3MWEB

Truncated human atp-citrate lyase with tartrate bound
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
335
structure length
320
Chain Sequence
GKSTTLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILIPVFKNMADAMRKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPATVGGIKPGCFKIGNTGGMLDNILASKLYRPGSVAYVSRSGGMSNELNNIISRTTDGVYEGVAIGGDRYPGSTFMDHVLRYQDTPGVKMIVVLGEIGGTEEYKICRGIKEGRLTKPIVCWCIGTCATMQASETAVAKNQALKEAGVFVPRSFDELGEIIQSVYEDLVANGVIVPAQEVPPPTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the citrate-binding site of human ATP-citrate lyase using X-ray crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords ATP-citrate synthase
total genus 112
structure length 320
sequence length 335
ec nomenclature ec 2.3.3.8: ATP citrate synthase.
pdb deposition date 2010-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 3mweB02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3mweB01
4WEQA 1V3VA 4D46A 1A7KA 4DBVO 2FR1A 4NJMB 3VH1A 5JS6A 2DU8A 4TRRA 1R12A 3UXYA 2DQ4A 4NIMA 4YTEA 3QVSA 3GAZA 1KERA 1ZMTA 4P4NA 1FDSA 1UAGA 4RPLA 4YPOA 3DL2A 4B4VA 4J6FA 5KJCA 4W6ZA 1BGVA 3CH6A 4L0QA 1SC6A 1GD1O 4JBGA 1PQWA 2WD8A 1EZ4A 4BVAA 3JQ7A 3L07A 2DBVO 5GZ6A 4Z3KA 2O3QA 4HFJA 1GL3A 3NX4A 1XLTA 4QSMA 4U0JA 2NVBA 2GF2A 3DAGA 3C24A 1VSUA 1SO8A 4JIGA 4G5HA 4MP3A 3RC1A 3RJ9A 5T8KA 3I6QA 2YFHA 4IJUA 4PCVA 4AJNA 2E6UX 4DQXA 2RIRA 3EYWA 1AHHA 2PKQP 2Z1NA 3ZI0A 4E5MA 4J7XA 2DPGA 2WWRA 1EK6A 3MJEA 4OQYA 1Z45A 3AI1A 2EEZA 1B3RA 3FN4A 3RC7A 4Z6KA 5KNLA 4R69A 4CQMB 3S2FA 4J1SA 1C0LA 1EK5A 4M49A 1QYWA 2PNFA 1ZUD1 2Y0DA 3K9QO 4DYDA 5KJFA 1SBYA 3DWFA 3ADOA 3HDYA 5JPIA 1P31A 4XGNA 1WNTA 2PZKA 1K6IA 3AFNA 4FR5A 4DUPA 3I6IA 4WCFA 2ZYDA 3QWFA 4RDHA 3WX0A 4BNXA 2EW8A 3A28A 4BQPA 2JD0A 4TKLA 5L3ZA 6LDHA 3UAGA 4RLSA 1GZ6A 1QYDA 5JYEA 3MWEB 1ONNA 2HU2A 4GSKA 3ZHBA 1P1FA 3DB2A 5JDCC 4XKJA 4IIUA 3DBRB 2B5VA 1BW9B 1YL6A 2G82A 4CMHA 3NT4A 1R4MA 2NU6B 1KEPA 3GEGA 1A9ZA 3PZBA 4Z0HO 4BKOA 3ETEA 3BTOA 3MTJA 4PLPA 3NRCA 1QORA 3KEQA 5GZ1A 1NHGA 3U5TA 2HMWA 3MWDA 2D1YA 3UN1A 5FFFA 2I5PO 1R37A 4D3DA 1BXGA 3I9JA 5COQA 3PHIA 3QVTA 3HE3A 1UZMA 4DIBA 2NM0A 1PQPA 3PI7A 4YDRA 5K6AC 2X9GA 2HO5A 4NBWA 1BDBA 3AK4A 4KDFA 4ZU3A 1ZH8A 2IZ1A 3KYCB 1DLIA 3ITKA 3OEYA 3Q9UA 5A03A 1UXIA 4LW8A 2FP4B 4RVGA 5I9LA 3ANMA 3DBVO 4WLVA 3JQ7B 1C0KA 1TLTA 2VWHA 3D7LA 4TVOA 3PDUA 1DDOA 4XIYA 1Q2XA 4BKPA 1TT5A 1BG6A 1ML3A 5JCXA 2O3TA 3JYLA 2AQHA 3QV1A 4P4GA 1UDAA 4IINA 5KVVA 2Z5LA 4TRNA 4CMBA 2AMFA 2O23A 2DLDA 4GGPA 1JW9B 3HFGA 3S2GA 1H2BA 3U3XA 4DLLA 4MKZA 5TS3A 4QTZA 4MINA 3PLRA 2HSDA 1QYXA 3WQRA 5JC8A 2AEFA 1A9YA 2ZYGA 4D0SA 2CSUA 5L7TA 3I9LA 1DFHA 1IZ9A 1JKFA 2PGJA 4MVJA 2OBNA 5JBIA 2Q45A 3LT2A 2FN7A 2NQTA 3DMYA 3NV9A 5L45A 3A06A 5CHEA 1AN9A 5KKAA 2CUKA 1UR5A 2NADA 3FTNA 3OICA 5B4TA 5CEEA 4YACA 8ADHA 1NP3A 3CSDA 1VJ1A 2X5OA 1MC4A 1ZCJA 4RVDA 5G4KA 4ZQFA 2VWQA 4JX8A 1G1AA 4IIVA 4R1NA 4AJPA 1PQUA 1U9JA 3BXXA 3QSGA 4HBGA 4O6VA 2CNBA 5I8WA 4NU6A 4CQLB 1BW9A 4K9DA 3ZWCA 3NTQA 3Q2KA 3SBOA 3A14A 1PGJA 1B8PA 1CF2O 4XR4A 1D1SA 5B4VA 3R6DA 4LN1A 4WCFC 1AUPA 4FQ8A 3GNSA 1ZO8A 2ZB4A 3H5NA 4HUJA 4J9UE 4NBVA 4QX6A 3AUSA 4E30A 1SEPA 2GASA 2VYNA 5IJZA 5EMHA 2ZATA 5I8ZA 3GNTA 2QRLA 3H3JA 4XWYA 4O0LA 2JFGA 4CM4B 4CUKA 1EE9A 4WUVA 3WGQA 2YQ5A 3PLNA 2Q4BA 7ADHA 1X14A 2AW5A 2CDAA 5EQFA 1JAXA 4ZQHA 3TZHA 1C1XA 1R0LA 2W8ZA 5ER9A 5KWEA 4PRLA 1NBOA 4GX1A 4JQCA 5AXCA 2X0RA 2HMVA 1UDCA 3ZZNA 4IMPA 4RJTA 3UOGA 4CMKA 1UXKA 4TZTA 2CVQA 1VSVA 3FI9A 5KJEA 4B3IA 2HK7A 3GRKA 4PFJA 1ISGA 4MVJP 5KVQA 4XZ3A 2EF1A 4Z9XA 3OA0A 1R4NB 3BTSA 4CLEA 1YO6A 3ORFA 2P9EA 3WBBA 3DO5A 5TRTA 5BR7A 4RQTA 4JBHA 1ENZA 3BHMA 1BMDA 3H8VA 2VT2A 3BMQA 3PJEA 4GH5A 2WM3A 5DCWA 2X86A 2XAAA 4I9UA 2X0JA 1Z74A 4CM9D 2QQ5A 1DIAA 5AXAA 2GYYA 4O63O 3SJ7A 1NM5A 1SAYA 4YJHB 3NTRA 4MJLA 1KVUA 1KY5A 2FHSA 3N7UA 4ZVVA 3TDKA 3DFZA 2A35A 1XCBA 1CIVA 2YDXA 4B79A 4CMCA 2IE0A 3IC5A 4PG6A 4AJLA 4UEKA 3EAGA 3F4BA 2PWZA 3OQ6A 3W8DA 3JSAA 3VH4A 1FK8A 1LDGA 2GRAA 4DYVA 4CM1A 1R6DA 4ALNA 3RU7A 4BNLA 1DRWA 4OSPA 3TPCA 4CM5A 5C7LO 5JAZA 2LDBA 4JLWA 1EUDB 3RROA 3AM4A 3GEDA 5KVCA 4CV2A 4HV4A 1E3WA 4PN3A 1T2DA 1YBVA 1I33A 1HZJA 2VWGA 4ZHSA 1JVSA 4BO1A 4EJ0A 1DIRA 2CY0A 3FBTA 3KXDA 1E5LA 1VL0A 1V0JA 4IZHA 4DIFA 3RC2A 5GMOA 4ND2A 8LDHA 1H6AA 4DWVA 1LLDA 2ZJ1A 1J4AA 2WD7B 1GTMA 1Q0QA 1KOLA 7MDHA 5I7FA 1KIFA 2BI7A 3SVTA 2Z95A 4LRSB 3TSCA 4CMIB 3D3WB 3PYXA 4RZIA 5THQA 2YHIB 1EUCA 3BMOB 4XDZA 5I7SA 3GRPA 4BO8A 4OKIA 2EXXA 4NU5A 4Y9DA 3JQCA 4E5NA 1PTJA 4YRAA 1UXJA 2D59A 2GSDA 2VHVA 4JXKA 4YT4A 3PRJA 3OJFA 3WTBA 1PZFA 2OBYA 4R16A 3WFIA 2WYUA 1KVTA 5G2OA 3VPHA 4KMSA 2YV3A 1YS4A 4W7HA 3D0OA 1E6WA 3LT1A 3DFUA 4H15A 2C0CA 4ND1A 4N5LA 2QIOA 2FRDA 1T25A 3DBLA 4GSLA 3GG2A 1ZK1A 4MVJH 5DNAA 3KSZO 3OH8A 4I9HA 1ONOA 4E5PA 1E92A 1D1TA 1EMDA 3JQAB 4J1NA 4PLCA 3KSDO 4NG5A 1H93A 1QMGA 2HUNA 3R0IA 4CM8A 1E1NA 2HRBA 5JO9A 1R0SA 2V6FA 3Q0EA 3IP3A 3WR5A 1IYZA 1XWFA 4BNTA 3ICPA 3I5MA 1F17A 4LSMA 3ZH2A 2I3AA 1A72A 4IGFA 3Q11A 4DPMA 2E82A 5I7EA 5ITVA 2WJPA 3EK2A 4RZHA 4K28A 4KUHA 2C2XA 1ZNQO 3OIGA 3DAFA 2WYVA 1VJTA 2ZTVA 1B16A 1WDLA 2IZZA 1UP7A 4J3FA 2BKAA 3DONA 4DMMA 1YB5A 2CF6A 2VCYA 4RVUA 1G0OA 3VZSA 1R66A 4C7KA 3L6OO 4L75A 3GHHA 5BSFA 1WLYA 1EVJA 1Q7BA 1Y8QB 2ZQYA 1B3BA 5F1OA 3FR7A 3GVXA 4URFA 1P3DA 3F6YA 4IQGA 4OM8A 4E33A 3GPDG 3KO8A 3G1UA 1HZZA 2JKVA 4A0SA 4TZKA 3WICA 1E3LA 5FI3A 2NTNA 4G81A 1N2SA 3GVCA 4DC1A 3MJVA 2OGUA 5A9TA 4OXKA 4BMNA 1UH5A 4QXMA 4Q3EA 3B1KA 3W8FA 3QW2A 1RM0A 4R1TA 1LJ8A 4JJGA 4GBJA 3I9MA 1GZ3A 2PD3A 2W2LD 2UDPA 3ZN2A 2DT5A 3H9QA 4F6CA 4R1SA 4MVJG 2VNAA 1A27A 4YEDA 4IXWA 3ANNA 3DEYX 4Q39A 3WGTA 5B1YA 2FZWA 3BMOA 1PIWA 2X0IA 1T4BA 3F47A 3JQFA 1X7GA 3WG9A 2PZJA 2HRZA 5HA5A 1HF3A 4B8WA 1I0ZA 1R16A 4HP8A 1B7GO 3D4OA 1R4NA 1VPDA 5KVSA 3JYOA 3TN7A 1YE3A 4K6CA 3RQSA 1HE5A 5CDGA 5GZ3A 1M6HA 5ER6A 2YY7A 1FDTA 4B3JA 3PJDA 2I3GA 1P9LA 2Q49A 1GADO 4XEHA 4AJKA 3IIEA 1EBFA 4YJHA 4RCVA 5B12A 1LQTA 4M54A 1JU9A 3RJ5A 4YAJA 2EJVA 3GN2A 1EQUA 1LX6A 1GUZA 2GN8A 2IEDA 4CM8B 4GKBA 3JQGB 3QE3A 4XR9A 3F46A 4MVJF 4FJ1A 1I2CA 4TSKA 2EERA 2I67A 3D3EA 1X13A 2B4TO 4DXHA 4FD3A 1X1TA 4I9NA 1EEHA 5I7VA 1PX0A 1H5QA 1PZHA 3KETA 1U28A 4FCCA 1O8CA 3E1KA 4XYLA 3LDHA 3JQBC 1NHWA 3UCXA 4IDCA 3RIHA 1C1DB 1WMBA 3GG9A 3NUGA 1I2ZA 4DQVA 2V6GA 4AVYA 2P4QA 4D43A 1HT0A 4GPD1 2CMDA 4Z9FA 3SC4A 3HDHA 4RVFA 5THKA 3LQFA 1KS9A 2R00C 2QHXA 2BGLA 1B8UA 5JCJA 4RL6A 1ZSVA 3KVOA 1KVQA 2O7SA 4PLGA 2G0TA 3BMCA 1TB4A 3H9JA 2EGGA 3OP4A 5A04A 2DKNA 1E3SA 2YDYA 3HHPA 3JQ6A 3P7MA 5EPOA 4ROSA 1DAOA 3PJGA 4QO8A 1V3UA 2W2KB 1XKQA 4TMFA 3DZKA 1PWXA 3IUSA 5JO0A 1U2DA 4S1VA 3DMTA 5DBFA 4YRDA 5H81A 4CR8A 2FZEA 3GUYA 4FFMA 4JN6B 1UAYA 4RF2A 4E32A 2O3SA 1HE4A 5IDYA 2AG8A 1IB6A 4M1QA 3TWOA 1AXGA 3QRWA 1HKUA 4D44A 4J7UA 4NDNE 2Q50A 5DDIP 1LLQA 1Y81A 3GGOA 3S55A 4Y6RA 4C4OA 1Y7TA 3U4HA 2C5AA 1VL8A 3CMCO 4LVUA 5EESA 3VPXA 4WCDA 1O5IA 3L6EA 4CLOA 1ADFA 5IZ4A 1XA0A 1FMCA 2H9IA 1NQ5A 1E1LA 1ENYA 3M6IA 4LMPA 3RUIA 2VZ9A 2A92A 4E3ZA 1EBUA 4WJZA 2Y68A 2BRUA 2IEBA 1NR7A 2O4UX 4RF4A 1B14A 1PR3A 5JSFA 2NNLD 3JQAA 4PLTA 1O89A 1U3TA 4R5HA 3VTFA 3V8BA 1MP0A 1XEAA 1BXGB 2ZK7A 4GVLA 4N18A 5DCYA 4JBIA 1DXYA 2HJSA 3ZV3A 5IDXA 1U7TA 4JP2A 4L4SA 3EVNA 4Q3NA 2X0NA 3RBZA 1BHSA 4JNKA 3ROQA 3ZHZA 4EUFA 4IUYA 1JAYA 3HSKA 3FNHA 2FWMX 1MUUA 4R5MA 3RAJA 3GDGA 4J2OA 4WPGA 2J3HA 4XA8A 2VUSA 1HDZA 1VLLA 2QZ9A 1XHLA 3DZHA 4ZQGA 3T4XA 1GYPA 3VPGA 3WS7A 1JDJA 1O95A 3GFBA 1KETA 3L0DA 4B3HA 3TOZA 1Y8QA 1Z82A 4L74A 1Z73A 3FBGA 4WK6A 1QLJA 3TOXA 1UXHA 4AFNA 2FY8A 2W2LA 1YRLA 2TMGA 1QRRA 4ID9A 4AJIA 2DC1A 3MOIA 3FSRA 3ZW9A 4PVDA 3VKUA 2QRJA 1N7GA 3PQEA 2AQKA 4LCJA 1P1IA 1UP4A 3CXRA 2P5YA 3JQBA 1U2GA 2GD1O 1LA2A 4QFCA 4D0RA 3VOSA 1YB1A 1YDEA 3GFGA 1T1RA 3NGLA 3P19A 1HTBA 2NU9A 3DAPA 1QG6A 3GF4A 3MJCA 2HK9A 1AGNA 3OECA 2EGHA 4EYEA 5HM8A 4D3FA 1XR3A 2RBEA 2I65A 1U5AA 4RPGA 5F1KA 1BVRA 3I83A 1DEHA 3NJ8A 1NFQA 1GPJA 3AW9A 3ZWWA 3LU1A 2JD2A 2O7QA 4MOWA 3ZWBA 2BFMA 4QO7A 4YVFA 1HDCA 5CAEA 1VC2A 1T24A 4R1UA 1QSGA 3E9MA 3RASA 4IQ0A 4CLOB 1O6ZA 1X0VA 2SCUA 4CQMD 1E3WB 1M66A 3KYDB 3T7EA 1S7CA 3JQDA 2HJRA 3CZMA 3DC2A 2ZYAA 3SJUA 1A5ZA 2V65A 4XB2A 1NASA 1DIBA 3T7CA 4ALMA 5A02A 3TZQA 1DLJA 1NPTO 4NPCA 2VZ0A 1ULSA 3PGJA 1NNUA 3C1TA 4QQRA 5EN4A 1IE3A 2NVWA 3HFSA 5G0SA 4AJJA 1OBFO 1HLDA 2IDZA 2Y1CA 3W4JA 3C8MA 1NWHA 3A9WA 3EY4A 5F3RA 4AJ1A 2AE2A 4A27A 1C3VA 2CD9A 4BNZA 1K6XA 3FRJA 1R0KA 3IJPA 4EEXA 2BFAA 1HDXA 4MVJM 1D4FA 4UVEA 1GYRA 2HMTA 2X7HA 4ITUA 5U1PA 4A2CA 2DBRA 3AOGA 1UDBA 5HS4A 3AOEA 3QP9A 4AJHA 1N7HA 1ULUA 1MFPA 1GQ2A 5L7YA 1PSDA 3BMCB 4IMRA 4UVGA 1MFZA 1Z75A 3H9UA 3MJSA 2AEJA 3EHEA 4FPXA 1FDWA 1HYGA 2YQ4A 2A4KA 4BNGA 1LEHA 3NEPX 4J1TA 4L9RA 3VVCA 5CFZA 1JKIA 4JJFA 4N5NA 2VRCD 3KHUA 4YA6A 4PVCA 4YAKA 3N74A 2Y1OA 3TL3A 1G0NA 5U4QA 2UYYA 4BNJA 1X7DA 2GERA 3HDJA 3PJFA 1U8FO 2YHUA 2CFCA 1VRWA 3P2OA 3HZZA 2PKQO 2B69A 5IZCC 3C7AA 2VHYA 3WGZA 2PZLA 2QW8A 4E0BA 1VM6A 3ETGA 2AHRA 1PU2A 3WYBA 2C7GA 4J9VA 4BO0A 1P74A 4W9NC 4RVHA 1NTOA 3U49A 3L77A 1HSZA 3LYLA 3RSHA 5CDSA 2POQX 5JYDA 3UICA 2DFDA 1TA4A 4BNIA 1IOLA 3GNQA 1H94A 1LDNA 3CEAA 3WDSA 5KIAA 5L4NA 4EDFA 2Y05A 1Y8RB 2P91A 3TNLA 4I5EA 4B7UA 4E2WA 3F4LA 3STHA 5A9RA 4BO6A 1GCOA 2OP1A 4CM6A 4K26A 1DOHA 4NBRA 3WSWA 1OI7A 1GAEO 4R4JA 4H7PA 2HLPA 4UUOA 1E7SA 4DTIA 3RUAA 3VVBA 3U9LA 2YW9A 4I5GA 4IDBA 1YVEI 2NV6A 1NVGA 2G5CA 3DBHA 3ETDA 3I4CA 1MXFA 3JD4A 4FOOA 4QUKA 3LSYA 3DXFA 2DUWA 1VKNA 3O8QA 1YKFA 1B0AA 2C7VA 1N9GB 3LF2A 5DP1A 1LDMA 2EKPA 2H1SA 2HAEA 1TT5B 3F5QA 2V7PA 1LC3A 5JC1A 3B70A 2X8LA 1LQUA 4TQGA 5AXDA 3C7CB 2I66A 2DPHA 4FIZA 1ADCA 4BB6A 1CWUA 1H9BA 3G17A 4OQZA 4NBUA 4XB1A 2ZCVA 4J43A 4O59O 1SOWA 1HE3A 2C59A 5CP8A 4OOEA 2VOEA 1IPEA 1H6DA 2WE8A 3H9EO 4UEOA 3L9XA 2JFFA 1HYEA 4RPHA 3L4BA 4E4YA 4F6LA 2NU9B 4YXFA 1Q1NA 4UUPA 1NQAO 3BTVA 3PGXA 4OXYA 1I8TA 4DA9A 3K96A 2UV8A 4KOAA 4CODB 1QYCA 4N5MA 5KJ6A 1KEVA 4PLVA 1M67A 4XQEA 3NT2A 3SEFA 2FR0A 3PHLA 1KVRA 1PZEA 3CTMA 2I99A 2EP5A 4ZN6A 1YBAA 2H6EA 4DL9A 3DOJA 1OOEA 5JMPA 3X2EA 2IZ0A 3PEFA 4B4UA 1O94A 4IXTA 3ZHYA 4OO3A 1XDWA 1PL6A 2RH4A 3AUTA 2ILTA 3KYDA 4Z0PA 2I76A 2PD4A 3WIDA 1ENPA 1T2AA 4CV3A 2VHZA 1E7MA 3TQHA 2NU7A 3ADPA 3D1LA 3ZWNA 1WWKA 4NBTA 3OFSA 1E77A 3EW7A 1PL7A 3WLFA 1Y6JA 1Q0LA 2Y1EA 4GLLA 4CPDA 3FHLA 3QVXA 2HDHA 4P8RA 3DHNA 1E6UA 3K5PA 4UVDA 1LLUA 4HADA 1LSJA 4WLUA 4O1MA 1EQ2A 3QJ5A 2B5WA 2D0IA 4FFPA 4GX2A 4NH4A 1YOVB 4J4HA 4PGFA 1IL0A 1PZGA 2ET6A 3E82A 4E5YA 4EITA 2OFPA 3JYQA 2XXJA 4FJ2A 2GCGA 2X22A 3WFJA 4YQZA 4LCEA 1AXEA 3DOCA 4BL5A 3EDMA 1ZFNA 1N9GA 5DP2A 2FPIA 1DHRA 1HDRA 2ZCUA 4P4LA 4TRJA 4L4XA 1DC5A 4CR6A 3SX2A 3PHJA 4YBZA 4L73A 1NVMB 2Y0CA 1MA0A 4Q3CA 5COAA 1E5QA 4NMHA 4U7WA 3GAFA 4CJXA 4J2HA 1J5PA 2IODA 2CDCA 5TQVA 4ILKA 3JQGA 3U4IA 3WWZA 5A06A 2BGKA 1EUZA 5F5NA 3WOHA 4TRMA 3PWZA 3QWBA 1WPQA 1LDEA 4BGIA 4OL9A 1RKXA 3IP1A 3K2EA 4LSWA 1KY4A 2WEKA 5TT1A 4MVJD 4H3VA 1IHYA 4IDDA 5TIIA 1K5HA 1G6KA 1XU7A 2C07A 1JKJA 1ZK4A 3HUDA 1GU7A 1SZJG 3E5MA 3FD8A 3ZWMA 4BO7A 4HFNA 1PJ2A 3OJLA 1P77A 1RM5A 3S2IA 5CDYA 2Q3EA 5HRUA 3AUAA 3GK3A 5TJ9A 4EI2A 2B0JA 2VHXA 3IQDB 1I36A 1W8DA 1DB3A 1O0SA 3B6ZA 4RVSA 3E5RA 1X1EA 4RF5A 1Y8RA 1KYQA 1YL5A 2DFVA 5BNFA 3ULKA 3IOYA 1BXKA 3O03A 3I52A 3LT4A 2A94A 2JCYA 3U4CA 3GZNB 4CLRB 5T5QA 2VRCA 4CQMA 3WYCA 3C1AA 1NPYA 3E9NA 1W6UA 5JAQA 2GO1A 1H2HA 4RDIA 5JDCA 2O3UA 1EUCB 3JD1A 5HS6A 2XPCA 3O4RA 2A9FA 4ND5A 2C20A 2P2SA 4E6PA 5L51A 4GAEA 3V5NA 3AM5A 1RYDA 3TZ6A 5A9SA 1YOVA 1EVZA 1LNQA 3IKTA 4GWGA 3U62A 1SB9A 1Z7BA 2VQ3A 4AJ2A 4MIOA 3QVWA 4J7CA 5L4SA 1GR0A 1X0XA 2CDBA 3E18A 5ICSA 3PZRA 4RF3A 3K6JA 1PJTA 1EVYA 3G1TA 3GY0A 2EKQA 4WLNA 5IXSA 1L7DA 2NU6A 4CUJA 4IPTA 3LF1A 4EUEA 4CR7A 3V1TC 3ZW8A 2JHGA 2Q1TA 5JY6A 1EVIA 4UULA 3WMWA 1CERA 1Q0HA 4BNMA 4XRRA 4WASA 4XYGA 4WLEA 1BDMA 3ZGYA 3DZBA 2P9CA 2EW2A 3BZUA 2PV7A 2IYPA 2XOXA 4O5OA 1ONPA 1CQIA 4CL8A 2GZ1A 4R9SA 2Y1GA 3BHIA 4ND4A 3CUKA 4IDGA 2W4QA 5JLAA 2GR9A 3QA9A 4FFLA 1NFRA 4GGOA 2V6MA 4TWRA 4WLOA 3ZNOA 1ZBQA 2VYVD 2BF7A 3ENNA 3WQSB 4IDFA 5ADHA 4A73A 3IL2A 2E37A 2Z1MA 3OSUA 1C1XB 3RC9A 3ONDA 4XYBA 1HDGO 1JWAB 2VYVA 3SLGA 2GLXA 3O9ZA 2X23A 3JV7A 2D8AA 2B4QA 5DOZA 4ND3A 2UVDA 3WYEA 1O9BA 5L53A 1W73A 1ZKMA 4EGFA 3UH1A 3NKLA 5IAAA 2Y67A 1ISJA 2Q2VA 1YJ8A 3OIFA 4FBGA 4PLHA 3GH3A 5DBIA 4U0KA 4HX5A 4KQWA 2HKIA 3RCBA 3AU8A 2YV1A 3H4VA 2P68A 4NI5A 4G2NA 5C37A 2J8ZA 4ZGWA 4XD2A 3BHJA 1XU9A 3WB9A 2UUPA 3H65A 3FR8A 5MGBA 3AJRA 4G65A 1JQBA 5IN4A 5HTOA 3KBOA 1IPFA 2EV9A 5AQ1A 3CPSA 3RUCA 3AUUA 1TVEA 2ZB3A 5COBA 4EW6A 2W2KA 3ZWAA 1DJNA 4CM9A 3H2SA 3WLEA 2PGLA 1GEEA 3GGPA 4J0EA 2D4AA 2GDZA 5DT9A 3GPIA 3MZ0A 1UP6A 3IJRA 2IRWA 3OIDA 4BQRA 4Q3BA 2B35A 4RLHA 1SEVA 4Y6PA 4XX0A 4BS9A 2QZZA 1W4ZA 3R3JA 1GV0A 4OGWA 3C3XA 2QYSA 3I9NA 3K31A 2EG9A 3BA1A 5BT9A 3TZKA 1B2LA 1QV6A 4QECA 3WJAA 4F3YA 3LVFO 1WVGA 3ASUA 3NAQA 3WQQA 4CMJA 1PGOA 2X5JO 2J5KA 1AHIA 4Y67A 1J49A 2VHWA 1NQTA 3NYWA 4JGBA 2Q46A 1K6JA 3Q2IA 2C2YA 3GZ4A 3LZ6A 1PGQA 5A3VA 4NQZA 3I9KA 1JVBA 3ONEA 4DQUA 3D4PA 2QRKA 2EJWA 3L6DA 3GLQA 4AJEA 4E21A 4KP7A 2O3RA 3OEWA 3HN2A 4J49A 3SXPA 2E49A 3WGYA 1B15A 2VTEA 2AXQA 1SPXA 2Q1SA 2WE7A 4OOFA 4L8VA 4GQAA 1OFGA 1KEWA 1MC5A 4X54A 2O2SA 3PYMA 2H63A 1DAPA 1CDOA 4MVJE 1PR9A 4NK4A 4YWJA 3W4KA 2P4HX 4BV9A 4BNFA 1VKOA 4UUMA 3BAZA 3BMQB 4OAQA 3I3OA 4YYZA 3ZWYA 4LVCA 5BSGA 4R54A 3BIOA 4GI2A 3Q1LA 2OUIA 5JY1A 1DO8A 2OZPA 3H5RA 3V2GA 5I9MA 2Q2QA 3KEOA 3GQVA 4IBOA 5L95A 2Q4EA 1Y9AA 2FSVA 3IKVA 1A7AA 5EJ2A 1SB8A 4XRGA 4BNNA 3JQAD 1Y1PA 1ZVMA 2WSBA 1MG5A 1P0FA 1MX3A 2YJZA 3MJ4A 2J3KA 2XF8A 1DFGA 2EIHA 2D5AA 1MV8A 1V3TA 1EUDA 2VTDA 3JD3A 4HFMA 2I6TA 1BXZA 2BELA 5DZSA 1T2EA 1EFLA 1LBEA 2GN4A 2ZB7A 4HY3A 3RUHA 4EJMA 1GUYA 3RVDA 2X9NA 3AY6A 3ZWOA 5JE8A 4CMEA 5JNLA 1YBMA 1JA9A 2JAPA 1Y9EA 4PZDA 5FYDA 1M6WA 1OC2A 2JAHA 5B37A 4E2YA 2Y1DA 2NU7B 1CQIB 1SCUB 3HG7A 4W82A 2LDXA 4Y98A 5G0VA 3MWDB 1P0CA 4D45A 1YGYA 1X15A 4K1LA 5A3JA 1P1RA 1WW8A 1M2WA 2VOJA 3ZDFA 4FC7A 4A10A 2OOSA 3DR3A 1Q7GA 3K8ZA 5CPFA 1PJLA 3BMNA 4I5DA 1LU9A 4PZEA 2GNAA 1L7EA 4RGBA 4B4OA 3ZV4A 1A71A 1QKIA 3LLSA 4EUHA 1EDOA 2FP4A 3M2TA 3ZU4A 3VC7A 2VN8A 3H7AA 3VDQA 2BH9A 1A4IA 1PEDA 4IJWA 2FPPA 2VT3A 3RUFA 2OMEA 2FPIB 1OMOA 3K92A 3ZV5A 2C54A 2JJYA 4TKMA 1RM4A 3B1FA 4MKRA 1BWSA 4GMFA 4R9RA 1IULA 4B7XA 3WBFA 1GUFA 3DBLB 4YAEA 4OMUA 1BSVA 1K89A 3KLPX 5C5IA 4YT5A 2PFGA 4Q9NA 1WDKA 4DLAA 4ZICA 1P45A 2OP0A 2JCVA 1E7RA 3KM0A 3KB6A 2GN9A 3X2FA 2D2IA 3I23A 1UXGA 2X4GA 3RI3A 5IFLA 4CMAA 2FMUA 3VZPA 2ZJ0A 3LK7A 4MO2A 3VPFA 2NU8A 3INRA 3JYNA 4L4RA 4U6QA 3LT0A 2D3TA 3JD0A 5LDGA 4GL4A 1Y5MA 1VL6A 3OQ1A 3GMSA 1TXGA 4QT0A 4WECA 3VZRA 5TT0A 2JFHA 2PD6A 1QYVA 3INTA 1U3WA 2DBZA 5G4KB 3UFXB 4AICA 3WNQA 1NAIA 4Q3AA 5DF1A 1C1DA 2SCUB 4CM3A 4HKTA 3WGIA 4NFYA 5LCXA 5L9AA 1P44A 4A03A 5BNTA 4NNJA 2J5QA 3A1NA 4L76A 3JTMA 3NGXA 1P1KA 4YJGB 1OZAA 3WJ7A 1H0KA 2W98A 3BTUA 1C0IA 3F1LA 1SCUA 5CDUA 3ZU2A 5CEFA 1E3EA 3AFMA 4BMVA 2EWMA 2AG5A 1ADGA 4NHEA 3ZNPA 4CM7A 1LDBA 4D79A 4CV0A 4GLOA 5KJ1A 9LDTA 4PLFA 3S2EA 3TL2A 2CVOA 1ZK0A 4CMEC 3PFFA 3SC6A 3CZRA 1OAAA 3BMNB 4MPDA 5ILOA 4B4WA 2RAFA 1JTVA 1YDWA 2AA3A 1JWBB 3CINA 4PG5A 5ENVA 5C3MA 1I2BA 3F5SA 3RFTA 1N1GA 4YB8A 5F5LA 2D5CA 4BO3A 3DOOA 4UREA 1J0XO 3H5AA 1N5DA 2P9GA 4P38A 1NAHA 3MCVA 1FF9A 3LLVA 4YRBA 1P33A 4FOSA 4J16A 4DREA 1QV7A 5T57A 1DPGA 3M1AA 3B1JA 1J6UA 1XQ1A 3R3SA 5K0ZA 4N7RA 5DOVA 4FS3A 3FNEA 3WTCA 4M55A 4R41A 4IJKA 2X9VA 3M2PA 3OJOA 4TROA 1XELA 3INGA 1GY8A 1OC4A 2PY6A 4DLBA 1QLHA 3E8XA 5A1TA 3WXBA 1XIVA 2B37A 2NU8B 4Y8VA 3F9IA 2NUAA 2AQ8A 4E12A 1E1MA 1ISIA 3DZJA 1QR6A 3RFVA 1LLCA 4NK5A 3VPSA 1AE1A 4J4BA 2EHDA 4ONEA 4II2A 2J6IA 1YXMA 4MIEA 3DZGA 4E13A 4YR9A 4R3WA 1ORRA 4RQUA 3PHHA 4WLFA 4FC6A 1FXSA 3RBXA 3HADA 4QEDA 3V2HA 1XGKA 5G0TA 4S3MA 2P5UA 4JP3A 1GFSA 5HBRA 4IDAA 4YT2A 1I10A 3W8EA 4XIJA 3PYLA 3GZNA 4CLRA 1LUAA 3GN1A 3ONFA 3Q3CA 4FGWA 2DTDA 5IDWA 3A4VA 4OJNA 4Y6SA 4GX0A 3TF5A 1U3VA 4CM4A 3KOUA 3WMXA 1FDUA 3NTOA 5A05A 4E5KA 2Q2WA 4DGSA 4XJTA 2NVUB 4BGUA 2Y0EA 1ZMOA 3ASVA 3O38A 3QWIA 1KC1A 5TGDA 3WSVA 5A9SB 3H3FA 4UUNA 1CEQA 2NSDA 4FGSA 1KEUA 3RKUA 4WCFB 4YAGA 1E6EA 4XYEA 4INAA 2X5KO 5JCJD 2FPPB 1T2CA 1LI4A 4PZCA 1UUFA 2G1UA 4UAGA 4XGKA 1Y5RA 3E48A 4I1IA 2JD1A 1XSEA 2OL4A 2PKRA 1PJ4A 3ZNQA 2WYWA 3HB4X 4BNKA 2Y99A 3FNFA 1JLLA 3OHSX 5EERA 1ZZEA 4U5QA 3GHYA 1HRDA 1HDYA 3QHAA 2CF5A 3Q6IA 1KC3A 3M1LA 3IMFA 4E2ZA 4ZQBA 3I1JA 4MKXA 2VNSA 4AL4A 1WXDA 1V9LA 3DQPA 4XJSA 3VTZA 3ABIA 1E7YA 1QXSA 1I5RA 3CIFA 4I8XA 1EDZA 3OQBA 2WDZA 2TMDA 3AY3A 1YJQA 2G17A 1CETA 4HNHA 4KQXA 3ZNNA 3PFWO 3FPLA 4U6SA 2NQ8A 4BB5A 1IHXA 1EE2A 3UCFA 1I32A 3B20A 4DIOA 1GV1A 4R68A 5C7IO 4E2XA 4BOYA 4D7AA 3QLJA 1ZSNA 4PLWA 6ADHA 2YZ7A 3QQPA 2PLAA 4WE3A 3HB5X 4ALJA 1YONA 4KZPA 1IY8A 4PLYA 3NDRA 5ENDA 2HMSA 4XDYA 1F14A 1N92A 1ZEJA 4YJDA 2BMAA 3PIIA 4XQGA 4EZBA 3JD2A 4W4TA 2X1HA 5A5FA 2GZ2A 1ZSYA 3RWBA 3DHYA 2C29D 1NVTA 1D8AA 2BI8A 4GWKA 4OIMA 5HWSA 1U3UA 3AU9A 2IYOA 3UVEA 1U8XX 4LMRA 3D3WA 4BGEA 2EP7A 2E4AA 5CG1A 3HJAA 5IDQA 4PLZA 4IS3A 5EIOA 4ALLA 1GDHA 4BO4A 1CQJA 4BUCA 3ZV6A 5CG2A 1D7OA 1YB4A 1NQOA 1WZIA 4CLXA 2E48A 1K0UA 3IUPA 3HDQA 1YH3A 2GPTA 4RV9A 2DTEA 5IG2A 1DSSG 1PJQA 4H16A 4YCAA 4NFSA 2JCXA 5LDHA 5T6BA 4DVJA 5JW6A 4OH1A 4RPJA 3VHRA 4YQYA 4BNUA 1R4MB 1U4OA 3PDJA 3R1IA 4IGEA 2BGMA 2JL1A 1WDMA 3PTZA 5FI5A 4CQLA 1NFFA 1A4UA 1ZIDA 1E1KA 2B36A 1U7HA 2I9PA 5EL0A 2OXIA 1BTOA 3IDSA 2VUUA 3JQFC 5F21A 5U9CA 1I01A 2F00A 2VUTA 3I9OA 1EFKA 4JK3A 4MDHA 9LDBA 4K6FA 5JDIA 3E03A 3S1LA 1E7QA 1XG5A 3F1KA 3AM3A 4OSOA 3ZWPA 4MP8A 3GUCA 3OBBA 1I3LA 2Q1UA 2DAPA 4WOJA 4NZ9A 1V6AA 4IQ8A 5LC1A 2NACA 4BO2A 4XYMA 4ZRMA 4ZJUA 5G4LA 3DBHB 3ZU5A 5TC4A 1YQXA 3EZLA 1H9AA 1CJCA 1P1HA 1PS8A 3ROPA 1F12A 3ROMA 5DCUA 5BNIA 2PH5A 3PXXA 2PH3A 5TSDA 4DPKA 5B4UA 3AI3A 3ST7A 5J23A 5FEUA 4XQ9A 3KRTA 3GVHA 3C85A 1LRJA 3ROKA 4PG7A 1XYGA 4KTTE 4JROA 4XGIA 4F45A 1PGNA 5G0UA 5TJHA 4KDEA 4LK3A 2J3JA 1I30A 3PHGA 3U0BA 2FPGB 1MB4A 3D4NA 4WNIA 3WGGA 1ZXLA 4BNWA 3ZU3A 1GCUA 1NWCA 2RCYA 3E6AA 3VH3A 3TFQA 4ESOA 1U4SA 2R00A 2FOIA 5I9NA 3HN7A 3PPIA 4R01A 1HXHA 2O50A 4FN4A 4EEZA 3G49A 3LC2O 2GGSA 2O4CA 4FFRA 4ZA2A 1U5CA 1B8VA 2AQIA 2ZB8A 5KKCA 1JLLB 1ISMA 3LC1O 4HXYA 3W6UA 3GOHA 3VAZA 4BV8A 2UUOA 3IS3A 1UZNA 5F1PA 3HQ4O 5JFOA 3DMTC 3DBRA 3ENKA 4KUEA 4EBFA 5T67A 1GQYA 4XX0B 3DZFA 5AOVA 4EJ6A 5TLSA 3H6KA 4Z0TA 3RFXA 2JHFA 3OJEA 2AE1A 2OHXA 4OYRA 2OORA 3F3SA 4Z3DA 3W4IA 3K2BA 1PGPA 1PJSA 3DHEA 3G3EA 4M8SA 4YJFA 5A5EA 4CMIA 3MEQA 4BO5A 1K3TA 1DC3A 5ILGA 3L4SO 3W1VA 3GMDA 1H6BA 1LSUA 1YWGO 2DTXA 1NXQA 1ZK2A 4GVXA 3CMMA 3FPCA 5JAMA 4OHUA 1RM3A 2NLOA 1TEHA 2QYTA 2F1KA 4CLDA 1Z6ZA 3JCZA 1QP8A 1NYTA 5H83A 4B8ZA 1PS0A 5JDIC 1Z7EA 3ANLA 4PIVA 4OXNA 4IY1A 5ICMA 3COSA 3V1UA 1E3IA 4LISA 1E3JA 2H5LA 1LXCA 5JAIA 1SNYA 4GKVA 1CYDA 3GEMA 3D5QA 3V1YA 3OM9A 1NPDA 4OKNA 5IF3A 2BFOA 2J5RA 2PK3A 1K2WA 4FFOA 3PWKA 3QWAA 5EQDA 1GZ4A 3GGGA 4XCVA 5K9ZA 1LSOA 1DJQA 3WNVA 1F06A 5AVOA 3W6ZA 3ZWVA 1LSSA 1HE2A 2V6BA 2FPGA 4MVJI 2O3JA 2ZQZA 4LRTB 4J1QA 3GDOA 3UHAA 2YFQA 4HNGA 5AXBA 2NUAB 2C5EA 1MG0A 2IXBA 4PG4A 4NJOA 1GEGA 1WZEA 2NTJA 3EUWA 5IN5A 1W0CA 1LRLA 3UFXA 3BYZA 1JKJB 2BD0A 1HL3A 1XQ6A 4P22A 1CRWG 1MLDA 3MWEA 1SMKA 3PIDA 1L1FA 4BMSA 4DMLA 4BKRA 3HNPA 4LGVA 2HQ1A 4AG3A 1WMAA 2OO5A 2DUUA 2Q1WA 1ID1A 3G79A 3OJ0A 4RPKA 1LDYA 4ALIA 1ZEMA 4YJGA 2GUGA 5TX7A 3RU9A 3AY7A 4D3SA 3N58A 1RWBA 1MGOA 4IM7A 2NWQA 3LC7O 2B4RO 1T1SA 3I4FA 1ADBA 1F8FA 5CDTA 2BFPA 1N8KA 3GT0A 1TI7A 3S8MA 3U09A 3ZCXA 3RKRA 5JXWA 4WNCA 2VWPA 2NVUA 1HWYA 4MP6A 4YJFB 3QY9A 3NT5A 3GC6A 3KV3O 5EINA 1M76A 1RYEA 5DULA 4A26A 5A4DA 1DC4A 1M75A 4Q3DA 1DIHA 4YT8A 5ES3A 4PRKA 3C7DB 1VJ0A 3WIEA 4N54A 1E0DA 2IXAA 5BQFA 5CPBA 1PL8A 1ENOA 4I5FA 2EKLA 1B26A 3G0OA 5GY7A 1I3MA 4FDAA 4ZQEA 1KVSA 2WMDA 4PG8A 2CVZA 4MIYA 1MXHA 2CZCA 3KLMX 3FWNA 2W90A 3NJ4A 4CUZA 4BIIA 3CKYA 3UKOA 3GDFA 3PQDA 4A5OA 2X6TA 4ALKA 1UJMA 5FF9A 2HMUA 3TFOA 4B7CA 2YYYA 4KWHA 4NJMA 2X58A 4NR0A 2PR2A 3ON5A 3HWRA 3KTDA 3T4EA 3D64A 2DM6A 3AOEC 5G0WA 2ZIZA 1I3NA 1I24A 1ZK3A 5TNXA 4XQCA 3RUEA 2G76A 4JJIA 1ISHA 3JQ8A 5JMWA 3L9WA 5IXYA 4CMGA 4E31A 2B83A 4Z9YA 1Q7CA 3IAHA 5CAEB 2ZTLA 1PWZA 2C82A 4DRYA 3VDRA 4M86A 3E9QA 4UVHA 2YV2A 5C7OO 5L40A 4IS2A 4FSHA 1ZJYA 4CV1A 3H9GA 1UZLA 2HK8A 1GQQA 3JQ9A 1LRKA 2J3IA 3OETA 3VH2A 2GN6A 4R3NA 1WP4A 3PP8A 3CE6A 4JCOA 1BVUA 2R2GA 3TJRA 1FDVA 1R15A 1YQDA 1DBVO 3EMKA 1T26A 2AEMA 1TT7A 3GVPA 4AJOA 5IZCA 1P1JA 4BNYA 2WD7A 3TRIA 3FNGA 2FR8A 1E7WA 2UAGA 4A7PA 2QG4A 2PZMA 4W9NA 4DPLA 3K30A 5MDHA 4UEJA 4CLHA 5L4LA 4RORA 1HETA 1GPDG 4KWIA 5BSEA 1NR1A 1CQJB 3P2YA 3QWHA 4GX5A 4W7IA 4WGGA 1ISFA 3Q9NA 1U1IA 3NDJA 3D5TA 1DFIA 1HSOA 2DBQA 4KUGA 3DTTA 2R6JA 3JQEA 3MJTA 2PTGA 3ZHXA 5CEJA 1T4DA 5H82A 1ARZA 1DRVA 4J4TA 4F46A 2PA3A 3QVOA 1YL7A 3AI2A 3O8QB 4BHTA 2ZTUA 5AYVA 4TVBA 3OMLA 2O48X 2DVMA 1F0YA 2FSSA 3EZYA 4GMGA 3DZIA 2O2YA 4NFHA 3QIVA 1S6YA 1HEUA 3UF0A 3KUXA 2ZTMA 3U4DA 1SOVA 1DHTA 3H2ZA 3PK0A 1NX6A 1FJHA 2RHRA 1IUKA 1JN0A 4WKGA 5KTKA 4QFDA 4BKUA 4HWKA 3EGOA 2GZ3A 3NDIA 1WAMA 2RHCA 4J0FA 2WTBA 2YUTA 1PJCA 4DC0A 1VI2A 4FW8A 4II3A 4WEOA 1IZ0A 4AJ4A 5L7WA 5DN9A 2XXBA 3ZWXA 4I08A 1PJBA 3OF2A 5T8KC 3UW3A 1VE9A 1ZXBA 4W99A 3UCEA 3GR6A 3SLKA 1RJWA 2NTVA 5KCZA 3VKVA 1PS9A 3RUDA 2HCTA 1KBZA 3EC7A 1D3AA 3WGHA 2VRBA 3JQ8B 1HLPA 3KYCA 3C1OA 1RPNA 4M89A 4ZRNA 1ZW1A 2BLLA 4IJVA 4HFRA 3OA2A 2Q99A 3PQFA 4J90A 3L4BC 3MTGA 4R51A 3FF4A 3TZCA 3ITDA 3UGKA 1PJ3A 2PGDA 1DRUA 2Y66A 4D41A 1HDOA 1C14A 4FJ0A 3KYBA 4UVIA 3ICCA 4CL3A 2ZKLA 5BSHA 3RD5A 3KZVA 3P5SA 1V8BA 1C0PA 1X7HA 3GVIA 4BNHA 4FB5A 4U8GA 4BO9A 1ZJZA 5KOIA 4WOKA 1V35A 4IDEA 1GYQA 4FFNA 3JYPA 3FCOA 3JQ9C 1H6CA 4BGVA 2VYND 2RH8A 3EVTA 2YHIA 3FTPA 3FWZA 4DBZA 3UUWA 5T64A 2Y93A 3AWDA 3WWYA 3WGOA 1YQGA 1F8GA 5ITWA 4BKQA 2BHLA 4IZIA 1N1EA 1LTHR 4BNVA 4RO0A 2QX7A 3RBVA 5DBGA 2VZ8A 3K73O 1BRMA 3O26A 3V2UA 4D42A 4ZD6A 1DC6A 4YAIA 5TF4A 3PWSA 3KSUA 1DIGA 4M87A 3DTYA 5K6AA 1HYHA 3VZQA 5FWNA 2Y1FA 3DDNA 3PVZA 1LC0A 3MOGA 4J91A 1T2FA 1I3KA 4C7JA 4KTVE 3GA0A
chains in the Genus database with same CATH superfamily
2DQZA 4MEAA 2ROQA 1IM2A 5K8UA 1I7LA 1QS0B 1YIAA 2Z9CA 4DSNA 4EKDA 3THWA 3VH1A 5B6JA 1NGSA 3QFRA 3OOYA 2H4ZA 1E64A 1R12A 1JILA 2XSZA 3G2KA 1NY6A 3P9CA 4OM7A 4EZEA 1EHYA 1X86B 4JJ8A 4YTEA 2WFAA 3MBOA 3GPLA 3G1WA 1FDSA 4RPLA 5JWHA 3PF9A 4J6FA 3C3JA 1IY1A 1I3OA 2J3DA 4QQNA 3CH6A 1G98A 1VIAA 3NDBB 3AZPA 4V3BA 5B3JC 4LIPD 1SC6A 3KAPA 4KK3A 2WD8A 2QJRA 2JEZA 4TLLB 1VGRA 3EXHB 4R8SA 4DJ5X 1NZFA 3L07A 5CVJA 4PO1A 3R24A 2YW2A 1TVKA 4HFJA 5C1IA 2BUCA 4DGQA 1NNSA 4G5GA 2NVBA 1PWYE 2FUCA 4KBGA 4JYBA 3C24A 3LDGA 2QAGC 1QV9A 2XYQA 3ICVA 3Q6NA 3QUTA 3VPCA 4YQFA 1RLMA 1Y4AE 1R5BA 4BIMA 2Y1KA 3KTAA 4UAUA 4JBYA 4PCVA 1D07A 4L16A 2OCAA 2XA1A 3IPRA 4TKVA 5ECWA 1AHHA 2Z1NA 3NBYC 1TC1A 4E5MA 3HR8A 3C6KA 1SUAA 4FD2A 2WWRA 1L6RA 1ODJA 2XKJE 2HM7A 1EK6A 2DUJA 4X94A 3SF0A 3SZUA 3MJEA 5KHLB 3AL3A 1QGZA 2OVFA 3PQ7A 1V4VA 1JYSA 1TIKA 3S81A 1EINA 3THYB 3JWHA 4M49A 3FMFA 1NP7A 1ZUD1 4DYDA 5AVUA 5UKDA 1SBYA 3DWFA 4EABA 4EKIA 3OZRA 5JPIA 1T3ZA 1P31A 5AVQA 1O57A 1AKUA 2W43A 2PZKA 4KQJA 2P3QA 4Q03A 4DUPA 4F2DA 1JMVA 4HWSA 2CCKA 3P0RA 4RDHA 3GRFA 3A28A 5JHHB 5IJXA 3QEKA 5LYJA 4WGFA 3H5VA 1OQAA 1XTRA 2B4KA 5L3ZA 3KOMA 4AXXA 5M2QA 3E9ZA 1R7RA 1FUUA 4GNKA 3UAGA 4PGAA 1Y1LA 4RLSA 3DYIA 3OFJA 3PTAA 2GPYA 3VNVA 5EWLA 1P1FA 3DB2A 2KMLA 1XNQB 3PNQA 1B41A 2VF4X 2VDPB 2DHEA 4JU8A 4XKJA 3ZGOA 2B5VA 1NMYA 1YL6A 2H18A 2WHQA 2FCAA 1CUAA 3MB8A 4A8JC 2J0SA 3GEGA 3CQ9A 3PZBA 3UT0A 4BKOA 8GPBA 1U5BB 3B9RA 3LCVB 3Q85A 1JR3A 3O6VA 4BX3A 2RK3A 4LC1A 3U4GA 1KMQA 1J70A 4KZKA 2HT1A 2G1KA 4JVSB 4QUGA 4C20A 1NHGA 4K3VA 2B82A 3ZZMA 3UN1A 1NN3A 1P2SA 3F7OA 5FFFA 1R6UA 2JC3A 3PNVA 4QASA 5GM2A 3RR2A 3Q98A 3SEAA 5KI6A 3PHIA 1JUDA 5DM4A 4UBIA 2GFIA 1NMQA 1Z6GA 2IS6A 3P5BA 3O1LA 5K6AC 5LWHA 3O83A 3D0KA 2H1LA 1SHKA 3LTEA 4UHEA 4DNOA 4QJ4A 3LY9A 4KDFA 1OBCA 4ENTA 1X9IA 2IZ1A 2JHPA 1EWVA 1KYYA 4LW8A 3VU3A 2RIPA 4I81A 5I9LA 1L5QA 2I1QA 1VMIA 3KUKA 2FF7A 4HWRA 1XRSB 5A4KA 3TVDA 4R2HA 3HEBA 4WLVA 2I78A 5JNTA 3M3DA 1AKVA 1TZ2A 3S40A 3DE3X 3AUYA 3G5AA 3WKBA 1ZR2A 1WVMA 1GA1A 1E4EA 5JCXA 1QOPB 3VXKA 1Y4UA 3IBCA 5DK6A 5LU8A 4L27A 2AMYA 4IHJF 4KDRA 5KVVA 1VBNA 4CMBA 3K4QA 4GIBA 4KB5A 2A0WA 1WP9A 1VIDA 2DLDA 1K7SN 4GGPA 1V16A 1H2BA 4MRNA 3U3XA 3CRNA 5KOYA 4QTZA 1QYXA 3ZE6A 2AEFA 2YHAA 2I1LA 3K8QA 3VR6A 5L7TA 1PEKE 4QJ3A 5KKNB 4REQA 4QJ5A 5MFZA 1DFHA 1IZ9A 5ALHA 2QX8A 3PKJA 3S2ZA 2DGDA 1P9RA 2P2ZA 2XMDA 3PG5A 2ANCA 2Q5EA 4YCJA 5DHPA 2OBNA 2XWJI 4PONA 2IHUA 2VXBA 3UUEA 3RG8A 1G41A 3BCHA 2OAGA 5IFKA 2NQTA 1YRBA 3DMYA 4HDKA 5L45A 1G2OA 3TBFA 4DLSA 2AKEA 2F55A 3R8CA 5KKAA 1UR5A 5C9ZA 5B4TA 4YRTA 4TN5A 1EP3B 4OHPA 3ANTA 8ADHA 2H7CA 1NP3A 3CEPB 3E3MA 4UBKA 2A1TR 4JIMA 3P9SA 5E4JA 4B09A 2Y71A 1P4RA 4IJ6A 1XF9A 3QEBZ 2G83A 1P0IA 1RZVA 5FUMA 4YASA 2I3ZA 2WB4A 5LXTF 4PE5B 3LDFA 3ZXXA 4HPJB 5IP5A 1PQUA 1WHSB 3BXXA 2EJBA 4HBGA 4O6VA 4DEVA 5HOEA 2OKGA 4NU6A 4S0XA 1BW9A 4K9DA 5E3HA 4RHFA 3NTQA 2H3HA 1PGJA 2PO5A 1NXWA 2Q5QA 4I50A 1Q57A 3CT6A 1E9BA 4WCFC 3LHIA 1G66A 4FQ8A 4FT4A 1ZO8A 3MMXA 2IDMA 4HUJA 4J9UE 3CJQA 1CNEA 2GASA 1NBAA 3P9KA 5HP4A 4R8LA 3RF7A 2ZATA 5I8ZA 3MJFA 3R0VA 3GNTA 3VNSA 5K20A 5EZYB 4IIGA 4CM4B 2C3OA 4CUKA 3WGQA 2FWRA 1XZIA 3RVQA 1C0EA 2AW5A 4WCVA 4ZAXA 2RAVA 3KJIA 1KAMA 1XZ8A 3MTIA 3TZHA 1SJ9A 1C1XA 1TAQA 3F7TA 5ER9A 2FEPA 3ROTA 4HX9A 3DVAA 4PRLA 3UKDA 3WADA 4J16C 4N03A 4HPXB 5CM2Z 3V7FA 2FFJA 1ID8A 2BKVA 1NT4A 3VRHA 4LF5B 4RM3A 3ROZA 3DBOB 1W19A 3OT4A 4IJ5A 4INZA 1TK9A 3BGIA 5KJEA 4B3IA 1V25A 4NAHA 5CYGA 4IDQA 1IJKA 2ZREA 1ISGA 1RNLA 4MVJP 4WY5A 1FU4A 2JZCA 3KTAB 5DIFA 3OA0A 1R4NB 3ZD9A 1S8AA 1EFHA 5K51A 1YO6A 3GFSA 1DG3A 3AJ9A 4NV3A 3DO5A 3Q12A 1JIQA 1JLHA 1BWPA 1B0ZA 4C3ZA 1NJ2A 2WJGA 3BHMA 2DR0A 3JU3A 3TTUA 4FKMA 5GJBA 1HI9A 4GH5A 1E94E 2GK4A 2XAAA 4I9UA 4G0MA 4N49A 3TR6A 1AK1A 1Z74A 4FYKA 3MOSA 5KNCD 3LWNA 5KTSA 1YUMA 1U3GA 1EJBA 2QQ5A 1NMEA 2XA9A 3PRYA 5H1YA 1XCOA 2GYYA 2VHUA 4O63O 1HQKA 1NM5A 1SAYA 4JLVA 4MJLA 2FHSA 1KY5A 2HJVA 2ZI7A 3T5DA 5KNDD 1FFBA 3MPUA 2R97A 5E9AA 4XVUA 3KUUA 1RAEA 1CIPA 2NXWA 3GV0A 4Q7KA 3JZFA 4TXNA 1P5ZB 2IE0A 2PJDA 1PHRA 1KEKA 2PAFA 3EAGA 4HGOA 1K3FA 4RMNA 1SD2A 2PWZA 4C22A 3OQ6A 4EPRA 1UJ2A 4J6EA 1BKYA 4EHIA 3W8DA 3JSAA 5AFSA 3VH4A 1FK8A 1LDGA 3G2PA 1S2IA 2HTEA 4CM1A 1H69A 1GLNA 2QTVA 3L0SA 1U80A 3UAVA 3FM9A 5DGHA 5E6SA 2XOKD 3RU7A 3DPUA 1DRWA 4PHGA 2SNIE 4BNLA 1SQ6A 2LDBA 3GJQA 4MICA 4R2WA 1Y80A 3HKEB 1Z2NX 3QITA 3V7YA 3VO8A 5KVCA 3NYQA 3TPFA 2RHDA 3C1UA 4DWJA 1T2DA 1IOVA 4CN8A 2PMCA 3T3NA 3ZYZA 1LBHA 1JVSA 1REQB 2CY0A 4EJ0A 5AHWA 1VL0A 1V0JA 4NS1A 4FN5A 3CGGA 2GNPA 4LDQA 5GP1A 3FWKA 3I2JA 4P84A 4RAOA 5GMOA 4MDFA 1XHEA 3NHYA 3ZU6A 1J4AA 4UFOA 2J41A 1SIOA 4O25A 1WW3A 4CKEB 3OI7A 1KF0A 4LXXA 3CWQA 1KOLA 3G2JA 3CUYA 1YJXA 2CV1A 2BI7A 5J4VA 2XE7A 4GI5A 2IYAA 4LRSB 3TSCA 2ZRFA 5ITSA 5TF0A 5HBGA 5ULLA 3LRXA 4JXXA 1TJNA 1KORA 3N07A 2XMPA 4MJ7A 4ZT6A 5AR1A 1EUCA 3OCCA 4Q47A 2FPWA 3GJ5A 4GU5A 4NU5A 5AK4A 3OPVA 4X1IB 1PTJA 4OU5A 2D59A 5A71A 4H7EA 4HAUA 4E5NA 2HR1A 2VHVA 2UXDB 1JP7A 1A3CA 1NE2A 3P4UA 3IDAA 3WTBA 1NDUA 1PZFA 2O7NA 2OBYA 3PF8A 3WIOA 3CW2A 3VPHA 2ZS8A 2DCUA 4KMSA 4W7HA 5JD3A 5IT9A 3QX3A 1OROA 1RZUA 2G28A 3LUKA 3W78A 1BQEA 1E6WA 2AHOA 4OQLA 3BDVA 4H15A 1KXJA 2C0CA 2OHGA 4AKEA 5TEWA 1ZL2A 4L3VA 2DY0A 1XLVA 4BYMA 2NVUB 3DBLA 1ZK1A 4RWZA 3KSZO 1N6OA 3M1IA 4UHFA 5DM2A 1C41A 2QMHA 4KXXA 4LXUA 4A9AA 5D1NA 3PUKA 4BJ1A 2BP7B 4Q4JA 2XJ4A 1TCUA 2VDUE 3WMGA 5KVAA 1OTYA 3KSDO 4HTFA 4NG5A 2PYDA 3DNPA 3R7NA 1CRLA 3CT4A 3RVPA 3T12A 4R71A 4ZV4A 1R0SA 2V6FA 4QQ8A 1X74A 4MS3B 1TO2E 2HWWA 1ZI8A 5DIZA 3N8DA 1OZ0A 1YKGA 1F17A 1OXUA 1DXQA 2VPTA 3ZH2A 3MWFA 4DE5A 4DPMA 3HXOA 2E82A 2FSHA 1IVSA 1F8YA 3OTGA 2IEAA 4EHLA 1JB9A 2WJPA 3MBIA 2WG0A 3ONVA 4DAOA 1LV8A 3ESYA 1ZNQO 4L2IB 3DAFA 4BEJA 2WYVA 2ZTVA 1WDLA 2IZZA 5F3WB 1UJ4A 1UP7A 2EJUA 3I5AA 2CNDA 3DHWC 1XK6A 2QK4A 3LVBA 1NW8A 2CF6A 3Q3VA 1M8PA 4ZVLA 4DMMA 3FOBA 1R66A 3C6ZA 1JEAA 3L6OO 3R41A 3VZSA 3GHHA 5BSFA 1WLYA 1A76A 2I03A 5F1OA 1XMJA 3GVXA 1P3DA 3B3GA 3TLEA 3VHQA 3KO8A 4QBGB 5TPZD 1K7CA 1HZZA 1SKAA 2X8JA 3OVMA 5FI3A 2NTNA 4G81A 4BBPA 3IBSA 1UWLA 3RHTA 4LECA 3PD0A 4NOLA 4WZAA 2GA9A 4BMNA 2JGRA 1STOA 1UH5A 1VG0B 1TM4E 1NKTA 1CDZA 4Q3EA 3WLLA 4POAA 2ZRHA 2FEKA 4KMMA 1LJ8A 5K03A 3GIDA 3KEGA 1W48A 3IUBA 4PFQA 3SQXA 4GBJA 3I9MA 4YJ2A 3RVLA 1QMPA 2DT5A 3H9QA 1C1YA 2G07A 4P7GA 2VNAA 4P5EA 3P96A 2C83A 3ELBA 3ANNA 3DEYX 4FK8A 3GXBA 4IXWA 3RSGA 1NU6A 3NHMA 3WGTA 4QDZA 4W5QA 1PIWA 4M22A 1OBVA 4Q9LA 4KRGA 2IOQA 2SHKA 4ZCIA 1GQFA 3BCUA 5D3QA 4GR9A 3WG9A 2HV9A 3R75A 1R9GA 3SNHA 1CUYA 1I0ZA 4HP8A 1DTSA 1E3DA 1B7GO 2G9NA 2PGAA 4B74A 4BFZA 4HGNA 1CS4C 2W11A 1Q1QA 2JFQA 2WVAA 4BN4A 2MTBA 2WFLB 3JYOA 3AYXB 5F7OA 4B3FX 1YE3A 1RMTA 3Q9LA 3RQSA 1XQYA 3QF4A 4ZVKA 3WGUA 5CDGA 5GZ3A 4ON9A 2P3SA 2RK4A 3A3KA 1OV4A 5JATA 1N34B 2GAFA 3DHVA 4RTKA 1BS1A 3F97A 3PJDA 2Q49A 4GOLD 3S5UA 1NJ5A 2ZS9A 3IIEA 3Q3GE 2P2YA 2ZVQX 3ML1A 2GAJA 1YC2A 2E4ZA 3HVIA 2ZSEA 4KO4S 3RJ5A 4C0KA 4G1EB 1NI4B 3R7SA 4YAJA 4BP8A 1EQUA 2GLTA 3DZDA 3HI6A 3UENA 3PUXA 1RU3A 2GN8A 4CM8B 3KB1A 1NLMA 3QE3A 3Q8KA 2IKSA 4A36A 4FJ1A 1YAJA 2XDQB 3D81A 3EC1A 2VZEA 3ILSA 3KPVA 2V7QA 4QBKA 1SBCA 3RVMA 5KQSA 3QFFA 4A92A 2HA6A 4DXHA 3TW8B 3T34A 3THXB 3D6TB 3QEJA 5AM2A 1DAFA 4HOYA 5I7VA 2YMPA 1PZHA 3UXEA 1T5HX 1RAGA 2PUTA 4FCCA 4HN9A 2QQGA 4YV2A 3LLUA 2QDXA 1E1QA 4FGKA 4LFCB 4GYWA 2V03A 1IUPA 3FLAA 1NHWA 2DFTA 2ZRJA 2E1RA 4OBWA 3UCXA 1DC7A 3T06B 3RIHA 1NJGA 1C1DB 1FP4A 1JQKA 5ALIA 1I2ZA 2XQVA 1BEUB 2XQIA 2V6GA 3DTNA 3Q8WA 1XA4A 4NBKA 2RI1A 3GA5A 3M33A 2ZKIA 4GPD1 3PQ6A 4NU0A 2QE7D 3UHOA 1JXOA 4HB2A 2XZLA 4FS8A 5BW5A 2POCA 1Y89A 3MS7A 1WKVA 3I6ZA 1PT7A 3NI2A 1E6MA 4TZ0A 1EVQA 1KVQA 4PLGA 1XZCA 4CKBB 4YCCA 2ZIGA 4YUXA 3IXMA 2XCQA 3OP4A 5CLIA 5HFAA 3UT5A 1OLSA 2YDYA 5A04A 4FDUA 1BS2A 3BXFA 3IMGA 3TMKA 2DZDA 4L95C 2W83A 3FHOA 4EG7A 3O1JC 1Z8NA 4ZJYA 5JNUA 3ZKAA 1SIBE 3NVMB 1PWXA 3TUIC 3ZPXA 1V47A 4PPYA 3DF9A 1U2DA 1RHQA 3DMTA 3ZVLA 4YRDA 1P7ZA 2KWIA 1O03A 2IGBA 4JN6B 4RF2A 5CNJA 1BS9A 1W85B 1FYVA 3TWOA 3S8EA 1U0EA 4BRUA 2G1PA 1N3BA 1FFXA 3FUWA 1KU0A 3QRWA 4OHWA 3RDPA 3UK1A 3VSCA 2OORC 2J7PA 4J7UA 2O1EA 2Q50A 1Y81A 1QKKA 3ANXA 3C6XA 3GGOA 3CUEF 3DT8A 3ZS8A 1Y7TA 3LPCA 4RIHA 4A4DA 4KIJA 3VPXA 5EP4A 1OAKA 1SOUA 3BB1A 2PT9A 3KFVA 3CR7A 3K20A 5BYAA 3LFTA 4JKOA 4YS6A 4DNFA 1XZPA 2ZAOA 5ALZA 4CF7A 2XOKA 3G7SA 3OLQA 4WJZA 3W3AA 2Y68A 5DH9A 1XXLA 1J8MF 2BRUA 3USES 4E88A 2Q8QA 2O4UX 3AR6A 4ARUA 5A4JA 5JSFA 3HCFA 3RJTA 4CE6A 4PLTA 1B6SA 1O89A 4R5HA 3T0GA 3OUTA 4MAFA 2PXHA 2YV4A 4W8HA 2RJOA 4BGDA 5KYWA 2MSDB 1UBUS 2ZK7A 4HTAA 4UPDA 5ALOA 2XUIA 2Q3DA 3HL0A 5IDXA 1U7TA 2R7NA 2WUWE 2P2GA 2X0NA 2QE6A 4KSBA 4RD1A 1DOAA 2CLCX 2O2JA 2QTCA 3E23A 1QM5A 4IUYA 4ZT7A 2LKCA 1S1MA 3BGDA 1GNLA 1CC1S 2OTCA 4R6XA 4WPGA 4QTUB 4BMPB 3CLHA 3DZHA 4ZQGA 2I3BA 1E9DA 2QTLA 1F2UB 4QUAA 4LZLA 1S2DA 3NVAA 4MMYB 1O95A 1TO1E 2ECQA 1KETA 3GFBA 3L0DA 3KC2A 3R3ZA 1W0JD 4RE5A 1HMPA 4E1AA 1Z82A 2AOWA 1MD9A 2WJ3A 1O6CA 7ABPA 2N3ZA 2Q3FA 2XTZA 3FBGA 3IA2A 2ZAGA 3FFAA 1QLJA 1E2JA 4I3GA 2TMGA 2O5VA 4O4LB 3VHXB 4EJFA 1JHYA 4RTSA 4ID9A 5BV2P 2ERXA 4Q21A 1X39A 2A4MA 4U7HA 1P1IA 1UP4A 4GDMA 1Y37A 3DP7A 1SG9A 5BW4A 1GL9B 2DQYA 2PZFA 4QBFA 1D5WA 2CYCA 2BM0A 3VOSA 3BGVA 2AKYA 4M36A 3C5HA 2BTQA 2HN9A 3HJGA 3CZPA 4LBYA 4BPBA 5DLQC 1YB1A 2FXVA 1N9ZA 3KVYA 2XNSA 3CLTC 1N5OX 3CCFA 2BMWA 4HDKB 3DAPA 4JI2B 3GF4A 3WK6A 1XB2A 2ISCA 2XB6A 4LDRA 1G8GA 4DB2A 1GLVA 1ACMA 1PKXA 3EH1A 5KTMA 1GARA 1RI1A 1XR3A 3VKFA 3BKWA 3K0HA 1G20E 2OESA 2M6LA 3V8MA 4CEHA 1MOQA 1BVRA 1I9CA 2ECOA 3FJOA 1DEHA 1M1YE 4KGDA 3PS9A 3AW9A 1TA9A 3NXKA 4N6OA 2YINC 1Z8FA 1WZNA 3FNQA 4QO7A 3ZNQA 4HDNA 3RASA 4EA8A 5CAEA 1T24A 3DOFA 3NNSA 4B2PA 1GGVA 2ZLBA 4CLOB 2XAUA 4QOJA 3LQYA 2DLCX 3KJFA 1OWPA 4LDNA 4AM8A 1R6AA 2SCUA 1X9GA 4CQMD 1M66A 1YRAA 4U7FA 3QYAA 3W7VA 4PGGA 3OLZA 1SXJD 1GPBA 4QJIA 1X80A 1DIBA 4HVCA 2AR9A 5AW4A 3ZOZA 1V8PA 4B75A 221PA 2HHLA 3U37A 4Q1VA 2PL1A 2AG0A 2DF8A 4ALMA 2H2FA 2AF4C 3TZQA 5DDIP 5DM60 1NPTO 5C8VA 4DM4A 4NPCA 2IELA 2VZ0A 4NHOA 4WFQA 1L8QA 3H0KA 5AKJA 1G5QA 1H4TA 1NNUA 4QQRA 4C0JA 2DJ5A 1ZJ6A 2X8AA 3U4QB 1KRXA 2WT8A 4CL2A 3OE4A 1IAVA 4MGZR 3W4JA 1M34B 5HKAA 3LFHA 4LF7B 3A9WA 1MAUA 3DEIA 1PV2A 3EY4A 2FEOA 4HK4A 1YF3A 2MU1A 3TZBA 4AY2A 2Z09A 1I5EA 1OFTA 3KHSA 4FYVA 4FYYA 5CR9A 4R83A 1Q0UA 3KR9A 4KYIB 4OJTA 2JJ8A 3ELUA 2AE2A 3WYNA 3Q0TA 3VMMA 4YMIA 4BWYA 1F0KA 3QOWA 5T3YA 4BNZA 3JWJA 1YVPA 1U2PA 2Z3WA 3IJPA 4TT8A 5AH0A 2ZB2A 5JBNA 2E5FA 4YRJA 2J5BA 3PDHA 4F4DA 1H1DA 3JQQA 1D4FA 3QBTA 5B36A 4MK4A 2OCLA 2WJZB 1GYRA 4HH0A 5CDFE 2ZQ5A 3B89A 3VYRB 1PR2A 1RLOA 1T9KA 4O2BF 2IYZA 2O07A 1Q16A 5U1PA 2DBRA 5AKIA 3DA8A 3H19A 2WF9A 5A0TA 1MAVA 4MGKR 4C7OA 2NXNA 2X14A 3QP9A 2OB1A 3HKDA 3VYSB 1ULUA 1P2BA 1RXUA 3I5UA 2G4VA 4MUBA 3TO5A 5AOCA 1DQZA 5KO2A 3IHLA 4QEZA 3FSGD 3RTCA 2AEJA 1AKYA 2QJWA 3O92A 3R6GA 2E9SA 3R9XB 1O94C 1HYGA 3EBOA 2A4KA 1Z8HA 4E70A 2VR1A 2WM9B 3MMZA 1I7DA 2QG9A 2GYWA 5CFZA 1E1CA 1FQKA 2F9MA 4KQKA 3TJZA 4R1QA 2R66A 2PAAA 2O0LA 4I99A 4JJFA 4RD2A 5E9WA 4ZVNA 4ATNA 4ITRC 4OYHA 3QEMB 1E69A 2GPNA 2QDKA 2IV7A 1Z4QA 2UYYA 2OM2A 3L8MA 4BNJA 4DIMA 2GERA 3HDJA 3WWEA 1U8FO 2CFCA 3GPCA 2GDJA 4NABA 4DSTA 3HZZA 2PKQO 1MW9X 1QVAA 3KLOA 2M6RA 4JP5A 5IUKC 4UM7A 3ZI4A 5LJLA 1M0EA 1E5TA 5CFQA 3C7AA 2I2DA 2N1BA 2OT3B 3PHCA 4E0BA 2PM8A 2ZTHA 1Z22A 4ZQIA 1NSFA 2FQQA 1XPOA 1SPBS 1Z6AA 2Q0QA 3AUFA 4BO0A 4A91A 5E2AA 3L77A 4IEFB 3ZCRA 1WUYA 1HSZA 2ADMA 1SKMA 3FCAA 3LECA 2DFDA 1YMQA 4BNIA 4F04A 5AP9A 1H94A 1KIAA 1P2FA 1SKUA 2BFDB 2NYUA 2P9YA 2VHEA 3CH4B 2XE4A 3IVGA 1TZBA 4HLUA 5K0BA 5L4NA 3GLFE 2XD9A 1QH1A 1UF9A 2Y05A 3BILA 3OT5A 3A3YA 1Y8RB 3OE1A 3TNLA 3EXG2 3AIOA 4FGZA 4I5EA 1F3LA 4X6LA 4OF4A 5I4BA 3F4LA 5J5AA 4GPTA 3QX7A 4AP9A 4BO6A 5A9RA 2V7EA 1AX9A 2C2WA 1XQXA 2HX1A 5LN1A 3RSOA 2AC2A 3WSWA 1GAEO 1VJRA 4NZMA 5EQTA 4PYRA 3FB4A 4AQDA 3B1ZA 4EFLA 3EWAA 1GTL1 4UUOA 3RUAA 3E27A 2Q0SA 2G4CA 3FSGA 4I5GA 3SMVA 3CR3C 2EZUA 2NV6A 1NVGA 1XRJA 2YN2A 1P0QA 2FMXA 3ETDA 3M8KA 4FOOA 3V8PA 3T3OA 5T7BA 1T0UA 1J9ZA 2QL5A 4OGKA 3IP6A 2ZRDA 1CJKC 1SXHA 3LF2A 4QE3A 5DP1A 5HKKA 4NLLA 2CUTA 2CZGA 2EKPA 4OI4A 3GEIA 3F5QA 2V7PA 1LC3A 4WDQA 2O59A 3BE8A 1LQUA 3GUHA 3ABSB 1HK7A 3SHVA 1P91A 1BAPA 2AUMA 3WA7A 1ADCA 4BB6A 3WLAA 2CSXA 4D25A 4IL5A 4HX2A 2CV0A 4J43A 2VLIA 1DQPA 4H7HA 3LPDA 2C59A 1MTOA 5D87A 4AULA 2XYPA 2IEIA 4UEOA 1ZD5A 4MUHA 3L9XA 2JFFA 3GRVA 3WRYC 3WNZA 1LFAA 4W63A 2BOVA 5AI5A 3NATA 3WZMA 4JJKA 4F6LA 3BXGA 2JGIA 2N75A 3PGXA 2CVHA 4MWDA 3MUOA 5IBPA 4BGVA 3CZ9A 1I8TA 4UKDA 3ITNA 4CODB 5KJ6A 3HWX1 3IAS6 4G26A 5EJGA 5JIBA 4PLVA 3X1XA 1JQ5A 4XQEA 4D56A 4YMLA 5IT5A 2FR0A 2B25A 2PJRA 1RCUA 3L82B 1YBAA 1SKBA 3I28A 1F5SA 3DOJA 3GOQA 1OH6A 1PJAA 5H5JA 1I7QB 2HYDA 4RVOA 1TM5E 2PKCA 4DMHA 3MELA 3ZHYA 2UXCB 4TV9F 2VYQA 2Q6KA 4F8EA 4OCZA 1NJ8A 1R0CA 2ILTA 2HGSA 3T1OA 4Z51A 4WAUA 3L93A 1M10A 3MTQA 4DY4A 4IWXA 2ORWA 2PD4A 1N4DA 3IVMA 4HS4A 4J8PA 4DC9A 3WDKA 3DW1X 1GL7A 3PC8C 2NU7A 1L2TA 3D1LA 3O95A 4PCUA 4TTSA 3TIFA 2FN8A 1GKIA 4MV4A 3SFZA 1GPNA 3ZWNA 3ZOKA 1S0UA 1TJPB 2I22A 4HI0E 1H2WA 1JR3D 3E7XA 3ESZA 1PL7A 4MW4A 5DWDA 4Z54A 2Y1EA 4CPDA 2X77A 1DO0A 2XUGA 5BR4A 3HCOA 1PEYA 4NQRA 1Y3IA 3FHLA 1OVMA 3F6SA 2IXTA 4IR7A 5AHRA 2HDHA 4P8RA 4UMVA 4A8JB 3LXMA 3GP5A 2JGKA 2GAOA 3SQDA 3SS7X 3OJWA 4Y0NA 1JJBA 4KLNA 4KAFA 4O1MA 3QJ5A 1Y3CE 2XT6A 4U2CA 3VSDA 1DELA 4NH4A 4GX2A 1E6CA 3M1YA 4EVSA 3G0HA 2QZSA 4GNRA 1JAZA 3Q7EA 3QFSA 4ZTUB 2QN7A 2XXJA 3R5TA 4JOBA 2GCGA 4QLAA 4UTOA 1JSRA 4RJLA 4YQZA 1AXEA 5AO9A 1NQWA 4BQEA 1M34E 3TW0A 3DOCA 4XIGS 3EDMA 1Y4SA 4U7PB 1ZFNA 3X1KA 1SXJA 2FPIA 4YHHB 1VGQA 4L4XA 1AV7A 3HU3A 5G3YA 1HQYE 3SX2A 1Y7IA 3PHJA 3QUQA 4QTTB 2M2IA 1DG1G 4C4XA 2Y0CA 1JDVA 4JLSA 4F4UA 3W5JA 1ZAYA 1O94D 5LNK6 4JH0A 1IG3A 5BSVA 1IN6A 1QKJA 5I7OA 2BUBA 3WBJA 3GAFA 4CJXA 1W2WB 2XTNA 1VYTA 4ILKA 5LP6C 1UM8A 4JUFA 3KU1A 2X13A 4KQMA 2GX6A 2JJQA 3DO6A 1EUZA 4Q37A 4UFNA 5A7FA 1I6MA 2ZRNA 1UAAA 3L0BA 3QEMA 4G0OA 4JT4A 4KLCA 1RKXA 4TT3D 1M1XB 1R0BA 3BRQA 3VU0A 5C1BA 4TVKA 1CY2A 3VR4D 5AJYA 5D84A 2WIKA 3GLIA 1A8PA 1MB9A 5TIIA 4QG3A 4G0VA 2WDPA 2X8BA 4DA6A 2C07A 5I5EA 1ZK4A 4K9PA 2UXBB 1SZJG 3RHFA 3ZWMA 2I7CA 1Y7HA 4BO7A 2REBA 2JFOA 3EPKA 2P65A 3V1LA 3OJLA 1P77A 3QKWA 1XV5A 4HC4A 4P81A 3AUAA 5TJ9A 4QVKA 2ORIA 2B0JA 3A6EA 3OU6A 1RRPA 2B21A 3KALA 5IARA 2CDNA 1IEQA 4J3NA 3BT7A 3AHEA 1DB3A 2CN1A 4KE7A 4KYTA 1QRUA 2FK7A 1T5LA 1O0SA 2IPAB 3LL7A 3EAQA 3ZUPA 3G7UA 4RVSA 1QH1B 2H48A 1GKLA 2CL5A 1YL5A 5C8DA 4N48A 4NMXB 4UNNA 3FTQA 3D8NA 3OZIA 1MBZA 2R60A 2M6SA 3LT4A 2W6NA 2A94A 3BSYA 3U4CA 4GEKA 5T5QA 3VGJA 3OEHA 2VRCA 1PFVA 1LV7A 5D01A 4YR7A 3HTXA 3B52X 3ODPA 1W6UA 5JAQA 5K3OA 2GN1A 4X8HA 4EH1A 1N2EA 4IMIB 2GO1A 2ZPTX 1VZ2A 4FW9A 3KKPA 2ZWAA 1TIBA 1DKPA 2ZRGA 3COZA 5HS6A 1BMFD 1PK9A 4GBMA 4K81B 1NUPA 5AESA 2BDEA 3QLEA 5ALUA 3HL4A 1VQ1A 4HJXA 1KO8A 3CPEA 5A9SA 3MK31 4M46A 1ZS9A 1IXZA 1N8TA 1NDQA 3JQPA 3LXUX 4GWGA 3KB2A 2VQ3A 1V5FA 2CDBA 4ZOBA 5BVHA 2XGJA 1JEEA 3ZTWA 4OI0A 1EWQA 3FMPB 2IYXA 3K6JA 3OX3A 5JBQA 3OURA 4A8TA 1XZKA 3GY0A 1RZ3A 1SVMA 3WIUA 1MQ8B 2QT0A 1C7JA 4WLNA 1B8OA 1O5OA 3BWVA 1L7PA 7REQB 4KXNA 1RYMA 4WKOA 2IHBA 3C2QA 2VDWB 4CR7A 3DLPX 2QRHA 2GJ8A 3NNNA 1J8DA 2J9FA 5JY6A 1J8QA 5F2EA 4GG1A 4ZZ1A 5J43A 5LIPA 4O2BB 4HR7A 1XNJA 4GXTA 1IEXA 4WLEA 3UJ7A 4H7IA 4DXAA 3BZUA 5AKLA 1LJUA 3ELWA 2X76A 4O2RA 2Y1GA 1K86A 2OBFA 1W0JA 4ND4A 4QPPA 1YDHA 2Q6OA 3TRFA 2SBTA 1KFKB 2X1MA 1ACJA 4PHCA 3OM8A 4EG4A 3HLTA 4YLGA 1UKVY 1LPPA 3ENNA 2XMBA 4FI3C 1SC4A 4FHEA 1E58A 2A59A 2GNOA 2HLDA 3IH5A 4IDFA 5AJVB 4YRSA 2QRNA 4GC5A 1BFDA 3OPNA 1E2IA 3JY6A 3NORA 4UHKA 2ZBPA 3EGVA 4XYBA 3RC9A 3AP3A 3HB1A 4V0SA 1OLUB 2PDAA 4YFVA 2GLXA 5JQGF 3O9ZA 4BXOA 3FZGA 3JV7A 5HCNA 1JLKA 4ZOLA 2UVDA 3DJYA 3DZCA 3ZBUA 4EOGA 2X19A 2B34A 1O9BA 2HSEA 1N6PA 1QFYA 4J0CA 4PGHA 1ZKMA 3OZEA 2EW1A 3IOCA 4MWTA 5IDVA 1FNMA 3RUPA 4E09A 4PN7A 1LY1A 2YWBA 4JP1A 3U17A 2Q2VA 2FUG1 4H6WA 3OIFA 1N8NA 4FBGA 2ICAA 3MAAC 3ELDA 2E21A 1C9JA 4U0KA 2QPTA 3L0OA 3ER8A 4WBSA 4HX5A 4WSOA 1SBIA 4KQWA 1FEZA 2HKIA 1WCWA 3RCBA 4RXTA 4GUAA 1SRQA 1YR1A 2P68A 3NTLA 4MR7B 4NI5A 4HYTA 5T4BA 1AUVA 3S7ZA 3NYRA 3DPSA 4KXYA 3B60A 4XD2A 1NBIA 1BE0A 3MMPA 3B1YA 4PC7A 3CPJB 2MMCA 4M0LA 1JQBA 3KBOA 1T6BY 4URUR 1IPFA 1PNVA 2B5OA 3R9KA 3RUCA 1XF1A 3IBYA 1XVVA 1ZUIA 3T3EA 3ZZTA 1YDMA 1DQSA 5LR6A 2J5XA 2XNCA 2NUTA 3ACDA 5CFPA 3H8JA 2I8CA 4HHEA 3WLEA 1MEOA 2KI5A 2QJTA 2XUHA 3DV2A 3IE2A 2D4AA 3MERA 2GDZA 4EPYA 3MZ0A 4CI9A 2IEGA 3H6GA 2BHTA 2IRWA 4RANA 5FHRA 5CB4B 3AEQA 1SQSA 1TTQB 4Q3BA 1QOZA 4RLHA 1FJXA 1SEVA 2P1DA 2W6IA 4Y6PA 2JVKA 2JG3A 4XX0A 3PNOA 3U40A 1USUA 2QZZA 3SZLA 3WS7A 1T2NA 1ADYA 4AZTA 2IEZA 4CCAA 5I9IA 3C3XA 3F96A 4OHMA 5HPYB 1FP1D 2EG9A 1Z2CA 1FVHA 3D2LA 3TW4A 3ASUA 3STXA 3WQQA 4OU4A 3S1SA 1IIBA 2ZE7A 1CY6A 2HUPA 4Y67A 1J49A 2VHWA 1AQNA 1NQTA 2HJWA 2Q46A 4NMMA 1RKQA 5GIOE 5DHRA 2GBPA 5H3LA 1COWA 1U0NA 3LZ6A 1PGQA 3LUDA 2ID9A 5A3VA 1VECA 3I9KA 3M7IA 3ONEA 4DQUA 4BCCA 2EJWA 2HF8A 1Y9ZA 1UEIA 2I6GA 2V4MA 3L01A 3L6DA 4KP7A 4AJEA 4EB6A 2O3RA 3D6JA 3FYUC 1E60A 2IT1A 1ORHA 3OEWA 1B15A 4WN9A 4YJKA 3SXPA 3WGYA 4E1BA 1ULTA 4BV2A 4LF9B 4X60A 2WE7A 1J5EB 2XYGA 3KZKA 4P7BA 3KELA 1KMMA 1TYBE 4GQAA 2JIPA 3HXLA 1MC5A 1SR8A 5C1PA 1P39A 1EESA 1V5WA 3FVVA 3CPHA 4YRGA 5DX8A 2OO7A 3PYMA 1IEWA 4TL9A 3X1ZA 5KYYA 1TD9A 1EXVA 3HV2A 2B20A 3VTKA 2FOLA 4AMVA 2B0CA 2BVNA 4BV9A 3QOXA 4XIFA 3VYTB 4L02A 3TQQA 2I4LA 4U5XA 5D6NA 3UTCA 3I3OA 5KAMA 1ZRSA 2B9VA 3SKVA 5EGNA 4YYZA 5AVYA 3EXFB 4Q19A 3B5EA 3AF6A 2XZDA 3V2IA 3EIFA 1QX3A 1UBNA 3CLUC 4FWIB 1XTPA 2W2QA 1G21A 2C1EA 5BRAA 5BR8B 3DWGA 3V2GA 4LNAA 2Q2QA 3KEOA 4RPCA 3GI1A 3ENQA 2PSHA 4UBJA 3ZWKA 4YUYA 4DR7B 1FLNA 4RD0A 4EGAA 3ZHTA 4IBOA 5L95A 4WOCA 5E1OA 1FDRA 4FCWA 4RJIA 2D5LA 5KSZA 2I2CA 5IMBA 4EMSA 4NWIA 2X3UA 4NCAA 3L04A 1FFSA 3P20A 1W4BA 1NZJA 1PVDA 3ESDA 2IY7A 4JT9A 5EPUA 4IFTA 1Y1PA 5JS8A 4D81A 1QHFA 4JXZA 1DS6A 2C97A 2WIJA 2J85A 3O73A 1M1NA 3IVXA 1N2OA 2C8KA 2XF8A 4ZEXA 4QU5A 4MKIA 2RGYA 3FPEA 1Q83A 4DR1B 2AI2A 2HWUA 3S4YA 3TIGA 1EUDA 4JBLA 3RBAA 2J08A 4I1UA 2G06A 3IB6A 2YOGA 1BXZA 4DZZA 4ITVA 4CG1A 2ZB7A 3V8EA 4EJMA 1GUYA 3Q7IA 3RVDA 3ZWOA 5CT8A 3WNCA 3K6RA 4FDTA 4TLMB 4AK9A 5JNLA 2JAPA 1YI0A 2R8PA 5B37A 1MQ9A 3SNKA 2XDWA 4AO7A 4FTWA 3T9CA 2QX9A 2X2EA 2BT4A 2VJNA 2ZWVA 3M9XA 1Q7EA 4ABYA 1E89A 4BEWA 1OGYA 4X61A 4YQEA 1KZHA 2WAAA 1P1RA 1I1OA 3Q8MA 2ZUTA 4MVWA 4UFPA 5GGYA 1IG0A 3A32A 1P6XA 1XXHE 1PJLA 4F4IA 2PH7A 3IX7A 4PZEA 1VCOA 2NSJA 3FYHA 3RK1A 3LLSA 2GXSA 4AIRA 3OZCA 2GPAA 3M2TA 4ZOCA 4LAFA 5HE8A 1ZNWA 2V7TA 2VN8A 3H7AA 4LQLA 3VDQA 1WB5A 1A4IA 1PEDA 3G7NA 3L7CA 5EUMA 3VR2D 4AX4A 4YCMA 4TLBA 3RUFA 2PS9A 4HDOB 2BEWA 4EY6A 3ZV5A 1EK0A 2JJYA 3QENA 4TVSA 3HCAA 4HQLA 1BWSA 3IP9A 4MKRA 1IULA 3CV3A 3IHTA 3QQ5A 4FZRA 3L0ZA 4YMSA 5B6PA 2PRYA 5EP2A 3S28A 3NHKA 5C2JB 5C5IA 2IYWA 3F8SA 4KEAA 3HN6A 2YV5A 1WDKA 3QFHA 4MX8A 5FHQA 2ES4A 4DLAA 1TUGA 4LYDA 4BQOA 1KAEA 2HHCA 3NG1A 3U80A 2ANBA 2GN9A 3FHJA 4ME6A 2CDRA 4EGJA 2QV0A 2RARA 3O3CA 1VBMA 5K2MA 3OQHA 3ONNA 3JZAA 5J5CA 2OQRA 4CMAA 5G53C 1WB6A 2PL3A 2D06A 2XQJA 3VZPA 2JIBA 2Z83A 3HB9A 4BV3A 4F5YA 4MR8A 1OJLA 5AW5A 1CYEA 4IXMA 2GD0A 3EWSA 1OYWA 3INRA 1ABBA 5FWDA 1Y8ZA 4GYYA 5C8YB