3MWIU

The complex crystal structure of urokianse and 5-nitro-1h-indole-2-amidine
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The complex crystal Structure of Urokianse and 5-nitro-1H-indole-2-amidine
rcsb
molecule keywords Urokinase-type plasminogen activator
molecule tags Hydrolase
source organism Homo sapiens
total genus 55
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mwiU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mwiU01
2NU0E 1DUAA 5L30H 1FY8E 2M5TA 1YPMH 4CH2B 1FY1A 2JETC 2ZGJA 5E2OA 5DP3A 2NU1E 3TNTA 1CBWC 2FP7B 4WXVA 3EDXB 3QWCH 1AN1E 3EYDA 2HNTF 1Q2WA 3PWCA 1A7SA 5A0BA 1SHHB 3RXSA 3TH4H 3V7TA 2Y5HA 2FM2A 5HM2A 1KIGH 1WTGH 1AKSA 3PWBA 1C1SA 2BD7A 2VVVA 1EJNA 4NWLA 4FUIA 1C4U2 2BVXH 4H6TA 1HUTH 1ZJDA 1GHZA 4A6LA 2A4QA 1HIAA 2ESTE 1O2MA 2ZKSA 1JXPA 2VH0A 1GBJA 1PQAA 1F5KU 3S9CA 2UUKB 2ZPQA 2FOGA 1O3EA 1MTVA 2QXJA 2F83A 1QRZA 2PR3A 2SGAA 3U8TH 1OYQA 1DY9A 1QL8A 5FX5A 3UUZA 2H5CA 1O2TA 2BHGA 5DG6A 1HB0B 3SJKA 1GVLA 2R2MB 1GJ8B 4AX9H 1EATA 1NT1A 1IQIA 3GCOA 2XC4A 3SNBA 3DT0H 4IBLH 1SGCA 1P12E 3DHKH 4CRBA 4K1TA 1V2ST 1ELVA 2W7UA 3LJJA 4LXBH 5JPMH 1LPGB 2FOEA 3RXLA 1BBRE 2OXSA 4DOQA 1MTWA 3EGKH 3MO6A 1K1NA 3F9EA 1P2MA 1PPCE 5JB9S 4WMFA 1OKXA 1XUJA 5EU8A 1GL0E 2GD4B 2D8WA 1KTSB 4A1VA 1MU6B 1YBWA 1P02A 5GJ4B 2BDGA 2A32A 4BAQB 2BLWA 3TJUA 1MD8A 3KQBA 3KN2A 1CVWH 2AH4X 1T31A 1BRAA 1Z7KA 2CGAA 2ZZUH 3UWJH 1CA8B 1F5LA 5EQQA 2W7SA 2ZCKP 1SGRE 4JYUH 2GZ7A 1LVOA 1X7AC 3M5LA 2OC8A 1MQ6A 8GCHG 1LKBA 2SGQE 2ZI2H 1ZLRA 2YNBA 2ZHWH 4Y8ZA 1AQ7A 1C5WB 2FMJA 3RP2A 1MAXA 2IN2A 1K1LA 2EI6A 1P2NA 3SJ8A 1K1OA 1KSNA 3M37A 1MKWK 1V2PT 2ULLA 5CE1A 2A4OA 4X2YA 1T4UH 5K0HA 1A4WH 1K1PA 4CBOA 1EZUC 4ABEA 1HJ9A 1LO6A 4O03A 2J38A 4NGAH 1QRWA 2BDHA 3BEIB 3HPTB 1KYNA 1O2UA 1GBKA 4CRAA 5DP5A 1DS2E 1C2JA 1C5OH 1XUGA 3BEUA 3Q00A 1BJUA 3RMOH 1GI6A 3GCTF 1C1OA 1TNKA 1N8OC 3MU4A 2WPJS 4NA7A 2O8MA 1CSOE 4KGAA 1PYTC 3RUOA 3R0FA 4Q80A 4DT7B 1FY4A 4R8TB 1BA8B 3VGCC 1Z71A 1XKAC 1YPGH 3UIRA 3URCA 4UFFH 2FX6A 3ELAH 1HAGE 3ODFA 4BOHA 2RG3A 4OS5A 1O3NA 5B6OA 1QY6A 3SUDA 1L0ZA 1HLTH 4KTSA 3S9AA 4R0IA 3MH7A 2PTCE 2C4FH 2G51A 1ELTA 4JK5A 5JBBS 2ZDVH 4ABFA 4MVNA 5F03A 1ELFA 4KTCA 5L6NH 1VJ9U 3Q3YA 1B5GH 2FO9A 1GL1A 1O2ZA 2PSXA 1YM0A 4F49A 1HYLA 1T8LA 3UR9A 3UOPA 5J4QA 4Y76A 5EQSA 1O2SA 1GBCA 4MPVA 1IQEA 1KLJH 1GI8B 1G3EA 3DA9B 1C2DA 1GHAG 4KKDA 1TNIA 1MCTA 2NWNA 4TWYA 2ANYA 3UWIA 3A84A 1V6DA 3LOXA 1OX1A 5C5NA 3E90B 2PWXA 1YPJH 1UVOA 5E0HA 4FUJA 5T6FA 1YPKH 1SLXB 3O8BA 2PSYA 3RXCA 4GVUA 4X1NU 4YOJA 4JK6A 4O3UA 1G9IE 3V3MA 4A1TA 1UK4A 4NG9H 5FPSA 3H7TA 3RLYH 2HWLB 3TITA 3NK8A 3SUEA 1MCVA 2QA9E 1SGDE 1ZPZA 1TIOA 2BY5X 1YLCA 2UUJB 2B8OH 1ZSJA 1CT0E 1DSTA 5TCCA 2BDCA 4YESB 1GDNA 1V2VT 4MPXA 1IQHA 1C5VA 3QZRA 3H7OA 1L1NA 5EPNA 1AUJA 3RMMH 1A0JA 3HKJB 3NZIA 1EZSC 1EB1H 3UPEA 3ZZ9A 4ZAEA 1SG8B 4I8HA 3ZZAA 3PMAB 2W3KA 1HV7A 4ZHMU 1GGDC 5F8XA 4BTIB 1GPZA 4XOJA 5EPYA 3GY4A 3MWIU 1MKXH 1UVSH 2UWLA 1N6YA 3MNXA 1TB6H 2FOFA 5GWZA 1VCQA 4BAOB 1EPTB 2ZFFH 3EE0B 4NA8A 3PV4A 1AWHB 2BDAA 1O3LA 3P8FA 2KAIA 3SHCH 5AF9H 1D6WA 2G55A 4MNXA 5L2YH 2BTCE 2GZ9A 1ZR0A 1QJ6B 1QURH 3ATMA 1MD7A 2Q1JA 4QT8C 2IOTA 2NU3E 1LHFH 1DWDH 1GCTC 3CENA 4NZLA 1UHBB 1BTHH 2W26A 2F9OA 3RU4D 2LPRA 1EUFA 3SI4H 2H9EH 1GHXH 2WPHS 2YOLA 1TX6A 3MNCA 3RXRA 1FPCH 2ZG0H 4AOQA 2BLVA 3GY2A 2ZDMA 1S6HA 1IAUA 3RXBA 3S69A 5DKMA 1Y3WA 1HFDA 4FUEA 4NA9H 1CGHA 1GWAA 1OP8A 1ANBA 1IQJA 1TGNA 5TCAA 2FYQA 3R3GB 5ESTE 1MBMA 4KELA 3RXEA 1ZMLA 5DP6A 3SQEE 2C3SA 5AFYH 4X0WU 1TA2A 5L2ZH 3SGAE 4U30A 4NFFA 4MPUA 3LJOA 4NIVA 2XNIA 1F7ZA 1O5GH 2PUQH 3SNEA 2QYIA 1GG6B 2C8XB 4AG2A 1Z8GA 5G4BA 4WY3A 5C5OA 3UOUA 3ZVGA 1BMNH 1EAIA 3LONA 5FPYA 1GI1A 2WUBA 7ESTE 1JOUB 3HK3B 1DPOA 3OSYA 2A4GA 1QR3E 1GBLA 1AVXA 2BB4A 5F6MA 1RIWB 1Z8JB 4FVDA 3SU2A 1HJAB 3IWMA 2PGQB 1TMUH 4UD9H 3SW2B 1SGFA 5JB8S 1GI3A 3RMLH 1T4VH 3ZZ4A 2BD9A 1EX3A 3TH3H 1HAPH 1C5QA 2CF9H 1JMOH 1FQ3A 2BY9X 2SFAA 2PKSC 3GY3A 3MOCA 1YPEH 1B0FA 2ODPA 1NRNH 4OS6A 1HXEH 3FP6E 4ZHLU 1EJMA 2Z7FE 1V2WT 3BF6H 4J1YA 2Q6FA 3FP7E 4ZKSU 4K8BA 1FMGA 1ZMNA 3A8CA 3GOVB 3TIUA 1IQLA 1AO5A 1C1TA 2OLGA 2AGGX 4NSYA 2ANKH 3M61U 1CGIE 1FAXA 1O3CA 3SJIA 3S0NA 1DLEA 5EXMA 1LQDB 3QN7A 1DT2A 1GG6C 2PKAA 4D8NA 2ZTZA 4XBDA 6GCHF 3OY5U 4FU7A 1ARBA 1ZSKA 3P8GA 1P2OA 4B73A 2XCNA 1UK2A 2VIOA 2FYRA 2ZHQH 1P04A 1TLDA 2HALA 4FUGA 2B5TB 1TPSA 2XWAA 1O35A 1RIWC 2QC2A 2XWBI 4XSKU 4A1XA 3HGPA 1HJAC 3T5FH 3K65B 1NY22 3NPSA 3U1JB 2DUCA 1D3PB 1A5HA 5SGAE 4UFEH 1P9SA 4AB8A 2ZNKH 1IQGA 3FANA 1SSXA 1UCYK 5HGGA 1AY6H 3HGNA 1Y3YA 4X6NA 3M5OA 1QL9A 2OC0A 2QCYA 1CHOG 1ELEE 3SUGA 4NFEA 1ACBE 2A5IA 3SU4A 1EXFA 2VIVA 2ILNA 2Y80A 1GVZA 3PM3A 1TGSZ 1C1UH 3CP7A 1TALA 1G37A 5ABWA 1C9TA 1AWFH 2AS9A 1KDQA 5GCHF 3F9FA 4ZKRU 3M3TA 3TGJE 2Z3CA 3LGIA 2ZP0H 1K28D 1UTQA 4I8GA 1Y59T 4X2WA 2A4RA 3SNCA 2WYGA 3P17H 2OD3B 2TIOA 3O8DA 2LNCA 2FDAA 2BD2A 4H42U 3LGYA 4XBCA 3S7KB 3GY7A 4CR9A 1JIMA 1G3BA 1GMDG 1V2RT 4WMDA 1TMBH 3U8OH 4YT6H 3KNXA 1TPAE 1MAYA 4Y6DA 1L4DA 1AE5A 1V2KT 2FTLE 1PPFE 2GT8A 3P6ZB 2FOCA 1TQ0B 1Y3XA 2P59A 1C5PA 1S85A 4Y8YA 4B2BA 2CN0H 3VXFH 1GJ5H 3SQHE 1C1NA 1AB9B 2R2WU 1XXFA 1ARCA 2ZDKA 4OGXA 4U32A 3SV6A 1GMCF 2BXUH 1GHBF 1S83A 1TABE 3T27A 1HAOH 1J14A 1MH0A 1DFPA 1MUEB 1PPGE 1SOZA 1Y5AT 1CU1A 1FY3A 1AE8H 3QUMP 4X1PU 1EQ9A 1WTHD 3K6ZA 2CV3A 5F8TA 4YM9A 1AMHA 5FXLA 1V2UT 1Y3VA 1P0SH 1DY8A 1TA6A 2BDIA 1HDTH 1NRRH 3URDA 3WY8A 1G3DA 3BG4B 1H9HE 1QCPA 4CREA 1DWBH 3LPRA 1O2LA 2H6MA 3F68H 1S5SA 1T8NA 3TGKE 2ZFPH 3MNSA 1AB9C 2GT7A 3ZVBA 1S6FA 1G30B 2HPPH 1H8IH 1GDUA 1A61H 3MNBA 5CMXH 1AHTH 1O34A 2ZA5A 2ZHFH 3DFJA 5FAHA 3SZNA 2G00A 3HATH 3JZ1B 1UVUH 3KQCA 2AFQB 4LZ4B 3SO3A 1ETRH 3EA9A 2JKHA 1TQ7B 1MTNC 1PPEE 1OWIA 2VIDA 3MO3A 4JYVH 4UE7H 4LK4A 3F9HA 2UUFB 1SGFG 1LCYA 3OX7U 2CXVA 2ZDLA 4JCNA 1DICA 3BG4C 5HYOA 3GCHC 3T25A 4NSVA 2EI8A 4B76A 1UTPA 1WUNH 3DD2H 9LPRA 1YLDA 1MKWH 1OWKA 3GY6A 4OS7A 1BITA 3SORA 2VB0A 1P01A 1D4PB 3BTTE 3GCNA 3V0XA 4MNYA 4K3JA 3E16B 4Y79A 2FS8A 4NZQA 4O97A 5EOKA 4X1RU 3D65E 1RD3B 1XKBC 5T3HA 3GY8A 1LHCH 1UVTH 1SQAA 1CT2E 2ZPRA 1O33A 1HRTH 1O3HA 4Z6AH 1LHDH 5C1YA 4AB9A 1CO7E 2ASUB 2AMQA 1XUIA 5C20A 3E1XB 2H9TH 4MQAA 3UFAA 4NIXA 1TWXB 3OU0A 2R0KA 2PTNA 4O3TA 2G5NA 1Y8TA 4OS1A 2WUCA 3C1KA 7KMEH 4GUXA 2Q6GA 3A7XA 1F0RA 1SVPA 4A7IB 1TX8A 1TFXA 4YLQH 3L33A 3RXHA 1C2GA 1AZZA 1QBNA 2J94A 3UNQA 2Z6BD 3LKWA 4DY7B 4Y0ZE 1LKAA 2QXHA 3GYLB 3UY9A 2AIPA 3SHAH 3U1IB 1QBOA 4YOGA 4X6MA 1C4V2 1RRKA 1V2LT 3A8BA 4J2YB 4BXWA 4Z0KA 1EP6A 2ZQ2A 6ESTA 2FTMA 3QLPH 1C1QA 1C1VH 1E36B 1QL7A 2PGBB 2BY7X 1ESAA 1N8OB 1QFKH 2J4IA 1P11E 2BX3A 4FUBA 2ZF0H 3TK9A 3EA8A 2WV5A 2CHAB 1V3XA 3ESTA 4AYVB 2TGPZ 1F0UA 1FLEE 1RTFB 2GP9B 3VGCB 3I78A 1W7GH 3RU4E 3E3TA 1IHTH 3LU9B 2FZZA 2F9BH 3A83A 1DSUA 3MH4A 1P2KA 2ODQA 3LT3A 2XC5A 3MU5A 1NRPH 4I32A 1PPZA 3A7WA 5T6GA 5EW1H 4D9RA 2XTTB 1C5YB 4MLFB 2BOHB 4FVBA 1ABIH 5TJXA 4JMYA 4B74A 1TONA 2QV1A 1A3EH 1LPKB 1YCPK 3A80A 1PPHE 3QK1A 3K6YA 4INHA 1KLTA 3O8RA 2C8ZB 1OXGA 2P3FH 2BZAA 2IPHA 1O2NA 1Z8RA 3ZZDA 1GBMA 1QB1A 2BLQA 1G2MA 1GMHF 2QN5T 4DW2U 2CHAC 2JH5D 3ZV9A 2BZ6H 4X8TH 1ZTKA 3TPIZ 1KXAA 5C1XA 2Q6DA 3P8NA 1C4Y2 2GCTB 2GDDA 3M35A 3TLOA 2OUAA 1Y5BT 1MMJN 1GJDB 5FHTA 3PMHB 5DJ7A 2VWOA 4IW4E 3ZZ7A 4RN6A 1EOJA 2F9UA 1HCGA 2FLBH 3U9AH 1ZPCA 3PMBB 2DE9A 3QZQA 5A8YA 3KHVA 1BRCE 5LGOA 2JH0D 1YC0A 1E38B 5K7RA 4WXIA 3OY6U 3VPKA 2R9PA 4M7GA 4Q7ZA 1O2PA 1W7XH 1WU1A 1ANCA 4AFUA 1O2QA 2I6SA 4THNH 1O5AB 1Y3UA 1MZAA 1QB9A 1NFYA 3S9BA 4X6PA 3A7TA 2GCTC 3SJOA 4D9QA 4BAMB 4CHAC 3FVFB 5HM9A 1NS3A 1FUJA 1PJPA 4X8SH 1BBRK 2XRCA 3E0NB 1BOQA 1GGDB 4I8LA 1A3BH 4FU9A 2V3HH 1Q31A 3F6UH 4ASHA 2ZGCA 1O30A 1FNIA 1UVPA 1MBQA 1RGQA 4KTUA 4X2VA 3VFEA 2RA0A 4X1QU 3PO1C 2ZO3H 1PQ5A 1K9OE 5T6DA 2ZWLH 2AMDA 1ETTH 3TJOA 5JBCS 2FX4A 1XMNB 1INCA 1AD8H 1ELBA 3CS0A 2SGDE 2BD3A 1SHYA 2W5EA 1XUKA 2ZU2A 3QDZB 4GAWA 4Y11E 1EKBB 2OC1A 4ZUHA 1C2MA 1DE7H 1GCTB 1TPPA 3BIUH 1GHYH 2XBXA 2R3YA 3BTME 3QO6A 4FUFA 1EB2A 1NROH 3RXDA 3SV9A 2XYAA 5FBIA 2XBVA 3FZDA 4AYYB 1OP0A 4OS4A 4UFDH 2SGPE 1DWEH 2CMYA 2WINI 1VCWA 4CRDA 3W94A 2D2DA 3RXMA 1O2HA 1FJSA 4MTBA 3PTNA 3QTVH 1BMMH 1JBUH 1SPJA 1P10A 3SU1A 2QF0A 1C5NH 1O2VA 1WBGB 2R0LA 2WPMS 5LPRA 2F91A 3TU7H 2O9QA 3MU8A 1XVOA 1GBHA 2GCHF 3A86A 4WF8A 3V12A 2PLXA 3RC4A 2VWMA 2AERH 2XC0A 4ABBA 1YF4A 1W0YH 3P95A 1TE0A 1HAVB 4HFPB 2HRVA 4I8KA 3TJNA 4ABAA 4DIIH 5LPEA 4HI3A 4U2WA 1LVYA 2GKVE 1GI4A 3UNSA 2WV4A 4IN1A 1O5CB 1SGTA 2FOHA 3FAOA 2AGEX 1S84A 5DP9A 1P06A 2JH6D 1V2QT 3TVJB 3M7UA 3BSQA 4UONA 4PROA 1EAWA 3GDVA 1BTWA 1KDQB 3TH2H 4K1EA 3AAUA 4K1SA 4IGDA 1LPZB 5E8EH 3PROA 4FUCA 1NN6A 2VJ1A 3SV2H 3PMJA 3I77A 4B2CA 1O36A 2ZIQH 3SU5A 4D7GA 4X2XA 2P16A 1O3BA 2PKSB 1C5SA 2DE8A 3GICB 4ZMAH 1UCYH 3BTKE 3MFJA 4IS5A 4Y7AA 3NUMA 4DCDA 1GBBA 1P2IA 1RXPA 2ZFQH 4I33A 2GV6A 3LH1A 7GCHF 3A7YA 1P09A 1D3QB 4AZ2B 1PQ8A 3AVZA 3BIVH 4B75A 1EASA 1K1JA 3ATIA 8ESTE 2Z3DA 5LH8A 2AEIH 5AVDA 6GCHG 2BY6X 2SNVA 3EAJA 1J16A 1DXWA 1AVGH 3T26A 1YCPM 1NFUA 2PHBA 4MDSA 1N1LA 3N7OA 5FPTA 2I6QA 1MU8B 1BRBE 3SNAA 4E7NA 1AZ8A 5DP4A 4BANB 3T62A 4CBNA 1UK3A 4GCHF 2ZDAH 4K5ZA 1C2FA 2ZFSA 2TGTA 1E37B 2FXRA 3BV9B 3MO9A 1BRUP 5DO4H 1A1RA 1SQTA 3ZZ5A 2EEKA 4B2AA 1GJCB 1NU9A 1SGYE 4ISLA 3VEQB 1J8AA 1W13U 1AUTC 4GLYA 1Y5UT 3I29A 1KTTB 3W95A 1O2KA 2PFEA 5H4IB 2ZDNA 2WPKS 1H4WA 3AAVA 3RXTA 4Y8XA 1O2WA 1ZHRA 2STBE 2BD5A 2BDBA 2SNWA 4WJG2 4X8UH 4WH6A 2R3UA 3BTGE 1SFQB 2IJOB 3RXQA 1O3JA 5JBTA 4Y10E 1AGJA 1TOMH 4ZROA 4X8VH 1FDPA 1BCUH 1FIZA 2UWPA 1GHWH 5EGMA 1GJAB 3RM0H 3VXEH 2GV7A 2RCEA 2FPZA 1O5EH 8KME2 4FUHA 2WYJA 3A7VA 2QGRA 4DGJA 5BPEA 2TPIZ 3T28A 3MTYA 1E0FD 1TMTH 1FIWA 3RXAA 1A0LA 1ELGA 3LGTA 3UNRA 2XBYA 2BQWB 4ABGA 2FOAA 1SGNE 1H9IE 1OYTH 1SGQE 3ZZ6A 2W3IA 1AKSB 1IQFA 4MNWA 1EPTA 3ZVCA 2K1QA 1YPLH 4Q7XA 3VB5A 1C2LA 3T29A 1O3GA 1HIAB 1XM1A 4IC5A 1IHSH 1RFNA 1ZMJA 2BD8A 1GHBG 3MMGA 3SI3H 1B0EA 1DITH 4SGAE 1NZQH 4NCYA 5DPAA 2YNAA 1BUIA 4ESTE 4TYDA 4YO9A 3SOSA 1L2EA 1AFQB 1QB6A 1QJ7B 1A0HB 1BTYA 2EC9H 2D1JA 2ZEBA 4H4FA 1NPMA 3E0PB 5CHAC 4B71A 5GXPA 1D9IA 1Q3XA 2BLOA 5A8XA 1CA0B 1O2IA 2F9VA 2ZGHA 1O5BB 1HAHH 3AASA 2TBSA 1V2NT 4ISHH 2Z9IA 2TRMA 1QJ1B 2C93B 3DUXH 1NFWA 2QY0B 4TY6A 4HGCA 2OINA 4ABDA 2ZC9H 2F3CE 3SUFA 4FU8A 3DFLA 1GBEA 4YLUA 4BAKB 1O3FA 1S81A 4BTTB 2J95A 1GBAA 2BVRH 2ZCLP 4YTAA 3SV7A 2ZU1A 3RXOA 1FI8A 5A0CA 1DM4B 2THFB 3GDUA 1O37A 3A8AA 3RXJA 3MU1A 3Q3XA 4XDEA 3SBKA 2AYWA 9ESTA 3PB1E 3KIDU 2ZFTA 1D6RA 4MNVA 2Y6TA 1H9LB 2ANMH 2VU8E 1AFQC 4ISNA 1D3DB 1HBTH 2A31A 5PTPA 1CA0C 1MTNB 1HAXB 3ATWA 2HVXA 2A1DB 1AVWA 3ZYDA 4UFGH 3A81A 1ZRKA 3RDZA 1A5GH 3TNSA 2G81E 1OPHB 3A89A 1Z6JH 3T2NA 1EOLA 2XXLA 3GCHB 3K9XB 1MTSA 4ZXXH 1Z8IB 1C2EA 3F1SB 1GBDA 3ATLA 1K22H 1FPHH 2QXIA 3TK5A 3TK6A 2ZHDA 2A5AA 4ZHAA 4UEHH 1GJ4H 4YT7H 1G32B 1XX9A 1GMDF 1GJ6A 2BD4A 4NIYA 4YOIA 5A0AE 1F2SE 2QAAA 3STIA 1RS0A 4JZIA 3MH6A 1TGTA 2ZTYA 3K2UA 1DLKB 3GISB 2VVUA 3ZVDA 1C1RA 1O3DA 2C90B 5E0GA 4INLA 1FY5A 3RXVA 3MU0A 3E8LA 5HXFA 3RMNH 2ALPA 3UQOA 1OWEA 5A09A 1JRTA 2VIWA 4ABJA 1ESBA 1VITF 1Z6EA 2A45B 4E06H 3MHWU 1QGFA 2Z94A 1UTJA 4GHTA 3UTUH 2J34A 2TGDA 2ZHEH 1P3CA 5FX6A 2RDLA 1EZXC 5E2PA 1EAXA 3SV8A 1P03A 1KXDA 2A7CA 1ZOMA 1WQSA 3LC5A 1O32A 1ZSLA 1YCPH 2P8OC 1KLIH 5JBAS 2EA3A 1KY9A 1O2JA 3SU6A 1SGIB 1V2TT 4ABIA 1QBVH 5F8ZA 2ZU4A 1J15A 5FCRA 3RXIA 1KXEA 3PLPA 2HOBA 5C1UA 3BEFB 3FZZA 1ABJH 2FIRH 2G5VA 1SR5C 1D3TB 1ZZZA 2BM2A 2FWWA 2Z9JA 5C2ZA 1SLWB 1ZPBA 2HLCA 4TPIZ 1GI9B 1C5RA 5IYTA 1P05A 3RU4T 2BOKA 5GDSH 1RTKA 1UMAH 3E6PH 4NWKA 1FN8A 6LPRA 3M7TA 1EAUA 1ZGVA 1A46H 4K2YA 1C9PA 1NTPA 1GI2A 1W0ZU 3NXPA 2ZQ1A 1TOCB 1PPBH 2ZECA 1G36A 4WMEA 4AFZA 3JZ2B 1QA7A 4GPGA 1BZXE 1THSH 2G4UA 1ESTA 2OP9A 2V35A 3CS7A 3LIWA 2GZ8A 1O39A 4BTUB 3PYHA 5FBEA 3GCTG 1GJBB 2A7HA 2P94A 4LZ1H 2Y82A 3B9FH 2Z9LA 1S82A 1XUFA 1GMHG 5J4SA 3LGVA 4NIWA 4O9VA 1FONA 2OBOA 4I31A 3TJVA 1BHXB 5ETXA 1O5DH 1C2IA 1C5XB 4AFSA 2O8UA 2P3UB 4ISOA 4BXSA 3A7ZA 5I25A 3UQVA 1BBRH 5ESBA 4E7RG 4D7FA 3Q3KA 4JZFH 4DG4A 1MTUA 4E05H 2P3TB 5LPFA 1LMWB 3A87A 4XE4A 1DX5M 4WVPE 4CRCA 1H8DH 1UO6A 2FOBA 4ABHA 3U98H 4K60A 3MI4A 2Y5FA 1F0TA 3IG6B 4Y7BA 1TRYA 1CT4E 4DJZB 3LDXH 5A2MH 4FUDA 1THPB 1QHRB 2VINA 2KAIB 1DXPA 4AORA 1O2XA 1HPGA 1K1MA 3RXGA 1KXCA 2VVCA 2QXGA 1SQOA 4MPWA 2D26C 3IITA 1OWHA 1VJAU 2CF8H 1ZRBA 1P3EA 4CHAB 4CRGA 1TYNA 1HNEE 1KXFA 1HXFH 1JWTA 2V0BA 1THRH 1O3PB 5HMAA 4ZXYH 4ZKOU 3M7QA 2BYAX 3QGJA 1Z1JA 1TX7A 1O31A 1GJ9B 2V6NA 4OGYA 5IDKA 2FI5E 1GI0A 2FLRH 1DOJA 3ZVAA 3F9GA 2OQ5A 3B8JA 8GCHF 1UTNA 3PO1B 1IQKA 5JDUB 3STJA 2PW8H 4ISIH 1TBQH 1VZQH 1ZGIA 2UWOA 1MZDA 2G8TA 1J17T 1F92A 2C8WB 3BN9A 5EQRA 1HAZB 2ZPSA 2TGAA 2ZGBH 3SJ9A 3ZZ3A 1W2KH 3LGUA 2O8LA 4Y0YE 5DK1A 5DGJA 8LPRA 1W12U 2VIPA 1QTFA 5E0JA 1O2OA 1DANH 1T7CA 3HK6B 1K21H 1T8OA 1LVBA 2J2UA 4WWYA 2FOMB 3BTEE 1C5MD 1TNJA 1VGCB 3BTDE 1ORFA 2GVFA 1O0DH 3ZV8A 4UDWH 3UREA 2Z9GA 2H2ZA 3AW1A 1O2YA 3VB7A 1OP2A 3B23B 2HNTC 1O3MA 4IC6A 1BTUA 1C2KA 3SU0A 5DP8A 4SGBE 2GCHG 1ELDE 1DDJA 1V2JT 1W11U 1NM6A 1P2QA 1SB1H 1C1MA 2GMTB 3M36A 1O3KA 5JYIA 1SBWA 2VWLA 1O2GH 1W10U 2B0FA 3QTOH 5I46H 3SGQE 3PLKA 3MH5A 4GSOA 4A5TS 1NO9H 1BTXA 2VNTA 5AHGH 4AG1A 3RXFA 1GVKB 1TRMA 1NESE 1UTMA 1A2CH 3OTJE 3ATKA 2PKAB 3A82A 1VGCC 1K1IA 2HNTE 1YYY1 1E34B 4AFQA 1ZYOA 3V13A 1C5UA 1L1GA 1W8BH 4RKOB 4Q7YA 5GPIB 5GIBA 1O2RA 4Y71A 1TBZH 3ZZ8A 3D49H 1NU7B 2Y5GA 3M5NA 3OYPA 2Y7ZA 2C8YB 1Z1IA 1GHAF 5EXLA 1YP9A 2GGVB 2GMTC 4MG3A 3RC6A 2FI3E 4K8YA 7GCHG 1GI7B 4ZKNU 4H6SB 1O38A 4IN2A 5EODA 4BAHB 3KCGH 3L3TA 1DWCH 2BDYA 3L6PA 1SLVB 1T32A 3RXUA 1UCYE 1KXBA 3ODDA 7LPRA 1FZZA 1TPOA 3AW0A 6CHAB 2PUXB 5AFZH 1ANDA 3QGNB 1PQ7A 2FESH 4TY7A 1F5RA 3BTWE 2VWNA 1WAYB 1C1PA 1NC6A 1PFXC 2Y7XA 2VH6A 3BTFE 4B1TA 1GHVH 3A8DA 1P9UA 1OS8A 3RLWH 4GCHG 1VITH 1C5ZB 2WPIS 1CGJE 3C27B 2OTVA 1SI5H 2OCVB 4AN7A 2BQ6B 3ENSB 1AU8A 1W3CA 4CH8B 2VIQA 3ZVEA 3QX5H 4BNRA 1K2I1 3G01A 2BMGB 1QQUA 2BX4A 2ZU5A 1BTPA 4HZHA 1HGTH 2FEQH 4XFQA 4WH8A 1C2HA 1BTZA 1XUHA 4GHQA 2HPQH 1SFIA 2F9PA 3UR6A 3FP8E 2FI4E 4TPYA 1M9UA 1MQ5A 1BDAA 2XBWA 2EI7A 6CHAC 4RKJB 3RM2H 1TGBA 2A5KA 2J9NA 5BRRE 4IMQA 1EPTC 2OQUA 1F0SA 3KQEA 1QIXB 3M5MA 3VB6A 2SGFE 1YPHC 4ZH8A 1V2MT 1GDQA 5C3NA 1AFEH 2FS9A 1O3AA 1LHGH 1V2OT 2ZFRH 3M3VA 4CRFA 2QIQA 4D76A 1NFXA 1IQMA 1BIOA 1FAKH 2A7JA 1P2JA 4K69A 1BMLA 2ANWA 3FFGA 1AI8H 4X6OA 1TBRH 1UTLM 4DVAU 2CJIA 3H5CB 1U6QA 1LVMA 2HGTH 2ZTXA 1SGPE 3ZYEA 3EA7A 1SGEE 1OOKB 1WSSH 4RSPA 5DP7A 1BB0B 2A2XH 1QNJA 2FODA 4INKA 1NRQH 1MKXK 1DVAH 3SN8A 2V3OH 2RA3A 1YPHE 5GCHG 2OC7A 3S7HB 1W14U 1BMAA 2Y81A 3BG8A 1BQYA 1UJ1A 2O8WA 3ITIA 3Q77A 1H1BA 1PYTD 2ODYB 1OWJA 4KP0A 3KEEA 1WQVH 1XVMA 3KF2A 1QRXA 3P70B 4DURA 4F4OC 2H5DA 5CHAB 1ELAA 1C5TA 1UTOA 1ID5H 1WV7H 1XXDA 1TNLA 1SMFE 1TRNA 1WYKA 2G4TA 3NKKA 4YZUA 1IQNA 2GDEH 4AGJA 1TNGA 2BQ7B 4IMZA 1CE5A 2Z9KA 1N6XA 2ALVA 1S0RA 2BXTH 1YGCH 1NRSH 2P95A 1RTLA 3Q76A 2AGIX 3HKIB 1ANEA 2AMPA 1GMCG 1SL3A 1ELCA 3VB3A 1LDTT 1O3IA 1HAVA 2H1UA 1C5LH 1EZQA 1HJ8A 5EG4A 3E91A 2BVSH 1JRSA 2NU2E 3EQ0H 2SGEE 3MYWA 1C1WH 1UHBA 1UTKA 5EXNA 3ZVFA 3BTHE 3U8RH 4U01A 1GI5A 1TGCA 1EP5A 3BTQE 1WOFA 1BJVA 4XBBA 3O8CA 1OSSA 4JZDH 2P93A 4CR5A 1OWDA 1CQQA 2STAE 3KL6A 1HAYB 4OS2A 1BT7A 2XCFA 3ZZBA 1SLUB 2ZU3A 4JYTA 2GX4A 3D62A 1G2LA 1ZHPA 1ZHMA 1GBIA 1J9CH 1VR1H 4JZ1A 1IOEA 1SC8U 4I7YH 4X1SU 1GJ7B 1RJXB 3GYMA 3RXPA 4I8JA 1CHGA 2OBQA 2ZGXH 3SGBE 4LOYH 1TNHA 1B7XB 1AIXH 1FN6A 2O8TA 1GBFA 3LC3A 1HAIH 2A2QH 2AIQA 3NCLA 3A85A 3U69H 1CHOF 5C67A 3GDSA 4A92A 2G52A 3TGIE 3LGWA 1GCDA 3PTBA 1BHXF 2WPLS 4VGCB 1VCPA 2Z3EA 1E35B 3KGPA 5A8ZA 1QA0A 2VGCB 2PV9B 1ETSH 1VITG 1WCZA 1YKTA 3ZZCA 1DUEA 4AGKA 1TAWA 1ZTJA 1S0QA 1O5FH 1GBTA 1QQ4A 3A88A 3LH3A 2JETB 1ZTLA 1CBWB 2XW9A 3KQDA 3M3SA 1EJAA 1JIRA 1ZJKA 4FXGH 2GTBA 1SOTA 1L4ZA 1P57B 4TWWA 3P92A 5EW2H 1FV9A 2P8OB 3RC5A 3D23A 3SU3A 3GY5A 4HTCH 1LHEH 2NU4E 1P8VC 2BY8X 1LQEA 4DIHH 5FCKA 3SNDA 2QF3A 1O3OA 2J92A 4JZEH 2UUYA 3VB4A 2B7DH 1G3CA 2ZCHP 1T8MA 2H9HA 1FXYA 1LTOA 2A0QB 4VGCC 3P8OA 2VGCC 3NWUA 4Q2KA 2F9NA 1A5IA 1L1JA 2B9LA 3PLBA 3RXKA
chains in the Genus database with same CATH superfamily
2NU0E 1DUAA 5L30H 1FY8E 4FOUC 2M5TA 1YPMH 4CH2B 1FY1A 2JETC 2ZGJA 5E2OA 5DP3A 2NU1E 3TNTA 1CBWC 2FP7B 4WXVA 3EDXB 3QWCH 1AN1E 3EYDA 2HNTF 4RT1A 1Q2WA 3PWCA 1A7SA 5A0BA 1SHHB 3RXSA 3TH4H 3V7TA 2Y5HA 2FM2A 5HM2A 1KIGH 1WTGH 1AKSA 3FKSD 3PWBA 1C1SA 2BD7A 2VVVA 1EJNA 4NWLA 4FUIA 1C4U2 2BVXH 4H6TA 1HUTH 1ZJDA 1GHZA 4A6LA 2A4QA 1HIAA 2ESTE 1O2MA 2ZKSA 1JXPA 2VH0A 1GBJA 1PQAA 1F5KU 3S9CA 2UUKB 2ZPQA 2KX4A 2FOGA 1O3EA 1MTVA 2QXJA 2F83A 1QRZA 2PR3A 2SGAA 3U8TH 1OYQA 2JDID 1DY9A 1QL8A 5FX5A 3UUZA 2H5CA 1O2TA 2BHGA 5DG6A 1HB0B 3SJKA 1GVLA 2R2MB 1GJ8B 4AX9H 1EATA 1NT1A 1IQIA 3GCOA 2XC4A 3SNBA 3DT0H 4IBLH 1SGCA 1P12E 3DHKH 4CRBA 4K1TA 1V2ST 1ELVA 2W7UA 3LJJA 4LXBH 5JPMH 1LPGB 2FOEA 3RXLA 1BBRE 2OXSA 4DOQA 1MTWA 3EGKH 3MO6A 1K1NA 3F9EA 1P2MA 1PPCE 5JB9S 4WMFA 1OKXA 1XUJA 5EU8A 2YMSD 1GL0E 2GD4B 2D8WA 1KTSB 4A1VA 1MU6B 1YBWA 1P02A 5GJ4B 2BDGA 3PRDA 2A32A 4BAQB 2BLWA 3TJUA 1MD8A 3KQBA 3KN2A 1CVWH 2AH4X 1T31A 2AHME 1BRAA 1Z7KA 2CGAA 2ZZUH 3UWJH 2HLDD 1CA8B 1F5LA 5EQQA 2W7SA 2ZCKP 1SGRE 4JYUH 2GZ7A 1LVOA 1X7AC 3M5LA 2OC8A 1MQ6A 8GCHG 1K0HA 1LKBA 2CK3D 2SGQE 2ZI2H 1ZLRA 2YNBA 2ZHWH 4Y8ZA 1AQ7A 1C5WB 2FMJA 3RP2A 1MAXA 2IN2A 1K1LA 2EI6A 1P2NA 3SJ8A 1K1OA 1KSNA 3M37A 1MKWK 1V2PT 2ULLA 5CE1A 2A4OA 4X2YA 1T4UH 5K0HA 1A4WH 1K1PA 5F53A 1EZUC 4CBOA 4ABEA 1HJ9A 1LO6A 4O03A 2J38A 4NGAH 1QRWA 2BDHA 3BEIB 3HPTB 1KYNA 1O2UA 1GBKA 4CRAA 3F3BA 5DP5A 1DS2E 1C2JA 1C5OH 1XUGA 3BEUA 3Q00A 5EJLA 1BJUA 3RMOH 1GI6A 3GCTF 1C1OA 3U28C 1TNKA 1N8OC 3MU4A 2WPJS 4NA7A 2O8MA 2OK5A 1CSOE 4KGAA 1PYTC 3RUOA 3R0FA 4Q80A 4DT7B 1FY4A 4R8TB 1BA8B 3VGCC 1Z71A 2V7QD 1XKAC 1YPGH 3UIRA 3URCA 4UFFH 2FX6A 3ELAH 1HAGE 3GS9A 3ODFA 4BOHA 2RG3A 4OS5A 1O3NA 5B6OA 1QY6A 3SUDA 1L0ZA 1HLTH 4KTSA 3S9AA 4R0IA 3MH7A 2PTCE 2C4FH 2G51A 1ELTA 4JK5A 5JBBS 2ZDVH 4ABFA 4MVNA 5F03A 1ELFA 4KTCA 5L6NH 1VJ9U 3Q3YA 1B5GH 2FO9A 1GL1A 1O2ZA 2PSXA 1YM0A 3KYGA 4F49A 1HYLA 1T8LA 3UR9A 3UOPA 5J4QA 4Y76A 5EQSA 1O2SA 1GBCA 4MPVA 1IQEA 1KLJH 1GI8B 1G3EA 3DA9B 1C2DA 1GHAG 4KKDA 1TNIA 1MCTA 2NWNA 4TWYA 2ANYA 3UWIA 4ACAA 3A84A 1V6DA 3LOXA 1OX1A 5C5NA 3E90B 2PWXA 1YPJH 1UVOA 1W0KD 5E0HA 4FUJA 5T6FA 1YPKH 1SLXB 3O8BA 2PSYA 3RXCA 4GVUA 4X1NU 4YOJA 4JK6A 4O3UA 1UW7A 1G9IE 3V3MA 4A1TA 1UK4A 4NG9H 5FPSA 3H7TA 1BMFD 3RLYH 2HWLB 3TITA 3NK8A 3SUEA 1MCVA 2QA9E 1SGDE 1ZPZA 1TIOA 2BY5X 1YLCA 2UUJB 2B8OH 4M9FA 1ZSJA 1CT0E 1DSTA 5TCCA 2BDCA 4YESB 1GDNA 1V2VT 4MPXA 1IQHA 1C5VA 3QZRA 3H7OA 1L1NA 5EPNA 1AUJA 3RMMH 1A0JA 3HKJB 3NZIA 1EZSC 1EB1H 3UPEA 1YLNA 3ZZ9A 4ZAEA 1SG8B 4I8HA 3ZZAA 3PMAB 2W3KA 1HV7A 4ZHMU 1GGDC 5F8XA 4BTIB 1GPZA 1VKYA 4XOJA 5EPYA 1YY3A 3GY4A 3MWIU 1MKXH 1UVSH 2UWLA 1N6YA 3MNXA 1TB6H 2FOFA 5GWZA 1VCQA 4BAOB 1EPTB 2ZFFH 3EE0B 4NA8A 3PV4A 1AWHB 2BDAA 1O3LA 3P8FA 2KAIA 3SHCH 5AF9H 1D6WA 2G55A 4MNXA 5L2YH 2BTCE 2GZ9A 1ZR0A 1QJ6B 1QURH 3ATMA 1MD7A 2Q1JA 4QT8C 2IOTA 2NU3E 1LHFH 1DWDH 1GCTC 3CENA 4NZLA 1UHBB 1BTHH 2W26A 2F9OA 3RU4D 2LPRA 1EUFA 3SI4H 2H9EH 1GHXH 2WPHS 2YOLA 1TX6A 5DSFA 3MNCA 3RXRA 2WSSD 1FPCH 2ZG0H 4AOQA 3SYJA 2BLVA 3WWBA 3GY2A 2ZDMA 1S6HA 1IAUA 3RXBA 3S69A 3DSPA 5DKMA 1Y3WA 1HFDA 4FUEA 4NA9H 1CGHA 1GWAA 1OP8A 3PV5A 1ANBA 1IQJA 1TGNA 5TCAA 2FYQA 3R3GB 5ESTE 1MBMA 4KELA 3RXEA 1ZMLA 5DP6A 3SQEE 2C3SA 5AFYH 4X0WU 1TA2A 5L2ZH 3SGAE 4U30A 4NFFA 4MPUA 3LJOA 4NIVA 2XNIA 1F7ZA 1O5GH 2PUQH 3SNEA 2QYIA 1GG6B 2C8XB 4AG2A 1Z8GA 5G4BA 4WY3A 2YMSB 5C5OA 3UOUA 3ZVGA 1BMNH 1EAIA 3LONA 5FPYA 1GI1A 2WUBA 7ESTE 1JOUB 3HK3B 1DPOA 3OSYA 5KECA 2A4GA 1QR3E 1GBLA 1AVXA 2BB4A 5F6MA 1RIWB 1Z8JB 4FVDA 3SU2A 1HJAB 3IWMA 2PGQB 1TMUH 4UD9H 3SW2B 1SGFA 4XRNA 1GI3A 5JB8S 3RMLH 1T4VH 3ZZ4A 2BD9A 1EX3A 3TH3H 1HAPH 1C5QA 2CF9H 1JMOH 1FQ3A 2BY9X 2SFAA 2PKSC 3GY3A 3MOCA 1YPEH 2KR7A 1B0FA 2ODPA 1NRNH 4OS6A 1HXEH 3FP6E 4ZHLU 1EJMA 2Z7FE 1V2WT 3BF6H 4J1YA 2Q6FA 3FP7E 4ZKSU 4K8BA 1FMGA 1ZMNA 3A8CA 3GOVB 3TIUA 1IQLA 1AO5A 1C1TA 2OLGA 2AGGX 4NSYA 2ANKH 3M61U 1CGIE 1FAXA 1O3CA 3SJIA 3S0NA 3PV2A 1DLEA 5EXMA 1LQDB 3QN7A 1DT2A 1GG6C 2PKAA 4D8NA 2ZTZA 2YMSC 4XBDA 6GCHF 2JJ2D 3OY5U 4FU7A 1ARBA 1ZSKA 2IJD1 3P8GA 1P2OA 4B73A 2XCNA 2J98A 2QE7D 1UK2A 2VIOA 2FYRA 2ZHQH 1P04A 1TLDA 2HALA 4FUGA 2B5TB 1TPSA 2XWAA 1O35A 1RIWC 2QC2A 2XWBI 4XSKU 4A1XA 3HGPA 1HJAC 3T5FH 3K65B 1NY22 3NPSA 3U1JB 2DUCA 1D3PB 1A5HA 5SGAE 4UFEH 1P9SA 2EQNA 4AB8A 2ZNKH 1IQGA 3FANA 1H8ED 1SSXA 1UCYK 5HGGA 1AY6H 3HGNA 1Y3YA 4X6NA 3CNRA 3M5OA 1QL9A 2OC0A 2QCYA 1CHOG 1ELEE 3SUGA 4NFEA 1ACBE 2A5IA 3SU4A 1EXFA 2VIVA 2ILNA 2Y80A 1GVZA 3PM3A 1TGSZ 1C1UH 3CP7A 1TALA 1G37A 5ABWA 2L6OA 1C9TA 1AWFH 2AS9A 5HKKD 1KDQA 5GCHF 3F9FA 4ZKRU 3M3TA 3TGJE 2Z3CA 3LGIA 2ZP0H 1K28D 1UTQA 4I8GA 1Y59T 4X2WA 2A4RA 3SNCA 2WYGA 3P17H 2OD3B 2TIOA 3O8DA 2LNCA 2FDAA 2BD2A 4H42U 3LGYA 4XBCA 3S7KB 3GY7A 4CR9A 1JIMA 2J5UA 1G3BA 1GMDG 1V2RT 4WMDA 1TMBH 3U8OH 4YT6H 3KNXA 1TPAE 1MAYA 4Y6DA 1L4DA 1AE5A 1V2KT 2FTLE 1PPFE 2GT8A 3P6ZB 2FOCA 1TQ0B 1Y3XA 2P59A 1C5PA 1S85A 4Y8YA 4B2BA 2CN0H 3DSGA 1GJ5H 3VXFH 3SQHE 1C1NA 1AB9B 2R2WU 1XXFA 1ARCA 2ZDKA 4OGXA 4U32A 5C94A 3SV6A 1GMCF 2BXUH 2L74A 1GHBF 1S83A 1TABE 3T27A 1HAOH 1J14A 1MH0A 1DFPA 1MUEB 3ZIAD 1PPGE 1SOZA 1Y5AT 1CU1A 1FY3A 1AE8H 3QUMP 4X1PU 1EQ9A 1WTHD 3K6ZA 2CV3A 5F8TA 4YM9A 1AMHA 5FXLA 1V2UT 1Y3VA 1P0SH 1DY8A 1TA6A 2BDIA 1HDTH 1NRRH 3URDA 3WY8A 1G3DA 3BG4B 1H9HE 1QCPA 4CREA 1DWBH 3LPRA 1O2LA 2H6MA 3F68H 1S5SA 1T8NA 3TGKE 2ZFPH 3MNSA 1AB9C 2GT7A 3ZVBA 1S6FA 1G30B 2HPPH 1H8IH 3NRLA 1GDUA 1A61H 3MNBA 5CMXH 1AHTH 1O34A 2ZA5A 2ZHFH 3DFJA 5FAHA 3SZNA 1MABB 2G00A 3HATH 3JZ1B 1UVUH 3KQCA 2AFQB 4LZ4B 3SO3A 1ETRH 3EA9A 2JKHA 1TQ7B 1MTNC 1PPEE 1OWIA 2VIDA 3MO3A 4JYVH 4UE7H 4LK4A 3F9HA 2UUFB 1SGFG 1LCYA 3OX7U 2CXVA 2ZDLA 4JCNA 1DICA 3BG4C 2JIZD 5HYOA 3GCHC 3T25A 4NSVA 2EI8A 4B76A 1UTPA 1WUNH 2WPDD 3DD2H 9LPRA 1YLDA 1MKWH 1COWD 1OWKA 3GY6A 4OS7A 1BITA 3SORA 2VB0A 1P01A 1D4PB 3BTTE 3GCNA 3V0XA 4MNYA 4K3JA 3E16B 4Y79A 2FS8A 4NZQA 4O97A 5EOKA 4X1RU 3D65E 1RD3B 1XKBC 5T3HA 3GY8A 1LHCH 3WWFA 1UVTH 1SQAA 1CT2E 2ZPRA 1O33A 1HRTH 1O3HA 3UB0A 4Z6AH 1LHDH 5C1YA 5C17A 4AB9A 1CO7E 2ASUB 2AMQA 1XUIA 5C20A 3E1XB 2H9TH 4MQAA 3UFAA 4NIXA 1TWXB 3OU0A 2R0KA 2PTNA 4O3TA 2G5NA 1Y8TA 4OS1A 2WUCA 3C1KA 7KMEH 4GUXA 2Q6GA 3A7XA 1F0RA 1SVPA 4A7IB 1TX8A 1TFXA 3MQKC 4YLQH 3L33A 3RXHA 1C2GA 1AZZA 1QBNA 2J94A 3UNQA 2Z6BD 3LKWA 4DY7B 4Y0ZE 1LKAA 2QXHA 3GYLB 3UY9A 2AIPA 3SHAH 2W6ID 3U1IB 1QBOA 4YOGA 4X6MA 1C4V2 1RRKA 1V2LT 3A8BA 4J2YB 4BXWA 4Z0KA 1EP6A 2ZQ2A 6ESTA 2FTMA 3QLPH 1C1QA 1C1VH 1E36B 1QL7A 2PGBB 2BY7X 1ESAA 1N8OB 1QFKH 2J4IA 1P11E 2BX3A 4FUBA 2ZF0H 3TK9A 3EA8A 2WV5A 2CHAB 1V3XA 3ESTA 4AYVB 2TGPZ 1F0UA 1FLEE 1RTFB 2GP9B 3VGCB 3I78A 1W7GH 3RU4E 3N7DA 3E3TA 1IHTH 3LU9B 2FZZA 2F9BH 3A83A 1DSUA 3MH4A 1P2KA 2ODQA 3LT3A 2XC5A 3MU5A 1NRPH 2KZ4A 4I32A 5C0TA 1PPZA 3A7WA 5T6GA 5EW1H 4D9RA 2XTTB 1C5YB 4MLFB 2BOHB 4FVBA 1ABIH 5TJXA 4JMYA 4B74A 1TONA 2QV1A 1A3EH 1LPKB 1YCPK 3A80A 1PPHE 3QK1A 3K6YA 4INHA 1KLTA 3O8RA 2C8ZB 1OXGA 2P3FH 2BZAA 2IPHA 1O2NA 1Z8RA 3ZZDA 1GBMA 1QB1A 2BLQA 1G2MA 1GMHF 2QN5T 3EE7A 4DW2U 2CHAC 2JH5D 3ZV9A 2BZ6H 4X8TH 1ZTKA 3TPIZ 1KXAA 5C1XA 2Q6DA 3P8NA 1C4Y2 2GCTB 2GDDA 2WHXA 3M35A 3TLOA 2OUAA 1Y5BT 1MMJN 1GJDB 5FHTA 3PMHB 5DJ7A 2VWOA 4IW4E 3ZZ7A 4RN6A 1EOJA 2F9UA 1HCGA 2FLBH 3U9AH 1ZPCA 3PMBB 2DE9A 3QZQA 5A8YA 3KHVA 1BRCE 5LGOA 2JH0D 1YC0A 1E38B 2EY4C 5K7RA 4WXIA 3OY6U 3VPKA 2R9PA 4M7GA 4Q7ZA 1O2PA 1W7XH 1WU1A 1ANCA 4AFUA 1O2QA 2I6SA 4THNH 4OM9A 1O5AB 1Y3UA 1MZAA 1QB9A 1NFYA 3S9BA 1E1QD 4X6PA 3A7TA 2GCTC 3SJOA 4D9QA 4BAMB 4CHAC 3FVFB 5HM9A 1NS3A 1FUJA 1PJPA 4X8SH 1BBRK 2XRCA 3E0NB 1BOQA 1GGDB 4I8LA 1A3BH 4FU9A 2V3HH 1Q31A 3F6UH 3OTPA 4ASHA 2ZGCA 1O30A 1FNIA 1UVPA 1MBQA 1RGQA 4KTUA 4X2VA 3VFEA 2RA0A 4X1QU 3PO1C 2ZO3H 1PQ5A 1K9OE 5T6DA 2ZWLH 2AMDA 1ETTH 3TJOA 5JBCS 2FX4A 1XMNB 1SKYE 1INCA 1AD8H 1ELBA 3CS0A 2SGDE 2BD3A 1SHYA 2W5EA 1XUKA 2ZU2A 3QDZB 4GAWA 4Y11E 1EKBB 2OC1A 4ZUHA 1C2MA 1DE7H 1GCTB 1TPPA 3BIUH 1GHYH 2XBXA 2R3YA 3BTME 3QO6A 4FUFA 1EB2A 1NROH 3UAIC 3RXDA 3SV9A 3OEED 2XYAA 5FBIA 2XBVA 3FZDA 4AYYB 1OP0A 4OS4A 4UFDH 2SGPE 1DWEH 2CMYA 2WINI 1VCWA 4CRDA 1W0JD 3W94A 2D2DA 3RXMA 1O2HA 1FJSA 4MTBA 3PTNA 3QTVH 1BMMH 1JBUH 1SPJA 1P10A 3SU1A 2QF0A 1C5NH 1O2VA 1WBGB 2R0LA 2WPMS 5LPRA 2F91A 3TU7H 2O9QA 3MU8A 1XVOA 1GBHA 2GCHF 3A86A 4WF8A 3V12A 2PLXA 3RC4A 2VWMA 2AERH 2XC0A 4ABBA 1YF4A 1W0YH 3P95A 1TE0A 1HAVB 4HFPB 2HRVA 4I8KA 3TJNA 4ABAA 4DIIH 3WW7A 5LPEA 4HI3A 4U2WA 4XD7D 1LVYA 2GKVE 1GI4A 3UNSA 2WV4A 4IN1A 1O5CB 1SGTA 2FOHA 3FAOA 2AGEX 1S84A 2LP6A 5DP9A 1P06A 2JH6D 1V2QT 4AC9A 3TVJB 3M7UA 3BSQA 4UONA 4PROA 1EAWA 3GDVA 1BTWA 1KDQB 2GJGA 3TH2H 4K1EA 3AAUA 4K1SA 4IGDA 1LPZB 5E8EH 3PROA 3W1EA 1QZ8A 4FUCA 1NN6A 2RDEA 2VJ1A 3SV2H 3PMJA 3I77A 4B2CA 1O36A 2ZIQH 3SU5A 4D7GA 4X2XA 2P16A 1O3BA 2PKSB 1C5SA 2DE8A 3GICB 4ZMAH 1UCYH 3BTKE 3MFJA 4IS5A 4Y7AA 3NUMA 4Q63A 4DCDA 2KCOA 1GBBA 1P2IA 1RXPA 2ZFQH 4I33A 3DCLA 2GV6A 3LH1A 7GCHF 3A7YA 1P09A 1D3QB 4AZ2B 1PQ8A 3AVZA 3BIVH 4B75A 1EASA 1K1JA 3ATIA 8ESTE 2Z3DA 5LH8A 2AEIH 5AVDA 6GCHG 2BY6X 2SNVA 3EAJA 1J16A 1NBMD 1DXWA 1AVGH 3T26A 1YCPM 1NFUA 2PHBA 4MDSA 2QF5A 1N1LA 3N7OA 5FPTA 2I6QA 1MU8B 1BRBE 3SNAA 4E7NA 1AZ8A 5DP4A 4BANB 3T62A 4CBNA 1UK3A 4GCHF 2ZDAH 4K5ZA 1C2FA 2ZFSA 2TGTA 1E37B 2FXRA 3BV9B 3MO9A 1BRUP 5DO4H 1A1RA 1SQTA 3ZZ5A 2EEKA 4B2AA 1GJCB 1NU9A 1SGYE 4ISLA 3VEQB 1J8AA 1W13U 1AUTC 4GLYA 1Y5UT 3F2FA 3I29A 1KTTB 3W95A 4DT4A 1O2KA 2PFEA 5H4IB 2ZDNA 2WPKS 1H4WA 3AAVA 1EFRD 3RXTA 4Y8XA 1O2WA 1ZHRA 2STBE 2BD5A 2BDBA 2SNWA 3OE7D 4WJG2 4WH6A 4X8UH 2R3UA 5FL7D 3BTGE 1SFQB 2IJOB 3RXQA 1O3JA 1WDIA 5JBTA 4Y10E 1AGJA 1TOMH 4ZROA 4X8VH 1FDPA 1BCUH 1FIZA 2UWPA 2VBCA 1GHWH 5EGMA 4ASUD 1GJAB 3RM0H 3VXEH 2GV7A 2RCEA 2FPZA 1O5EH 8KME2 4FUHA 2WYJA 3A7VA 3FOAA 2QGRA 4DGJA 5BPEA 2TPIZ 3T28A 3FN8A 3MTYA 1E0FD 1TMTH 1FIWA 3RXAA 1A0LA 1ELGA 3LGTA 3UNRA 2XBYA 2BQWB 4ABGA 4TT3D 2FOAA 1SGNE 1H9IE 1OYTH 1SGQE 3ZZ6A 2W3IA 1AKSB 1IQFA 4MNWA 1EPTA 3ZVCA 2K1QA 1YPLH 4Q7XA 3VB5A 1C2LA 3T29A 1O3GA 1HIAB 1XM1A 4IC5A 1IHSH 1RFNA 1ZMJA 2BD8A 1GHBG 3MMGA 1SQRA 2WZQA 3SI3H 1B0EA 2M2AA 1DITH 4SGAE 1NZQH 4NCYA 5DPAA 2YNAA 4ACBA 1BUIA 4ESTE 4TYDA 4YO9A 3SOSA 1L2EA 1AFQB 1QB6A 1QJ7B 1A0HB 1BTYA 2EC9H 2D1JA 2ZEBA 3OAAD 4H4FA 1NPMA 3E0PB 5CHAC 4B71A 5GXPA 1D9IA 1Q3XA 2BLOA 5A8XA 1CA0B 1O2IA 2F9VA 2ZGHA 1O5BB 1HAHH 2PP6A 3AASA 2TBSA 1V2NT 4ISHH 2Z9IA 2TRMA 5DN6D 1QJ1B 3AK5A 2C93B 3DUXH 1NFWA 2QY0B 4TY6A 4HGCA 2OINA 4ABDA 2ZC9H 2F3CE 3SUFA 4FU8A 3DFLA 1GBEA 4YLUA 4BAKB 1O3FA 1S81A 4BTTB 2J95A 1GBAA 2BVRH 2ZCLP 4YTAA 3SV7A 2ZU1A 3RXOA 1FI8A 5A0CA 1DM4B 2THFB 3GDUA 1O37A 4F48B 3A8AA 3RXJA 3MU1A 3Q3XA 4XDEA 3SBKA 2AYWA 9ESTA 3PB1E 3KIDU 2ZFTA 1D6RA 4MNVA 2Y6TA 1H9LB 2ANMH 2VU8E 1AFQC 4ISNA 1D3DB 1HBTH 2A31A 4B6EA 5PTPA 1CA0C 1MTNB 1HAXB 3ATWA 2HVXA 2A1DB 1AVWA 3ZYDA 4UFGH 3A81A 1ZRKA 3RDZA 1A5GH 4RI0A 3TNSA 2G81E 1OPHB 3A89A 1Z6JH 3T2NA 1EOLA 2XXLA 3GCHB 3K9XB 1MTSA 4ZXXH 1Z8IB 1C2EA 3F1SB 1GBDA 3ATLA 1K22H 1FPHH 2QXIA 3TK5A 3TK6A 2ZHDA 2A5AA 4ZHAA 3PRBA 4UEHH 1GJ4H 3N7EA 4YT7H 2RFKC 1G32B 1XX9A 1GMDF 1GJ6A 2BD4A 4NIYA 4YOIA 5A0AE 1F2SE 2QAAA 3STIA 1RS0A 4JZIA 2LELA 3MH6A 1TGTA 4Z1MD 2ZTYA 3K2UA 1DLKB 3GISB 2VVUA 3ZVDA 1C1RA 1O3DA 2C90B 5E0GA 4INLA 1FY5A 3RXVA 3MU0A 3E8LA 3F0OA 5HXFA 3RMNH 2ALPA 3UQOA 1OWEA 5A09A 1JRTA 2VIWA 4ABJA 1ESBA 1VITF 1Z6EA 2A45B 4E06H 3MHWU 1QGFA 2Z94A 1UTJA 4GHTA 3UTUH 2J34A 2J97A 2TGDA 2ZHEH 4B6FA 1P3CA 5FX6A 2RDLA 2KFWA 1EZXC 5E2PA 1EAXA 3SV8A 4I86A 2V3MA 1P03A 1KXDA 2A7CA 1ZOMA 1WQSA 3LC5A 1O32A 1ZSLA 1YCPH 2P8OC 1KLIH 2JJ1D 5JBAS 4YXWD 2EA3A 3SZEA 1KY9A 1O2JA 3SU6A 1SGIB 4Q4LA 1V2TT 4ABIA 1QBVH 5F8ZA 2ZU4A 1J15A 5FCRA 3RXIA 1KXEA 3PLPA 2HOBA 5C1UA 3BEFB 3FZZA 1ABJH 2FIRH 2G5VA 1SR5C 1D3TB 1ZZZA 2BM2A 2FWWA 2KCAA 2Z9JA 5C2ZA 1SLWB 1ZPBA 2HLCA 4TPIZ 1GI9B 1C5RA 5IYTA 1P05A 3RU4T 2BOKA 5GDSH 1RTKA 1UMAH 3E6PH 4NWKA 1FN8A 6LPRA 3M7TA 1EAUA 1ZGVA 1A46H 4K2YA 1C9PA 1NTPA 1GI2A 1W0ZU 3NXPA 5EIYA 2ZQ1A 1TOCB 1PPBH 2ZECA 1G36A 4WMEA 4AFZA 3JZ2B 1QA7A 4GPGA 1BZXE 1THSH 2G4UA 1ESTA 2OP9A 2V35A 3CS7A 3LIWA 2GZ8A 1O39A 4BTUB 3PYHA 5FBEA 3GCTG 1GJBB 2A7HA 2P94A 4LZ1H 2Y82A 3B9FH 2Z9LA 1S82A 1XUFA 1GMHG 5J4SA 3LGVA 4NIWA 4O9VA 1FONA 2OBOA 4I31A 3TJVA 1BHXB 5ETXA 1O5DH 1C2IA 5C0UA 1C5XB 4AFSA 2O8UA 2P3UB 4ISOA 4BXSA 3A7ZA 1H8HD 5I25A 3UQVA 1BBRH 5ESBA 4E7RG 4D7FA 3Q3KA 4JZFH 3F2GA 1MTUA 4DG4A 4E05H 2P3TB 5LPFA 1LMWB 3A87A 4XE4A 1DX5M 4WVPE 1S6LA 4CRCA 1H8DH 1UO6A 2FOBA 4ABHA 3U98H 4K60A 3MI4A 5CHBA 2Y5FA 1F0TA 3IG6B 4Y7BA 1TRYA 1CT4E 4DJZB 3LDXH 5A2MH 4FUDA 1FX0B 1THPB 1QHRB 2VINA 2KAIB 1DXPA 4AORA 1O2XA 1HPGA 1K1MA 3RXGA 1KXCA 2VVCA 2QXGA 4P00A 1SQOA 4MPWA 2D26C 2F43B 3F0PA 3IITA 1OWHA 1VJAU 1NBME 2CF8H 1ZRBA 1P3EA 4CHAB 4CRGA 1TYNA 1HNEE 1KXFA 1HXFH 1JWTA 2V0BA 1THRH 1O3PB 5HMAA 4ZXYH 4ZKOU 3M7QA 2BYAX 3QGJA 2WV9A 1Z1JA 1TX7A 1O31A 1GJ9B 2V6NA 4OGYA 5IDKA 2QF4A 2FI5E 1GI0A 2FLRH 1DOJA 3ZVAA 3F9GA 1OHHD 2OQ5A 3B8JA 8GCHF 1UTNA 3PO1B 1IQKA 5JDUB 3STJA 4RT0A 2PW8H 4ISIH 1TBQH 1VZQH 1ZGIA 2UWOA 1MZDA 2G8TA 1J17T 1F92A 2C8WB 3BN9A 5EQRA 1HAZB 2ZPSA 2TGAA 2ZGBH 3SJ9A 3ZZ3A 2XOKD 1W2KH 3LGUA 2O8LA 4Y0YE 5DK1A 5DGJA 8LPRA 1W12U 2VIPA 1QTFA 5E0JA 1O2OA 1DANH 1T7CA 3HK6B 2KCYA 1K21H 1T8OA 1LVBA 5KEDA 3KQ5A 2J2UA 4WWYA 2FOMB 3BTEE 1C5MD 1TNJA 1VGCB 3BTDE 3DSOA 1ORFA 2GVFA 1O0DH 3ZV8A 4UDWH 3UREA 2Z9GA 2H2ZA 3AW1A 1O2YA 3VB7A 1OP2A 3B23B 2HNTC 1O3MA 4IC6A 1BTUA 1C2KA 3SU0A 5DP8A 4SGBE 2GCHG 1ELDE 1DDJA 1V2JT 1W11U 2K8IA 1NM6A 1P2QA 1SB1H 1C1MA 2GMTB 3M36A 3H09A 1O3KA 5JYIA 1SBWA 2VWLA 1O2GH 1W10U 2B0FA 3QTOH 5GNDA 5I46H 3SGQE 3PLKA 3MH5A 4GSOA 4A5TS 1NO9H 1BTXA 2VNTA 5AHGH 4AG1A 3RXFA 1GVKB 1TRMA 1NESE 1UTMA 1A2CH 3OTJE 2KCPA 3ATKA 2PKAB 3A82A 1VGCC 1K1IA 2HNTE 1YYY1 1E34B 4AFQA 1ZYOA 3V13A 2F4LA 1C5UA 2J98B 1L1GA 1W8BH 4RKOB 4Q7YA 5GPIB 5GIBA 1O2RA 4Y71A 1TBZH 3ZZ8A 3D49H 1NU7B 2Y5GA 3M5NA 5KGOA 3OYPA 2Y7ZA 2W6JD 2C8YB 1Z1IA 1GHAF 5EXLA 1YP9A 2GGVB 2GMTC 4MG3A 3RC6A 2FI3E 4K8YA 7GCHG 1GI7B 4ZKNU 4H6SB 3VG8A 1O38A 4IN2A 5EODA 4BAHB 3KCGH 3L3TA 1DWCH 2BDYA 3L6PA 1SLVB 1T32A 3RXUA 1UCYE 1KXBA 3ODDA 7LPRA 1FZZA 1TPOA 3AW0A 6CHAB 2PUXB 5AFZH 1ANDA 3QGNB 1PQ7A 2FESH 4TY7A 1F5RA 3BTWE 2VWNA 1WAYB 5B6LA 1C1PA 1NC6A 1PFXC 2Y7XA 2VH6A 3BTFE 4B1TA 1GHVH 3A8DA 1P9UA 1OS8A 3RLWH 3FO8D 4GCHG 1VITH 1C5ZB 2WPIS 1CGJE 3C27B 2OTVA 1SI5H 2OCVB 4AN7A 2BQ6B 3ENSB 1AU8A 1W3CA 1E1RD 4CH8B 2VIQA 3ZVEA 1E79D 3QX5H 4BNRA 1WXRA 1K2I1 3G01A 2BMGB 1QQUA 2BX4A 2ZU5A 1BTPA 4HZHA 1HGTH 2FEQH 4XFQA 4WH8A 1C2HA 1BTZA 1XUHA 4GHQA 2HPQH 1SFIA 2F9PA 3UR6A 3FP8E 2FI4E 4TPYA 1M9UA 1MQ5A 1BDAA 2XBWA 2EI7A 6CHAC 5T1VA 4RKJB 3RM2H 1TGBA 2A5KA 2J9NA 5BRRE 4IMQA 1EPTC 2OQUA 1F0SA 3KQEA 1QIXB 3M5MA 3VB6A 2SGFE 1YPHC 4ZH8A 1V2MT 1GDQA 5HIYA 5C3NA 1AFEH 2FS9A 1O3AA 1LHGH 1V2OT 2ZFRH 3M3VA 4CRFA 2QIQA 4D76A 1NFXA 1IQMA 1BIOA 1FAKH 2A7JA 1P2JA 4K69A 1BMLA 2ANWA 3FFGA 1AI8H 4X6OA 1TBRH 1UTLM 4DVAU 2CJIA 3H5CB 1U6QA 1LVMA 2HGTH 2ZTXA 1SGPE 3ZYEA 3EA7A 1SGEE 1OOKB 1WSSH 4RSPA 5DP7A 1BB0B 2A2XH 1QNJA 2FODA 4INKA 1NRQH 1MKXK 1DVAH 3SN8A 4FETA 2V3OH 2RA3A 5IK2D 1YPHE 5GCHG 2OC7A 3S7HB 1W14U 1BMAA 2Y81A 3BG8A 1BQYA 3N99A 1UJ1A 2O8WA 3F2HA 3ITIA 3Q77A 1H1BA 1PYTD 2ODYB 1OWJA 4KP0A 3KEEA 1WQVH 1XVMA 3KF2A 1QRXA 3P70B 4DURA 4F4OC 2H5DA 5CHAB 1ELAA 1C5TA 1UTOA 1ID5H 1WV7H 1XXDA 1TNLA 1SMFE 1TRNA 1WYKA 2G4TA 3NKKA 4YZUA 1IQNA 2GDEH 4AGJA 1TNGA 2BQ7B 4IMZA 1CE5A 2Z9KA 1N6XA 2ALVA 1S0RA 3OFND 2BXTH 1YGCH 1NRSH 2P95A 1RTLA 3Q76A 2AGIX 3HKIB 1ANEA 2AMPA 1GMCG 1SL3A 1ELCA 3VB3A 4F55A 1LDTT 1O3IA 1HAVA 2H1UA 1C5LH 1EZQA 1HJ8A 5EG4A 3E91A 2BVSH 1JRSA 2NU2E 3EQ0H 2K0QA 2SGEE 1C1WH 3MYWA 1UHBA 1UTKA 5EXNA 3ZVFA 3BTHE 3U8RH 4U01A 1GI5A 1TGCA 1EP5A 3BTQE 1WOFA 1BJVA 4XBBA 3O8CA 1OSSA 4JZDH 2P93A 4CR5A 1OWDA 1CQQA 2STAE 3KL6A 1HAYB 4OS2A 5EJ1A 2XCFA 1BT7A 3ZZBA 1SLUB 2ZU3A 4JYTA 2GX4A 2KM0A 3D62A 1G2LA 1ZHPA 4TSFD 1ZHMA 1GBIA 1J9CH 1VR1H 4JZ1A 1IOEA 1SC8U 4I7YH 4X1SU 1GJ7B 1RJXB 3GYMA 3RXPA 4I8JA 3KYFA 1CHGA 2OBQA 2ZGXH 3SGBE 4LOYH 1TNHA 1B7XB 1AIXH 1FN6A 5CDFE 2O8TA 1GBFA 3LC3A 1HAIH 2A2QH 2AIQA 2XNDD 3A85A 3NCLA 3U69H 1CHOF 5C67A 3GDSA 4A92A 2G52A 3TGIE 3LGWA 1GCDA 3PTBA 1BHXF 2WPLS 4VGCB 1VCPA 2Z3EA 1E35B 3KGPA 5A8ZA 1QA0A 2VGCB 2PV9B 1ETSH 1VITG 1WCZA 1YKTA 3ZZCA 4ZCNA 1DUEA 4AGKA 1TAWA 1ZTJA 1S0QA 1O5FH 1GBTA 1QQ4A 3A88A 3LH3A 2JETB 1ZTLA 2IPQX 2HVYB 1CBWB 2XW9A 3KQDA 3M3SA 5HIZA 1EJAA 4P02A 1JIRA 1ZJKA 4FXGH 2GTBA 1SOTA 1L4ZA 1P57B 4TWWA 3P92A 5EW2H 1FV9A 2P8OB 3RC5A 3D23A 3SU3A 3GY5A 1KMHB 4HTCH 1LHEH 2NU4E 1P8VC 2BY8X 1LQEA 4DIHH 5FCKA 3SNDA 2QF3A 1O3OA 2J92A 1YWUA 4JZEH 2UUYA 3VB4A 2B7DH 1G3CA 2ZCHP 1T8MA 2H9HA 1FXYA 1LTOA 2A0QB 4VGCC 3P8OA 3OEHD 2VGCC 4HG6A 3NWUA 5EJZA 4Q2KA 2F9NA 1A5IA 1L1JA 2B9LA 3PLBA 3RXKA
chains in the Genus database with same CATH topology
2NU0E 1DUAA 5L30H 1FY8E 2M5TA 1YPMH 4CH2B 1FY1A 2JETC 2ZGJA 5E2OA 5DP3A 2NU1E 3TNTA 1CBWC 2FP7B 4WXVA 3EDXB 3QWCH 1AN1E 3EYDA 2HNTF 1Q2WA 3PWCA 1A7SA 5A0BA 1SHHB 3RXSA 3TH4H 3V7TA 2Y5HA 2FM2A 5HM2A 1KIGH 1WTGH 1AKSA 3PWBA 1C1SA 2BD7A 2VVVA 1EJNA 4NWLA 4FUIA 1C4U2 2BVXH 4H6TA 1HUTH 1ZJDA 1GHZA 4A6LA 2A4QA 1HIAA 2ESTE 1O2MA 2ZKSA 1JXPA 2VH0A 1GBJA 1PQAA 1F5KU 3S9CA 2UUKB 2ZPQA 2FOGA 1O3EA 1MTVA 2QXJA 2F83A 1QRZA 2PR3A 2SGAA 3U8TH 1OYQA 1DY9A 1QL8A 5FX5A 3UUZA 2H5CA 1O2TA 2BHGA 5DG6A 1HB0B 3SJKA 1GVLA 2R2MB 1GJ8B 4AX9H 1EATA 1NT1A 1IQIA 3GCOA 2XC4A 3SNBA 3DT0H 4IBLH 1SGCA 1P12E 3DHKH 4CRBA 4K1TA 1V2ST 1ELVA 2W7UA 3LJJA 4LXBH 5JPMH 1LPGB 2FOEA 3RXLA 1BBRE 2OXSA 4DOQA 1MTWA 3EGKH 3MO6A 1K1NA 3F9EA 1P2MA 1PPCE 5JB9S 4WMFA 1OKXA 1XUJA 5EU8A 1GL0E 2GD4B 2D8WA 1KTSB 4A1VA 1MU6B 1YBWA 1P02A 5GJ4B 2BDGA 2A32A 4BAQB 2BLWA 3TJUA 1MD8A 3KQBA 3KN2A 1CVWH 2AH4X 1T31A 1BRAA 1Z7KA 2CGAA 2ZZUH 3UWJH 1CA8B 1F5LA 5EQQA 2W7SA 2ZCKP 1SGRE 4JYUH 2GZ7A 1LVOA 1X7AC 3M5LA 2OC8A 1MQ6A 8GCHG 1LKBA 2SGQE 2ZI2H 1ZLRA 2YNBA 2ZHWH 4Y8ZA 1AQ7A 1C5WB 2FMJA 3RP2A 1MAXA 2IN2A 1K1LA 2EI6A 1P2NA 3SJ8A 1K1OA 1KSNA 3M37A 1MKWK 1V2PT 2ULLA 5CE1A 2A4OA 4X2YA 1T4UH 5K0HA 1A4WH 1K1PA 4CBOA 1EZUC 4ABEA 1HJ9A 1LO6A 4O03A 2J38A 4NGAH 1QRWA 2BDHA 3BEIB 3HPTB 1KYNA 1O2UA 1GBKA 4CRAA 5DP5A 1DS2E 1C2JA 1C5OH 1XUGA 3BEUA 3Q00A 1BJUA 3RMOH 1GI6A 3GCTF 1C1OA 1TNKA 1N8OC 3MU4A 2WPJS 4NA7A 2O8MA 1CSOE 4KGAA 1PYTC 3RUOA 3R0FA 4Q80A 4DT7B 1FY4A 4R8TB 1BA8B 3VGCC 1Z71A 1XKAC 1YPGH 3UIRA 3URCA 4UFFH 2FX6A 3ELAH 1HAGE 3ODFA 4BOHA 2RG3A 4OS5A 1O3NA 5B6OA 1QY6A 3SUDA 1L0ZA 1HLTH 4KTSA 3S9AA 4R0IA 3MH7A 2PTCE 2C4FH 2G51A 1ELTA 4JK5A 5JBBS 2ZDVH 4ABFA 4MVNA 5F03A 1ELFA 4KTCA 5L6NH 1VJ9U 3Q3YA 1B5GH 2FO9A 1GL1A 1O2ZA 2PSXA 1YM0A 4F49A 1HYLA 1T8LA 3UR9A 3UOPA 5J4QA 4Y76A 5EQSA 1O2SA 1GBCA 4MPVA 1IQEA 1KLJH 1GI8B 1G3EA 3DA9B 1C2DA 1GHAG 4KKDA 1TNIA 1MCTA 2NWNA 4TWYA 2ANYA 3UWIA 3A84A 1V6DA 3LOXA 1OX1A 5C5NA 3E90B 2PWXA 1YPJH 1UVOA 5E0HA 4FUJA 5T6FA 1YPKH 1SLXB 3O8BA 2PSYA 3RXCA 4GVUA 4X1NU 4YOJA 4JK6A 4O3UA 1G9IE 3V3MA 4A1TA 1UK4A 4NG9H 5FPSA 3H7TA 3RLYH 2HWLB 3TITA 3NK8A 3SUEA 1MCVA 2QA9E 1SGDE 1ZPZA 1TIOA 2BY5X 1YLCA 2UUJB 2B8OH 1ZSJA 1CT0E 1DSTA 5TCCA 2BDCA 4YESB 1GDNA 1V2VT 4MPXA 1IQHA 1C5VA 3QZRA 3H7OA 1L1NA 5EPNA 1AUJA 3RMMH 1A0JA 3HKJB 3NZIA 1EZSC 1EB1H 3UPEA 3ZZ9A 4ZAEA 1SG8B 4I8HA 3ZZAA 3PMAB 2W3KA 1HV7A 4ZHMU 1GGDC 5F8XA 4BTIB 1GPZA 4XOJA 5EPYA 3GY4A 3MWIU 1MKXH 1UVSH 2UWLA 1N6YA 3MNXA 1TB6H 2FOFA 5GWZA 1VCQA 4BAOB 1EPTB 2ZFFH 3EE0B 4NA8A 3PV4A 1AWHB 2BDAA 1O3LA 3P8FA 2KAIA 3SHCH 5AF9H 1D6WA 2G55A 4MNXA 5L2YH 2BTCE 2GZ9A 1ZR0A 1QJ6B 1QURH 3ATMA 1MD7A 2Q1JA 4QT8C 2IOTA 2NU3E 1LHFH 1DWDH 1GCTC 3CENA 4NZLA 1UHBB 1BTHH 2W26A 2F9OA 3RU4D 2LPRA 1EUFA 3SI4H 2H9EH 1GHXH 2WPHS 2YOLA 1TX6A 3MNCA 3RXRA 1FPCH 2ZG0H 4AOQA 2BLVA 3GY2A 2ZDMA 1S6HA 1IAUA 3RXBA 3S69A 5DKMA 1Y3WA 1HFDA 4FUEA 4NA9H 1CGHA 1GWAA 1OP8A 1ANBA 1IQJA 1TGNA 5TCAA 2FYQA 3R3GB 5ESTE 1MBMA 4KELA 3RXEA 1ZMLA 5DP6A 3SQEE 2C3SA 5AFYH 4X0WU 1TA2A 5L2ZH 3SGAE 4U30A 4NFFA 4MPUA 3LJOA 4NIVA 2XNIA 1F7ZA 1O5GH 2PUQH 3SNEA 2QYIA 1GG6B 2C8XB 4AG2A 1Z8GA 5G4BA 4WY3A 5C5OA 3UOUA 3ZVGA 1BMNH 1EAIA 3LONA 5FPYA 1GI1A 2WUBA 7ESTE 1JOUB 3HK3B 1DPOA 3OSYA 2A4GA 1QR3E 1GBLA 1AVXA 2BB4A 5F6MA 1RIWB 1Z8JB 4FVDA 3SU2A 1HJAB 3IWMA 2PGQB 1TMUH 4UD9H 3SW2B 1SGFA 5JB8S 1GI3A 3RMLH 1T4VH 3ZZ4A 2BD9A 1EX3A 3TH3H 1HAPH 1C5QA 2CF9H 1JMOH 1FQ3A 2BY9X 2SFAA 2PKSC 3GY3A 3MOCA 1YPEH 1B0FA 2ODPA 1NRNH 4OS6A 1HXEH 3FP6E 4ZHLU 1EJMA 2Z7FE 1V2WT 3BF6H 4J1YA 2Q6FA 3FP7E 4ZKSU 4K8BA 1FMGA 1ZMNA 3A8CA 3GOVB 3TIUA 1IQLA 1AO5A 1C1TA 2OLGA 2AGGX 4NSYA 2ANKH 3M61U 1CGIE 1FAXA 1O3CA 3SJIA 3S0NA 1DLEA 5EXMA 1LQDB 3QN7A 1DT2A 1GG6C 2PKAA 4D8NA 2ZTZA 4XBDA 6GCHF 3OY5U 4FU7A 1ARBA 1ZSKA 3P8GA 1P2OA 4B73A 2XCNA 1UK2A 2VIOA 2FYRA 2ZHQH 1P04A 1TLDA 2HALA 4FUGA 2B5TB 1TPSA 2XWAA 1O35A 1RIWC 2QC2A 2XWBI 4XSKU 4A1XA 3HGPA 1HJAC 3T5FH 3K65B 1NY22 3NPSA 3U1JB 2DUCA 1D3PB 1A5HA 5SGAE 4UFEH 1P9SA 4AB8A 2ZNKH 1IQGA 3FANA 1SSXA 1UCYK 5HGGA 1AY6H 3HGNA 1Y3YA 4X6NA 3M5OA 1QL9A 2OC0A 2QCYA 1CHOG 1ELEE 3SUGA 4NFEA 1ACBE 2A5IA 3SU4A 1EXFA 2VIVA 2ILNA 2Y80A 1GVZA 3PM3A 1TGSZ 1C1UH 3CP7A 1TALA 1G37A 5ABWA 1C9TA 1AWFH 2AS9A 1KDQA 5GCHF 3F9FA 4ZKRU 3M3TA 3TGJE 2Z3CA 3LGIA 2ZP0H 1K28D 1UTQA 4I8GA 1Y59T 4X2WA 2A4RA 3SNCA 2WYGA 3P17H 2OD3B 2TIOA 3O8DA 2LNCA 2FDAA 2BD2A 4H42U 3LGYA 4XBCA 3S7KB 3GY7A 4CR9A 1JIMA 1G3BA 1GMDG 1V2RT 4WMDA 1TMBH 3U8OH 4YT6H 3KNXA 1TPAE 1MAYA 4Y6DA 1L4DA 1AE5A 1V2KT 2FTLE 1PPFE 2GT8A 3P6ZB 2FOCA 1TQ0B 1Y3XA 2P59A 1C5PA 1S85A 4Y8YA 4B2BA 2CN0H 3VXFH 1GJ5H 3SQHE 1C1NA 1AB9B 2R2WU 1XXFA 1ARCA 2ZDKA 4OGXA 4U32A 3SV6A 1GMCF 2BXUH 1GHBF 1S83A 1TABE 3T27A 1HAOH 1J14A 1MH0A 1DFPA 1MUEB 1PPGE 1SOZA 1Y5AT 1CU1A 1FY3A 1AE8H 3QUMP 4X1PU 1EQ9A 1WTHD 3K6ZA 2CV3A 5F8TA 4YM9A 1AMHA 5FXLA 1V2UT 1Y3VA 1P0SH 1DY8A 1TA6A 2BDIA 1HDTH 1NRRH 3URDA 3WY8A 1G3DA 3BG4B 1H9HE 1QCPA 4CREA 1DWBH 3LPRA 1O2LA 2H6MA 3F68H 1S5SA 1T8NA 3TGKE 2ZFPH 3MNSA 1AB9C 2GT7A 3ZVBA 1S6FA 1G30B 2HPPH 1H8IH 1GDUA 1A61H 3MNBA 5CMXH 1AHTH 1O34A 2ZA5A 2ZHFH 3DFJA 5FAHA 3SZNA 2G00A 3HATH 3JZ1B 1UVUH 3KQCA 2AFQB 4LZ4B 3SO3A 1ETRH 3EA9A 2JKHA 1TQ7B 1MTNC 1PPEE 1OWIA 2VIDA 3MO3A 4JYVH 4UE7H 4LK4A 3F9HA 2UUFB 1SGFG 1LCYA 3OX7U 2CXVA 2ZDLA 4JCNA 1DICA 3BG4C 5HYOA 3GCHC 3T25A 4NSVA 2EI8A 4B76A 1UTPA 1WUNH 3DD2H 9LPRA 1YLDA 1MKWH 1OWKA 3GY6A 4OS7A 1BITA 3SORA 2VB0A 1P01A 1D4PB 3BTTE 3GCNA 3V0XA 4MNYA 4K3JA 3E16B 4Y79A 2FS8A 4NZQA 4O97A 5EOKA 4X1RU 3D65E 1RD3B 1XKBC 5T3HA 3GY8A 1LHCH 1UVTH 1SQAA 1CT2E 2ZPRA 1O33A 1HRTH 1O3HA 4Z6AH 1LHDH 5C1YA 4AB9A 1CO7E 2ASUB 2AMQA 1XUIA 5C20A 3E1XB 2H9TH 4MQAA 3UFAA 4NIXA 1TWXB 3OU0A 2R0KA 2PTNA 4O3TA 2G5NA 1Y8TA 4OS1A 2WUCA 3C1KA 7KMEH 4GUXA 2Q6GA 3A7XA 1F0RA 1SVPA 4A7IB 1TX8A 1TFXA 4YLQH 3L33A 3RXHA 1C2GA 1AZZA 1QBNA 2J94A 3UNQA 2Z6BD 3LKWA 4DY7B 4Y0ZE 1LKAA 2QXHA 3GYLB 3UY9A 2AIPA 3SHAH 3U1IB 1QBOA 4YOGA 4X6MA 1C4V2 1RRKA 1V2LT 3A8BA 4J2YB 4BXWA 4Z0KA 1EP6A 2ZQ2A 6ESTA 2FTMA 3QLPH 1C1QA 1C1VH 1E36B 1QL7A 2PGBB 2BY7X 1ESAA 1N8OB 1QFKH 2J4IA 1P11E 2BX3A 4FUBA 2ZF0H 3TK9A 3EA8A 2WV5A 2CHAB 1V3XA 3ESTA 4AYVB 2TGPZ 1F0UA 1FLEE 1RTFB 2GP9B 3VGCB 3I78A 1W7GH 3RU4E 3E3TA 1IHTH 3LU9B 2FZZA 2F9BH 3A83A 1DSUA 3MH4A 1P2KA 2ODQA 3LT3A 2XC5A 3MU5A 1NRPH 4I32A 1PPZA 3A7WA 5T6GA 5EW1H 4D9RA 2XTTB 1C5YB 4MLFB 2BOHB 4FVBA 1ABIH 5TJXA 4JMYA 4B74A 1TONA 2QV1A 1A3EH 1LPKB 1YCPK 3A80A 1PPHE 3QK1A 3K6YA 4INHA 1KLTA 3O8RA 2C8ZB 1OXGA 2P3FH 2BZAA 2IPHA 1O2NA 1Z8RA 3ZZDA 1GBMA 1QB1A 2BLQA 1G2MA 1GMHF 2QN5T 4DW2U 2CHAC 2JH5D 3ZV9A 2BZ6H 4X8TH 1ZTKA 3TPIZ 1KXAA 5C1XA 2Q6DA 3P8NA 1C4Y2 2GCTB 2GDDA 3M35A 3TLOA 2OUAA 1Y5BT 1MMJN 1GJDB 5FHTA 3PMHB 5DJ7A 2VWOA 4IW4E 3ZZ7A 4RN6A 1EOJA 2F9UA 1HCGA 2FLBH 3U9AH 1ZPCA 3PMBB 2DE9A 3QZQA 5A8YA 3KHVA 1BRCE 5LGOA 2JH0D 1YC0A 1E38B 5K7RA 4WXIA 3OY6U 3VPKA 2R9PA 4M7GA 4Q7ZA 1O2PA 1W7XH 1WU1A 1ANCA 4AFUA 1O2QA 2I6SA 4THNH 1O5AB 1Y3UA 1MZAA 1QB9A 1NFYA 3S9BA 4X6PA 3A7TA 2GCTC 3SJOA 4D9QA 4BAMB 4CHAC 3FVFB 5HM9A 1NS3A 1FUJA 1PJPA 4X8SH 1BBRK 2XRCA 3E0NB 1BOQA 1GGDB 4I8LA 1A3BH 4FU9A 2V3HH 1Q31A 3F6UH 4ASHA 2ZGCA 1O30A 1FNIA 1UVPA 1MBQA 1RGQA 4KTUA 4X2VA 3VFEA 2RA0A 4X1QU 3PO1C 2ZO3H 1PQ5A 1K9OE 5T6DA 2ZWLH 2AMDA 1ETTH 3TJOA 5JBCS 2FX4A 1XMNB 1INCA 1AD8H 1ELBA 3CS0A 2SGDE 2BD3A 1SHYA 2W5EA 1XUKA 2ZU2A 3QDZB 4GAWA 4Y11E 1EKBB 2OC1A 4ZUHA 1C2MA 1DE7H 1GCTB 1TPPA 3BIUH 1GHYH 2XBXA 2R3YA 3BTME 3QO6A 4FUFA 1EB2A 1NROH 3RXDA 3SV9A 2XYAA 5FBIA 2XBVA 3FZDA 4AYYB 1OP0A 4OS4A 4UFDH 2SGPE 1DWEH 2CMYA 2WINI 1VCWA 4CRDA 3W94A 2D2DA 3RXMA 1O2HA 1FJSA 4MTBA 3PTNA 3QTVH 1BMMH 1JBUH 1SPJA 1P10A 3SU1A 2QF0A 1C5NH 1O2VA 1WBGB 2R0LA 2WPMS 5LPRA 2F91A 3TU7H 2O9QA 3MU8A 1XVOA 1GBHA 2GCHF 3A86A 4WF8A 3V12A 2PLXA 3RC4A 2VWMA 2AERH 2XC0A 4ABBA 1YF4A 1W0YH 3P95A 1TE0A 1HAVB 4HFPB 2HRVA 4I8KA 3TJNA 4ABAA 4DIIH 5LPEA 4HI3A 4U2WA 1LVYA 2GKVE 1GI4A 3UNSA 2WV4A <