3TDMA 2W2QA 1ZAUA 4YQZA 5JD5A 3H6HA 3VPSA 1ZVQA 1C4XA 3SIPA 1VIYA 2JASA 2CY0A 1QCYA 4YJKA 1SZPA 4TT3A 4C43A 1PDOA 1Z13A 3A9VA 3M6XA 3H9CA 3PWSA 4BNZA 4MYUA 2QW1A 3V7YA 1THTA 3RRJA 3RS5A 3KU4A 3P2YA 2QUAA 5DN9A 1TZMA 5B7QA 1Y42X 4YACA 4ND2A 1QHFA 2HHCA 1YAHA 3P96A 1ICEA 3VR6D 4LF6H 2AG6A 5J3JA 2H4HA 3PENA 1UJ5A 4B75A 1AQYA 5SY6A 1P8AA 5F64A 3QU5A 3OT5A 2ZIAA 4PRZA 3EGXB 3TY9A 1IUKA 4F9GA 3H2IA 2ZJYA 4KFRA 2FDCA 3DZJA 2QQFA 2O5VA 5HF5A 2AJTA 1YZTA 1A9ZA 2XZTA 4EPRA 4YWJA 4DXAA 5JHHB 3BQ1A 1Z5NA 3SU8A 4BO9A 4GKJB 3JD4A 1R3UA 4F9TA 1GNSA 4OH1A 3PCTA 4L74A 1IXRC 2VP6A 3QVJA 5KG1A 2Q6LA 1LH0A 3N3AC 4JBXA 2GN9A 4MLZA 3G23A 1FXUA 1TKBA 3R9XA 1UP6A 5DB4A 4PCLA 4YMTA 2FEPA 1AQ6A 3U7GA 2H3EA 2YWGA 4R2JA 5BV0A 5IAAA 1MH9A 4EABA 2R6R1 2EBFX 2PL1A 2RH8A 4Y1RA 1REQB 4YJ2B 5HCIA 3VPCA 4J4HA 2QZPA 1BHO1 2A9JA 1A4XA 3GYBA 3JV7A 4UFZA 3S27A 1U0GA 4CF6A 2OOKA 1JILA 5LMUB 3T7AA 1I7SB 3E8SA 4B31A 1XELA 3DFMA 1Y81A 4DG5A 1SM4A 1JEQA 3IBFA 4RHFA 1MO6A 3K73O 4PYRA 5A4FS 4B87A 2CBXA 3BORA 2XAUA 1C30B 5DGBA 3BXFA 3SY8A 2ILTA 1WEKA 4ZT6A 2BGLA 1CZOA 3NG1A 3U6BA 1NLZA 4B81A 1Y6QA 3GIIA 1Y6RA 1TK9A 3SFZA 3CGGA 4KXLA 4J75A 3JR3A 2VKQA 3I9JA 3HWX1 3C3JA 1KAMA 5TXGA 2FUG6 4N4AA 3WAGA 4NG5A 5BWVA 2CV2A 3K5HA 4MS1B 4DUPA 4WK0B 4J76A 4BWGA 5LVAA 1YQGA 2HWYA 5F2OA 1HRKA 3T7KA 4PHHA 1X1CA 1WMSA 1UMCB 1OQAA 1FLNA 1AU9A 5LP6A 1E58A 5KPJA 2YIDA 5KFHA 5DM70 2RHCA 1PKXA 1WPRA 1QCZA 3NGLA 4F2GA 1XO1A 2NUPA 2H2DA 4AECA 3DLBA 1WG8A 3IE0A 1JDZA 4ZO9A 4DQDA 4ZJUA 2GJKA 3FWKA 4ZEVA 4ER5A 2G0TA 2QB5A 2QDKA 3NAZA 1C1DA 2WHPA 4ZTBA 1J2UA 3HI4A 5CDHA 1OAOA 5TT1A 4I6GA 1DMRA 3GMSA 3KEMA 2JGEA 3E23A 2X40A 4UHCA 1DXOA 4A2PA 2COUA 4J0DA 1NOJA 2ZYHA 1R0BA 1GRQA 2NZWA 1V1JA 4DRYA 1YR3A 5HRCA 5TEVA 4HRVA 1WH2A 1RC0A 2O23A 3ZWYA 2YASA 3WRYC 1GAJA 4PPGA 3ISVA 3V8QA 5CP8A 5TV2A 4YPVA 4CCWA 1BHJA 3GOHA 3ON5A 4PGHA 2ABWA 1DAPA 3BMCA 5A4AA 4CM5A 5CNMA 3M2PA 1Y9EA 3OBIA 5HKKA 5I7EA 3KSAC 4AJ9A 4QW9A 3LWDA 3U26A 5G4LA 2IDMA 1XD2B 3C6MA 1T25A 1T5BA 1Y3DE 2R4TA 4JX8A 3NYQA 3Q8WA 3IKLA 3SGIA 5LA6F 1FJHA 1M8JA 4C9BA 5FX2A 3D3WA 3BUSA 3RSSA 1E8NA 3UBTA 4PO3X 4A7PA 1RM4A 3BWEA 4NCHA 2GJ9A 5C8VA 3IT1A 5F2NA 4N7BA 3I2JA 4JKIA 1O5IA 4DJEC 3CRW1 2ODBA 1CTQA 1R4NA 1DC4A 3BGDA 3RAFC 2Q5EA 3NEAA 4JENA 2Y0PA 3QLUA 3HO8A 1WPQA 4HAWA 1VBGA 3GLHA 4GPEA 1EMDA 1A4UA 5IYZB 1KEWA 2V8OA 3WA6A 5E9JA 4M0LA 2VATA 1T91A 2JEGA 4MWSA 1FOEB 3ZK7A 2A0YA 4FZ5A 2HHHB 1QE0A 5G1OA 5K99A 4QVKA 4B48A 4PZYA 4JJ6A 2HWXA 1GVHA 4AN0A 4KBYA 3JRNA 2GBPA 2DHDA 2HADA 5KREA 1YJAA 2IODA 1HNZB 4Z0HO 3RIHA 1R8QA 2BP7B 2I03A 5A0VA 1KPGA 1TEHA 1VL8A 4G56A 5JNSA 1RIIA 4IQFA 2WKWA 4ED0A 5K05A 3QUCA 1TMOA 4PQEA 3UMMA 4UCUA 1QG6A 1UFQA 1HMYA 3UTCA 1RI2A 1R9JA 3K0FA 1NDHA 3E8MA 2ID9A 4LF9B 4NZOA 1UBJS 4BLSA 3CUKA 1XU9A 4A36A 3HQ4O 4K6NA 3AR9A 3RS3A 1TZCA 3Q8XB 1AS0A 3C6QA 1OV6A 2ECQA 2AQKA 4RIHA 4MO9A 3VO1A 4CU5A 2EJ3A 5JC1A 4YFVA 1Q0RA 2GN4A 4RA9B 3URKA 2FV8A 4LOJA 5JFOA 4FEGA 2PZ8A 3JQFC 2L19A 2V1XA 2DSTA 1PIWA 4FX5A 4ER7A 4F5EA 1IHDA 1JFTA 2J59A 1N32H 4L5AA 3WB2A 4X0EA 3IJPA 3ZU5A 2VQFB 4FSXA 2QD2A 1NBWB 2HLDD 1E1LA 4U2EA 4O7TA 5G53C 5D1HA 1ODKA 4EMUA 1QORA 4XFJA 2EFEB 2I4TA 4MIKA 3QI7A 5AXDA 3AONB 3UC5A 3TNFA 3P5BA 3G7SA 3BACA 4LNUB 1F1JA 2OLJA 3DE0X 1CUUA 4WJZA 4D9GA 4NIMA 2NU7B 4D8TA 4EVIA 2HTFA 1S9DA 3OKFA 1NURA 2WILA 3OMLA 3ZE8A 2OBLA 4LC0A 3M4YA 1XVTA 4N65A 3RVMA 3INRA 5EJEA 4L22A 3AX6A 4UE3S 3VI4B 4IVRA 1SQ5A 4OFXA 4JFAA 3G8DA 2FR1A 3VKWA 4MSUA 4GOOD 1ZX1A 1ID1A 4JKOA 2W8BA 5KNLA 4YLEA 2J3QA 4YP3A 1AQIA 3LBYA 4WT7A 3GWZA 5DJ5A 3JYHA 3Q5DA 2A2ZA 1Q1QA 4NNJA 3S8YA 3B9RA 2QQEA 1NAIA 2R8YA 3DT9A 5CAEA 1XEAA 3OPYA 3V80A 3LHFA 4RPKA 3U39A 5CLLA 3WMXA 4BVGA 1PZHA 3S4YA 4G5RA 4D8VA 3OEEA 3ITKA 3LW7A 4J03A 2X1VA 4OBWA 3QH4A 1GQOA 5CFZA 3TEFA 3OJEA 3FZQA 3LYLA 4I4IA 2WWWA 1YTUA 2OAQ1 3AF1A 1SOWA 3VU1A 5KS2A 2C3MA 1Y5MA 1E9VA 5HX7A 2F62A 2G88A 4QQRA 4YAOA 4EAAA 4HYTA 1G8JA 4YC7A 4I46A 1NJ5A 3VGPA 4V0LA 1GYPA 4TZTA 1R64A 4JLDA 5TSDA 3S6JA 3C8UA 3TEMA 1EP1B 4RY0A 1A98A 3BE8A 5FLMG 4YXFA 3J81k 4G63A 4PAOA 1ZK1A 1Q5PA 4QXOA 2OV2A 1YZKA 3VU0A 1R5NA 2QTWB 2W98A 3MGGA 2SCUA 3SS8A 4JI3H 4B80A 4G1VA 5LQDA 3N2NA 2HHJA 4EVSA 2XGQA 4I2NA 1GZ5A 4CDGA 1E5VA 3MLEA 2XGJA 1R27A 4DQVA 5A5DA 3P32A 4Q19A 4N3GA 1FTWA 4AUMA 2WT9A 5C37A 2FW8A 2FJUA 5KU7A 2K5UA 1Z0AA 4D8YA 4MVXA 5TC4A 3U5TA 5BQ5A 3A9CA 4MR8A 1C8VB 4OAPA 2SBTA 4R71A 1LLDA 2GWRA 2ZULA 3ZH9B 1VOTA 1W36C 2IXDA 3T1QA 3QBTA 1P72A 3E9EA 3W2TA 2O8EB 3AM4A 3HKEA 5EXPA 1TPZA 1ZK4A 2RHLA 4AY3A 4EFDA 1OGYA 1BE0A 2XECA 2H9AA 3OQMA 4OUDA 4KYVA 2X8JA 4BAUA 1CJSA 3EZ6A 4G67A 2ZJ0A 3CH7A 4YRZA 4NU0A 4KP7A 221PA 3W5HA 1UXHA 3OIDA 3MT8A 1EUDA 2DX7A 3PNOA 1SIBE 1RK5A 4CKCB 1Z6AA 4F8YA 5AVQA 2O8DB 4X7BA 1RC1A 3L84A 4GX0A 4ASUD 4OYRA 1MC4A 1WVIA 4FS1A 2EJ0A 3IV6A 4BQSA 2FSGA 4BV3A 2G7ZA 1Q0QA 5ALOA 1J90A 2REXB 2REBA 3RIGA 1HEYA 5DGXA 1W88B 3CVXA 3I4LA 2IUTA 1BXRA 2F4NA 4NYIR 2R92G 2O19A 2FOIA 4O4IF 3FH0A 1KDZA 1XZJA 3OFVA 2P27A 2ZBUA 3KDPA 1GZSA 3O94A 1T8UA 2WD9A 4IEIA 1HDGO 2WJGA 3P9SA 2PUFA 1DT5A 2YW9A 2VBFA 3HCDA 1GIAA 5DQGA 4K6GA 4HLQB 3TNDA 3FCSB 4RU1A 2YXNA 5IAGA 3H3FA 2F8TA 2Y1OA 2QT0A 2ZJAA 4YJ2F 4O2BB 3N74A 4B3TB 1BGWA 2XLCA 5LBTA 5J5CA 4C4PA 2LDXA 4HV4A 3GQBB 3I6BA 4X24A 4KQ9A 3DCIA 5FBQB 4EL5A 1JW9B 4C6TB 5IK2A 1KKLA 1N5DA 4TV9A 4KO8A 4AQYB 3MCTA 5AVUA 3F8NA 4P3KA 1YR9A 1AF4A 4C0AC 1AX9A 1LFDB 3KT8A 3WK5A 3TJMA 4BNJA 1Z62A 5EWMA 2ZB3A 3FWNA 4LXQA 2JGJA 4W4TA 1DCFA 4WLFA 3KYCB 4QFBA 3W5JA 3EOZA 1P2UA 4A73A 3KKNA 4DYDA 3FW1A 5BV2P 3RHZA 3EEYA 3N8DA 3JSAA 3OLWA 4F21A 4ZKEA 1RZUA 4L8VA 1Z45A 3TPCA 4FLEA 3AW9A 4TYMA 5C7YA 4D25A 4I7HA 4RK1A 5BYJA 1QBKC 5F9HA 3JALB 1ND6A 2O3TA 2CNVA 3QF4A 3NHJA 3JU3A 3MUNA 3BT7A 3DBVO 1DIOB 4MQ6A 5KDOA 4YBZA 4G84A 3WK8A 2JLUA 3AT1A 2ID8A 3CUVA 5HBRB 1DRJA 1DLJA 4RCZA 2NVUA 3BFPA 1EFPB 3QF7A 2H2WA 4BX2A 3E9NA 2FHPA 4OA8A 3KXYT 5KSPA 1CDOA 1WUJS 3BDVA 3M33A 4EKEA 3ZTWA 1I2DA 5D51S 1RXYA 2X86A 2RGEA 4N0DA 2VOEA 2VRCD 1ZIOA 2V45A 3M9XA 2P41A 3HYTA 5TLSA 4DJDC 1QTQA 4RTMA 4AG6A 1VLJA 5LJLA 4Y8VB 4DGSA 2JA7G 5DTMA 3ZVRA 1U31A 1KVTA 1ZC4A 4FONA 5HIIA 2PUGA 3X0DA 1KOGA 1W7AA 4TWJA 1P0IA 3SZRA 3RYHB 3K8QA 3ETEA 3R9IA 4MI9A 2V55B 3GJ0A 1MXFA 3UT5A 1YACA 4RX1A 1TE2A 1ZI8A 2ENUA 2RBKA 3AF5A 1CLUA 1U3GA 4OL0A 3STWA 4U6PA 4S3MA 4ZYYA 3OP1A 1EWYA 1RQ7A 3D4PA 2GVDC 1HNNA 1RQ2A 4Z4FA 2YYYA 3OCYA 3KFLA 5CHYA 4Z86A 3LUPA 5JNWA 2QZ9A 1M66A 1XPJA 3PT9A 4ZDIA 2QJWA 1PNOA 1XQVA 1DOHA 4OG2A 4PTLA 1U1EA 5H5JA 3NNNA 1Z26A 3KYJB 3STTA 1JFRA 5K6AC 5EY5B 2ZRJA 3G2OA 3LBHA 1QHYA 3FG9A 4OSPA 1H69A 2BE9A 2HVRA 3PR4A 3M5WA 1KDOA 3ZV3A 4Q4AA 1KIMA 3NASA 2X4DA 5LL6b 1PS8A 2GM4A 3M1YA 1H2HA 1P1BA 2AH5A 1O7JA 1OFHA 1JKJA 1UJMA 5IYZF 4M98A 3PFNA 3MTDA 1K4YA 1B8OA 1A1SA 4O4IA 1C0LA 4F0JA 3RTAA 5EDWA 1QGUB 1SVNA 3QLJA 4CTMA 2H29A 3K8OE 1VE5A 5KQLA 5CLHA 1NR1A 3W9YA 5I3CA 2ZYTX 3IPYA 5AXAA 5JAQA 3ZLTA 1RRFA 1L1QA 3AVQA 4RJIA 4KIJA 4NOMA 1UXKA 3GMIA 4DNXA 2GAAA 3KLBA 1OC2A 2WNHA 1P77A 4FMDF 3WV5A 2IY7A 1E2DA 3K2QA 2P9TA 5EJAA 5CA0A 2RARA 1G21E 4RB1A 2OHJA 3X2SA 1H94A 2ASLA 3EVFA 1T35A 1MENA 1MAUA 3JZMA 4KRXA 1Z63A 2K6GA 3LQ4A 4EQ6B 4NZ9A 3BRQA 4OHXA 5FPRA 2CDRA 4U7JA 3V2UA 4YRRA 3NT5A 2FUG1 1W6RA 1BEZA 4EZEA 1AD2A 4J7AA 4R1OA 4BNNA 2H5EA 4AY2A 1JNXX 5ALGA 3TIGA 5IJ9B 4N6NA 3EIWA 3WLFA 3FDJA 1Q7TA 3DOIA 1IWBB 4IJMA 4IXMA 2XYQA 1X74A 2P3QA 1Y4DE 1QH0A 2G82A 3L49A 3AVOA 3BIFA 1GNQA 2PMCA 3OTOH 5JAHA 1WKVA 2BWJA 2IDKA 4IDFA 2PZAA 2CCJA 4C87A 2CXNA 2G9RA 2PKXA 1P9RA 3KWLA 4ZMRA 4GDFA 4TTQA 5KX5F 2XCSB 2W2LA 1PAUA 4DQXA 4E5PA 1EBBA 1R0SA 3R24A 1AVTA 2VC2B 4EW1A 4FOTA 3GX1A 3MWFA 4ZVNA 1Y1WG 3GP8A 5BVGB 3QXHA 4JGIA 4MA0A 1FNSA 2Q28A 3DUFB 3QSYA 3BIXA 3F2IA 1VI5A 4CTJA 4QC2A 2FN9A 2ZRDA 1VA5A 2PJDA 3FKQA 3ETJA 1WOMA 1JIHA 3REFA 3IEPA 2Y76A 1DDGA 3DAGA 3AIOA 2F3RA 4PAMA 3C3AA 2GEVA 5ITZA 4MS3A 3C3EA 5E38A 2Q5HA 4A3IG 3FVWA 2FSFA 2Y1XA 5E2AA 1ENOA 4QXMA 2JIOA 1XXHB 5EGNA 5ARDA 2I91A 1ZM2A 5REQB 5L9XA 1OWPA 2Z8ZA 5JE8A 2WB1E 2Y99A 4BMVA 1OX5A 4AIRA 4RVFA 2HRZA 1U2GC 4Q47A 4C04A 2GEKA 2IXAA 3KT0A 4YB8B 2J3LA 4IIDA 4OMUA 1IEWA 1S8FA 4ZPJA 4W6QA 2Y93A 4K0RA 4J9OA 3TCKA 4MP6A 1JG2A 1TZJA 5IZ4A 2HNKA 3CSUA 4XYMA 3D0RA 3D2AA 4ENRA 3QVGA 2RHWA 3MW8A 2B36A 2GD0A 4A91A 2PT9A 4Q6BA 1KEKA 3FPCA 4WKGA 3PWTA 3DCJA 3LHSA 3EA5A 2JJYA 4K81B 4DUGD 2E6KA 2BKUA 4GU5A 4PO9A 2CMDA 4FCCA 1DKNA 5MFPA 5B55A 3JQ6A 4BRUA 2R1VA 4QIWA 1DEKA 3FWYA 2FFRA 1A97A 3Q0IA 2QMZA 2BMWA 1J2RA 2ZSFA 1V45E 3NGMA 5HFNA 2EG5A 3HXTA 3IB6A 2JIMA 2A5YB 2IDZA 1V9LA 4CEJB 1ZD4A 3FKIG 3HZZA 5KSYA 5JQWA 1RYSA 5HHTA 3IESA 2W6PA 4Z6KA 4KR0A 4DM4A 3P4UA 4OREX 4S1VA 4DV7H 3TVDA 4LYJA 2XUJA 3LQ2A 4UBIA 1IAQA 1LS6A 1G5IA 4YRGA 3ZZTA 1H3NA 3GNLA 3SEZA 5KHLB 2W2PA 4P4GA 1JIVA 3ZWXA 1ISJA 1PJ3A 5K0CA 1JG1A 5IAJA 3VJLA 3FWPA 3EDOA 2ZJ5A 3SDZA 1KFCB 1VBFA 3A06A 1HG0A 1N9ZA 3GVIA 2CV0A 3Q9NA 3TPZA 2Q3LA 4WCFA 1E7RA 5C3MA 5EQDA 5GOTA 4DS3A 4OOFA 5C1BA 1ZVMA 4RZ2A 2FVYA 4FWTA 1JQDA 5DNVA 4OHOA 2G25A 1ODJA 4KXWA 4EUSA 4NBKA 1MOQA 4V2UA 4YR7A 4QTUB 3H42B 3RC9A 5BN1A 3IR7A 1XMXA 1S97A 3RUHA 1M34E 2D5LA 3K0CC 4YN3A 3KD2A 4KN9S 1M1NB 4WBNF 5DGDA 4V0OA 5HCNA 4QKQA 1PR4A 1CUYA 4N7RA 1MLDA 4BHTA 4HX9A 1M5RA 3L02A 2VT6A 4LHWA 3NDBB 1T9AA 1J09A 1TNDA 4PZ0A 1IY0A 4EL0A 5DRYA 1Z2CA 2Q0HA 2YVKA 3ELBA 3JW8A 4Y6SA 3RE1A 3L1KA 3EYYA 2Q3CA 1F4VA 2C29D 1JHXA 4J9MA 4K9OA 4KO2S 3V1MA 5KX5A 1N34H 4M1TA 4B4DA 2JLQA 4EGSA 3SBEA 4UM9D 4G0PA 4BN4A 1KAGA 1GJRA 4QU8A 1Y4ZA 3ICWA 4EMSA 2CGEA 5I8WA 4PANA 1P0PA 2E4XA 2BSXA 1E77A 4HYQA 3IHWA 3I04A 3DE4X 3OTHA 1I2AA 1G5PA 2EERA 3E5MA 1JHQA 5BWCA 2WK1A 4HADA 2ET6A 1YZGA 3H5TA 2YMPA 4GOMD 1PZFA 5EESA 3AERB 1IEVA 2AI1A 3KOWA 1F2TA 3DNPA 2PXXA 3BYZA 4ESOA 2O57A 3W5OA 5DM4A 2FR8C 3KJHA 1DAHA 2IPOA 3DEFA 5BMOA 1F6WA 1GQ2A 1H3FA 5AHOA 4MYDA 2EQ5A 5CVCA 3VU8A 4PEVA 4NFSA 4F3CA 4MB0A 4NXNB 4JLKA 1MA3A 2YHSA 1C8BA 4AZ0B 2P2LA 3D6JA 3G17A 1ZL2A 4AZTA 1QBGA 3IDAA 3F3MA 1BCRA 2ZE8A 3EBPA 2WAYA 4B6SA 3WLHA 4JXKA 1W47A 1N8TA 2BKAA 1ICIA 2IHTA 4G5YA 2X58A 1VI6A 4AWXA 1FLAA 1ZINA 3K1ZA 4QM7A 1YRYE 2C77A 5LC1A 2VLIA 2EC5A 4AZSA 1G66A 3RI3A 2AV6A 3H7IA 2RHDA 1D6MA 4WY2A 4BQEA 2WYIA 5JVDB 2YJZA 4C0XA 1Y1PA 1GRNA 1JX4A 4XLLA 4DIEA 4TMTA 1CHDA 1XALA 3MJVA 3AY0A 3UEOA 1FUUA 3ZHCA 3FSGA 2JVIA 2HOQA 5DNAA 3SQNA 3T7RA 3QQPA 1H2XA 3WKEA 4S0XA 3H4VA 4AMYA 2CC2A 2NTVA 3TX2A 5D5HA 3KG2A 2HIAA 2X5OA 1QOZA 4FBTA 4MVYA 1FJ2A 4WINA 2JFZA 1WZNA 1XN1A 3OWXA 1TU0A 4V03A 3DWFA 3WLJA 1Z36A 5FA5A 3FNGA 2I5PO 4UEWA 2HH9A 1MJGA 1DIBA 4YECA 3AL2A 4WLUA 2Y4RA 3ZBQA 1R12A 3HFJA 1X1SA 4LN1A 1WXFA 1GA4A 1U0BB 4YMWA 1QHEA 3QELA 3CPEA 3H87A 3CUSA 1L7BA 2O8VA 4FDUA 5DBEX 3KQUA 2L2QA 5I7FA 3CH4B 2ODQA 3A8TA 1TWCA 4GOLD 1GUDA 3VOSA 2ZANA 1WP9A 3K6JA 5EPEA 4E88A 1OHHA 1AXRA 1Z34A 3J81W 2FXVA 3ONNA 2R4UA 3ZOKA 5T8KC 1E2HA 1WEHA 2VR1A 4AYBE 5KVAA 4DR5H 3T6KA 3TOXA 9LDBA 4MS4B 1UZLA 2BCGY 3B8EA 3H86A 1XRRA 2ZIGA 4NENA 2WHRA 3BC1A 2BEJA 2ZJZA 3OA0A 4EUFA 4UDNA 4FD3A 4KZPA 3NTQA 4K9NA 5AI6A 1RZ3A 2GVZC 3ZE7A 3UAVA 2PXCA 4C89A 5JEEA 4GKAA 4AUNA 4HDKA 3WI7A 4LS3A 4H77A 5GAJA 3HWSA 3UWPA 4POOA 3DONA 4H7PA 5HF9A 1M0SA 1FQWA 4BJ6A 4W5NA 3MB5A 3D8RA 2OFFA 5DM60 5JG7A 3B85A 4L6CA 4J9RA 4G5XA 1LDBA 4EA6A 3HZHA 5FNZA 3ROTA 4YUZA 4UNIA 5B30A 3X1XA 1WDTA 1JDJA 1OWMA 2ORED 1KK0A 1XEFA 3ENKA 3L43A 2EZ9A 5EKDA 3GCWA 3HLYA 2QTGA 3ZHUA 3G6WA 1HDYA 3ESQA 3W78A 4S1PA 2B8TA 4MLCA 4UHEA 3U7QA 2P2CA 1A88A 3L8YA 3RS8A 4YTEA 5LLSA 1FUKA 2IS1A 1Q7EA 1BJRE 9ATCA 2WTUA 1J00A 5B57C 1N5IA 3LNCA 4AG3A 5U4XA 1GZ7A 3VPBA 5L6MB 1WXQA 3JQRA 4DB2A 5LZ7A 4O3MA 4DABA 2EF1A 4ZYUA 1GA1A 3ANSA 3HJCA 4Q3AA 3ZWBA 4FIDA 3JRWA 1HI9A 2W6QA 5KJ6A 1PE0A 3H1PA 1Q7RA 3H1BA 3T12A 4UXHA 3M82A 5KMGA 1A8QA 1IPFA 3DC7A 2WJJA 2FEOA 3FFBA 4RTPA 2RAUA 2ZR7A 4HZGA 4CEHB 4C7MA 4KIUA 3LKDA 4QDTA 2I76A 2NPFA 1B14A 4KN6A 4BX3A 2FMUA 2PMDA 1FSGA 1GPKA 2HI0A 4IDBA 1BWSA 5FTKA 4BNYA 5JNRA 2O14A 1P4RA 4XGKA 2FQWA 2XUDA 1VZ3A 1UBEA 4LQ4A 3QTTA 4AFNA 5H7XA 1M7JA 3HB0A 4I5DA 4LF4B 4NHEA 3ER6A 5BOVA 4OGKA 4AVYA 5LDHA 4KXXA 2PT6A 3EIXA 4EFKA 3PXGA 1K8XB 1H5UA 1K6MA 3SHVA 5JATA 1UBFA 3OZEA 4F4HA 3CLTD 4YRKA 4YIKA 3I5MA 1CF2O 4IKPA 2R96A 3ZCUA 2H2GA 5B1IA 5EIBC 1IEXA 3K35A 5A1TA 1WXHA 3OZGA 3IOEA 1GGFA 2W70A 1YF3A 1TMKA 1XF9A 2AG5A 1FLDA 3RROA 4IVPA 2OB1A 1LKZA 1DWOA 3ZE9A 5AYVA 4YAJA 1PGJA 2VZ0A 2JF0A 2B35A 2Z8XA 4B7UA 3QHQA 2C35B 3C5VA 3HO1A 2G1JA 2R1TB 2CKMA 1SBTA 3ZDFA 1KSHA 1OX6A 4UOQA 4G81A 3AMVA 3IQGX 2XNSA 2O2GA 1HDIA 3OURA 1ECLA 2OESA 4CV1A 4HXEB 1VG0B 4NY1A 4IV8A 1ZU5A 5ALRA 4ZOLA